Metagenome / Metatranscriptome Family F083283

Basic Information
Family ID	F083283
Family Type	Metagenome / Metatranscriptome
Number of Sequences	113
Average Sequence Length	40 residues
Representative Sequence	YYSGSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD
Number of Associated Samples	104
Number of Associated Scaffolds	113

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.88 %
% of genes near scaffold ends (potentially truncated)	98.23 %
% of genes from short scaffolds (< 2000 bps)	92.92 %
Associated GOLD sequencing projects	104
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (86.726 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.274 % of family members)
Environment Ontology (ENVO)	Unclassified (23.009 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (47.788 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 29.41% Coil/Unstructured: 70.59%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF01344	Kelch_1	22.12
PF03061	4HBT	11.50
PF13415	Kelch_3	7.96
PF09084	NMT1	4.42
PF03401	TctC	3.54
PF13964	Kelch_6	3.54
PF13308	YARHG	0.88
PF04909	Amidohydro_2	0.88
PF00583	Acetyltransf_1	0.88
PF03466	LysR_substrate	0.88
PF01075	Glyco_transf_9	0.88

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	4.42
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	4.42
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	3.54
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.73 %
Unclassified	root	N/A	13.27 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	86.73 %
Unclassified	root	N/A	13.27 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	86.73 %
Unclassified	root	N/A	13.27 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	79.65 %
Unclassified	root	N/A	13.27 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	64.60 %
Unclassified	root	N/A	13.27 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.65 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	30.09 %
Unclassified	root	N/A	13.27 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5.31 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.65 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	30.09 %
Unclassified	root	N/A	13.27 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	2.65 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.88 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.88 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	30.09 %
Unclassified	root	N/A	13.27 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.65 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.88 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.88 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	30.09 %
Unclassified	root	N/A	13.27 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.65 %
unclassified Burkholderia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia	0.88 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.88 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.88 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	30.09 %
Unclassified	root	N/A	13.27 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.65 %
Variovorax sp. PAMC26660	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. PAMC26660	0.88 %
Burkholderia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp.	0.88 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459020\|G1P06HT01B08KJ	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	704	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1024444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1131	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1061226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	667	Open in IMG/M
3300000955\|JGI1027J12803_109685692	All Organisms → cellular organisms → Bacteria → Proteobacteria	613	Open in IMG/M
3300001164\|JGI11823J13286_1009478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	688	Open in IMG/M
3300002911\|JGI25390J43892_10038695	All Organisms → cellular organisms → Bacteria → Proteobacteria	1144	Open in IMG/M
3300004006\|Ga0055453_10028487	All Organisms → cellular organisms → Bacteria	1426	Open in IMG/M
3300004152\|Ga0062386_100098632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	2243	Open in IMG/M
3300004156\|Ga0062589_101469942	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	668	Open in IMG/M
3300004643\|Ga0062591_101109036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	763	Open in IMG/M
3300005164\|Ga0066815_10047207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	700	Open in IMG/M
3300005175\|Ga0066673_10517974	All Organisms → cellular organisms → Bacteria → Proteobacteria	701	Open in IMG/M
3300005187\|Ga0066675_11370674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	519	Open in IMG/M
3300005332\|Ga0066388_100756855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1570	Open in IMG/M
3300005332\|Ga0066388_105686407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	631	Open in IMG/M
3300005434\|Ga0070709_11109266	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300005436\|Ga0070713_101155958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	749	Open in IMG/M
3300005455\|Ga0070663_100589957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	933	Open in IMG/M
3300005518\|Ga0070699_100075111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2941	Open in IMG/M
3300005554\|Ga0066661_10075897	All Organisms → cellular organisms → Bacteria	1971	Open in IMG/M
3300005610\|Ga0070763_10928545	All Organisms → cellular organisms → Bacteria → Proteobacteria	519	Open in IMG/M
3300005713\|Ga0066905_100062477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp.	2350	Open in IMG/M
3300005764\|Ga0066903_101335256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1342	Open in IMG/M
3300005764\|Ga0066903_105878581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	644	Open in IMG/M
3300005764\|Ga0066903_105950352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	639	Open in IMG/M
3300005921\|Ga0070766_10697080	All Organisms → cellular organisms → Bacteria → Proteobacteria	687	Open in IMG/M
3300006038\|Ga0075365_11330631	Not Available	505	Open in IMG/M
3300006050\|Ga0075028_100448553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	745	Open in IMG/M
3300006163\|Ga0070715_11056538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	509	Open in IMG/M
3300006173\|Ga0070716_100613682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	820	Open in IMG/M
3300006176\|Ga0070765_100981056	Not Available	799	Open in IMG/M
3300006800\|Ga0066660_10313750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1258	Open in IMG/M
3300006880\|Ga0075429_100084721	All Organisms → cellular organisms → Bacteria → Proteobacteria	2763	Open in IMG/M
3300007788\|Ga0099795_10049906	All Organisms → cellular organisms → Bacteria → Proteobacteria	1520	Open in IMG/M
3300009012\|Ga0066710_101374906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1095	Open in IMG/M
3300009089\|Ga0099828_11515024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	591	Open in IMG/M
3300009098\|Ga0105245_12719248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	548	Open in IMG/M
3300009100\|Ga0075418_12319820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	585	Open in IMG/M
3300009792\|Ga0126374_10669508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	776	Open in IMG/M
3300009792\|Ga0126374_11046018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	644	Open in IMG/M
3300010043\|Ga0126380_10350597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1074	Open in IMG/M
3300010046\|Ga0126384_10128654	All Organisms → cellular organisms → Bacteria → Proteobacteria	1918	Open in IMG/M
3300010046\|Ga0126384_11916670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	565	Open in IMG/M
3300010362\|Ga0126377_12767981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	565	Open in IMG/M
3300010362\|Ga0126377_13259381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	525	Open in IMG/M
3300010362\|Ga0126377_13514326	Not Available	507	Open in IMG/M
3300010366\|Ga0126379_13802804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	506	Open in IMG/M
3300010376\|Ga0126381_102688714	Not Available	711	Open in IMG/M
3300010401\|Ga0134121_10039420	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	3853	Open in IMG/M
3300011332\|Ga0126317_10918962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	521	Open in IMG/M
3300012180\|Ga0153974_1047697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	939	Open in IMG/M
3300012204\|Ga0137374_10120039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2421	Open in IMG/M
3300012285\|Ga0137370_10465079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	772	Open in IMG/M
3300012358\|Ga0137368_10415155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	881	Open in IMG/M
3300012361\|Ga0137360_10574263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	964	Open in IMG/M
3300012469\|Ga0150984_107959394	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300012492\|Ga0157335_1027999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	576	Open in IMG/M
3300012893\|Ga0157284_10202253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	599	Open in IMG/M
3300012925\|Ga0137419_11692877	Not Available	539	Open in IMG/M
3300012930\|Ga0137407_11001414	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	791	Open in IMG/M
3300012944\|Ga0137410_10075670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2451	Open in IMG/M
3300012948\|Ga0126375_10950484	All Organisms → cellular organisms → Bacteria → Proteobacteria	695	Open in IMG/M
3300012975\|Ga0134110_10546451	Not Available	532	Open in IMG/M
3300013297\|Ga0157378_10539858	All Organisms → cellular organisms → Bacteria → Proteobacteria	1170	Open in IMG/M
3300014150\|Ga0134081_10248512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	621	Open in IMG/M
3300014199\|Ga0181535_10631383	Not Available	613	Open in IMG/M
3300015372\|Ga0132256_102129240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	666	Open in IMG/M
3300016270\|Ga0182036_10501911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	961	Open in IMG/M
3300016371\|Ga0182034_10124364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1895	Open in IMG/M
3300016387\|Ga0182040_11878073	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	513	Open in IMG/M
3300016445\|Ga0182038_11405813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	625	Open in IMG/M
3300017972\|Ga0187781_11344195	Not Available	528	Open in IMG/M
3300017973\|Ga0187780_10713989	Not Available	723	Open in IMG/M
3300018047\|Ga0187859_10837342	Not Available	529	Open in IMG/M
3300018431\|Ga0066655_11186694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	540	Open in IMG/M
3300018468\|Ga0066662_10231699	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1491	Open in IMG/M
3300018469\|Ga0190270_11886291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	654	Open in IMG/M
3300019887\|Ga0193729_1231739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	603	Open in IMG/M
3300020080\|Ga0206350_11134960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	529	Open in IMG/M
3300021082\|Ga0210380_10157386	All Organisms → cellular organisms → Bacteria → Proteobacteria	1020	Open in IMG/M
3300021402\|Ga0210385_10719306	Not Available	765	Open in IMG/M
3300021444\|Ga0213878_10547117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	511	Open in IMG/M
3300021560\|Ga0126371_12659531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	606	Open in IMG/M
3300021560\|Ga0126371_13487613	Not Available	531	Open in IMG/M
3300022694\|Ga0222623_10278339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	644	Open in IMG/M
3300025315\|Ga0207697_10557006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	504	Open in IMG/M
3300025900\|Ga0207710_10076844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1542	Open in IMG/M
3300027909\|Ga0209382_12074224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	543	Open in IMG/M
3300028714\|Ga0307309_10079145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	758	Open in IMG/M
3300028773\|Ga0302234_10317356	All Organisms → cellular organisms → Bacteria	668	Open in IMG/M
3300028778\|Ga0307288_10220489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	736	Open in IMG/M
3300031199\|Ga0307495_10242031	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300031366\|Ga0307506_10361810	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300031545\|Ga0318541_10329998	Not Available	852	Open in IMG/M
3300031549\|Ga0318571_10471512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	501	Open in IMG/M
3300031564\|Ga0318573_10710372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	540	Open in IMG/M
3300031668\|Ga0318542_10074777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1593	Open in IMG/M
3300031679\|Ga0318561_10701384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	556	Open in IMG/M
3300031718\|Ga0307474_11064859	All Organisms → cellular organisms → Bacteria → Proteobacteria	640	Open in IMG/M
3300031736\|Ga0318501_10400747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	741	Open in IMG/M
3300031779\|Ga0318566_10642794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	515	Open in IMG/M
3300031835\|Ga0318517_10089600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1341	Open in IMG/M
3300031845\|Ga0318511_10177547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	940	Open in IMG/M
3300031897\|Ga0318520_10995116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	529	Open in IMG/M
3300031942\|Ga0310916_10305526	All Organisms → cellular organisms → Bacteria	1348	Open in IMG/M
3300031947\|Ga0310909_11127180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	637	Open in IMG/M
3300032009\|Ga0318563_10004815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6004	Open in IMG/M
3300032066\|Ga0318514_10513495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	638	Open in IMG/M
3300032828\|Ga0335080_11359867	All Organisms → cellular organisms → Bacteria → Proteobacteria	707	Open in IMG/M
3300032892\|Ga0335081_10720289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. PAMC26660	1206	Open in IMG/M
3300032895\|Ga0335074_11445075	Not Available	552	Open in IMG/M
3300032955\|Ga0335076_10277376	Not Available	1568	Open in IMG/M
3300034150\|Ga0364933_122756	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	87.61%
Host-Associated	Host-Associated	11.50%
Engineered	Engineered	0.89%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	80.53%
Plants	Host-Associated → Plants	10.62%
Aquatic	Environmental → Aquatic	7.08%
Fungi	Host-Associated → Fungi	0.89%
Solid Waste	Engineered → Solid Waste	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	78.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.96%
Freshwater	Environmental → Aquatic → Freshwater	4.42%
Sediment	Environmental → Aquatic → Sediment	1.77%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.77%
Marine	Environmental → Aquatic → Marine	0.89%
Peat	Environmental → Terrestrial → Peat	0.89%
Floodplain	Environmental → Terrestrial → Floodplain	0.89%
Roots	Host-Associated → Plants → Roots	0.89%
Mycelium	Host-Associated → Fungi → Mycelium	0.89%
Grass	Engineered → Solid Waste → Grass	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	59.29%
Loam	Environmental → Terrestrial → Soil → Loam	14.16%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.31%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.31%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.65%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.77%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.77%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.89%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.89%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.89%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.89%
Composting	Engineered → Solid Waste → Grass → Composting	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	30.97%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	19.47%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.08%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.31%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.31%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.42%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	2.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.77%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.77%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.89%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.89%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.89%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.89%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	13.27%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.50%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.19%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.31%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.54%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.54%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.54%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	2.65%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.65%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.77%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.77%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.77%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.89%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.89%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.89%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.89%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.89%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.89%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.89%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.89%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.89%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.89%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.89%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.89%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.89%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459020	Litter degradation NP2	Engineered	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001164	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1	Environmental	Open in IMG/M
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300004006	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005164	Soil and rhizosphere microbial communities from Laval, Canada - mgLAC	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011332	Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012180	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG	Host-Associated	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Host-Associated	Open in IMG/M
3300012893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014199	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300018047	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021444	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028714	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196	Environmental	Open in IMG/M
3300028773	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2	Environmental	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031549	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24	Environmental	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031835	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032066	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300032895	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300034150	Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F083283

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2NP_01140820	2170459020	Switchgrass, Maize And Mischanthus Litter	YAGTVNVVRLTHDGQVLVERMELDIPREVEPVYVP
AF_2010_repII_A100DRAFT_10244442	3300000655	Forest Soil	AAYYSGSPEYAGTVNVVRLTAAGKVAVTRVPLGIAREPSAID*
AF_2010_repII_A100DRAFT_10612262	3300000655	Forest Soil	AYYSGSPEYAGTVNVVRLTAAGKVAVTRVPLGIAREPSAID*
JGI1027J12803_1096856922	3300000955	Soil	EYAGTVNVVRLSAGGKVTVARAELDIAREPSAVD*
JGI11823J13286_10094781	3300001164	Forest Soil	AYYSGSPEYAGTVNVVRLAATGDVAVTRVELDIAREPSAVE*
JGI25390J43892_100386954	3300002911	Grasslands Soil	YSGSPEYAGTINMVRLSAGGDIAVTRAALEIAREPSAVD*
Ga0055453_100284874	3300004006	Natural And Restored Wetlands	SPEYTGTVNVVRLTPAGEVVVTREPLDITRDPFAPPPADE*
Ga0062386_1000986324	3300004152	Bog Forest Soil	VAAYYSGSPEYAGTVNVVRLNAAGNVEVRRAELDIAREPSALV*
Ga0062589_1014699421	3300004156	Soil	AAYYSGSPEYAGTVNLVRLTRDGRVVVAQQELDIARDVDPPFVPD*
Ga0062591_1011090361	3300004643	Soil	YYSGSPEYAGTVNVVRLSAASGVAVTRAELDVAREPSAVE*
Ga0066815_100472072	3300005164	Soil	AYYSGSPEYAGTVNVVRLTTAGDVAVTRAELDIAREPSAVE*
Ga0066673_105179742	3300005175	Soil	RVAAYYSGSPEYTGTVNVVRLTRSGDVVVTQVQLDIAREVAPLYIAE*
Ga0066675_113706741	3300005187	Soil	TKVGAVTAYYSGSPEYAGTVNVVRLTSTGTVSVERAAVDIAREPAALD*
Ga0066388_1007568554	3300005332	Tropical Forest Soil	VAAFYSGSPEYAGTVNVVRLGASGQVAVTRAELDIAREPSAVD*
Ga0066388_1056864072	3300005332	Tropical Forest Soil	AYYSGSPEYAGTVNVIRLSGNGDVNVTRAALDVAREPSADASA*
Ga0070709_111092661	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	NGVVPAYYSGSPEYAGTINVVRLGEAGVTVIRAPLDIARELVD*
Ga0070713_1011559582	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	AYYSGSPEYAGTVNVVRLTPAGEVAVRRAALDIAREPSAVD*
Ga0070663_1005899571	3300005455	Corn Rhizosphere	GSPEYSGTVNVVRLTRDGHVLVERMELDIPRELEPVYVP*
Ga0070699_1000751116	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	AYYSGSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD*
Ga0066661_100758971	3300005554	Soil	AGTVNVVQLCADGKVAVTRAPLEIAREPSAVDYT*
Ga0070763_109285452	3300005610	Soil	YSGSPEYAGTINVVRLSEIGGVTVTRAPLDIAREVTD*
Ga0066905_1000624773	3300005713	Tropical Forest Soil	YYSGSPEYAGTVNVVRLTGEGQVLVSLLELDIPREVEPIFVP*
Ga0066903_1013352563	3300005764	Tropical Forest Soil	PEYAGTVNVVRLTATGEVAVTRAALDIAREPSAVD*
Ga0066903_1058785811	3300005764	Tropical Forest Soil	VEAHYSGSPEYAGTVNVVRLGSTGAVRVERTAVAVAREPAALD*
Ga0066903_1059503522	3300005764	Tropical Forest Soil	YSGSPEYAGTVNVVRLTAAGAVAVTRAALDIAREPSAVD*
Ga0070766_106970803	3300005921	Soil	GGTTAHYSGSPEYAGTINLVRLTRQGEVVVSHLALDIAREPCAFED*
Ga0075365_113306311	3300006038	Populus Endosphere	SPEYAGTVNVVRLTGGGDVAVARAELNIAREPSAVD*
Ga0075028_1004485531	3300006050	Watersheds	YYSGSPEYAGTVNVVRLTPAGEVAVTRAALDIAREPSAVD*
Ga0070715_110565381	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	AAYYSGSPEYAGTVNVVRLAGSGGVAVARAHLAIAREPSAVD*
Ga0070716_1006136821	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	GSPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE*
Ga0070765_1009810563	3300006176	Soil	GSPEYAGTINVVRLSEAGGVTVTRAPLDIAREISD*
Ga0066660_103137501	3300006800	Soil	KVGAVTAYYSGSPEYAGTVNVVRLNSTGTVSVERAAVDIAREPAALD*
Ga0075429_1000847211	3300006880	Populus Rhizosphere	VAAYYSGSPEYAGTVNVVRLTHAGQVVVARTELDIAREPSA*
Ga0099795_100499063	3300007788	Vadose Zone Soil	YSGSPEYAGTVNVVRLVASGEVVVTLHELDIAREVEPVFVP*
Ga0066710_1013749061	3300009012	Grasslands Soil	AYYSGSPEYAGTVNVVRLTPAGEVAVRRAALDIAREPSAVD
Ga0099828_115150242	3300009089	Vadose Zone Soil	YSGSPEYAGTVNVVRLTPTGDVTVTRLDLDIAREPSA*
Ga0105245_127192482	3300009098	Miscanthus Rhizosphere	NCAGKVRHVATYCSGSPEYAGIFNVVRLGAAGSVAVTRAELDIAREPSAVE*
Ga0075418_123198202	3300009100	Populus Rhizosphere	SGSPEYAGTVNVVRLTAGGDVAVARAELDIAREPSAVE*
Ga0126374_106695082	3300009792	Tropical Forest Soil	YYSGSPEYAGTINVVRLTSGGQVVVDRIDLDIPREVEPQYVP*
Ga0126374_110460181	3300009792	Tropical Forest Soil	GSPEYAGTVNVVRLTATGEVAVTRAALDIAREPSAVD*
Ga0126380_103505972	3300010043	Tropical Forest Soil	VGAVAAYYSGSPEYAGAVNVVRLTPAGEVAVTRAALDIAREPSAVD*
Ga0126384_101286543	3300010046	Tropical Forest Soil	YYSGSPEYAGTVNVVRLTRDGRVLVERMELDIPREVEPVYVP*
Ga0126384_119166701	3300010046	Tropical Forest Soil	YSGSPEYAGTVNVVRLTRDGQVLVTRMELNIPREVEPVYVP*
Ga0126377_127679812	3300010362	Tropical Forest Soil	AKVGAVAAYYSGSPDYAGTVNVVRLTAGGDVAVARGEHDIAREPSAVD*
Ga0126377_132593812	3300010362	Tropical Forest Soil	EYAGTVNVVRLTAAGAVAVTRTALDIAREPSAVD*
Ga0126377_135143261	3300010362	Tropical Forest Soil	AGTVNVVRLTSAGEVEVSQHALDIPREVAPIYVPD*
Ga0126379_138028041	3300010366	Tropical Forest Soil	YYSGSPEYAGTVNVVRLTGDGQVLVSLMELDIPREVEPVFVP*
Ga0126381_1026887142	3300010376	Tropical Forest Soil	YYSGSPEFAGTVNVVRMSEATGVTVTRVALNIARELSE*
Ga0134121_100394201	3300010401	Terrestrial Soil	AYYSGSPEYAGTANLVRLTPAGQVKVSRLKLDIAREVEPQFVPD*
Ga0126317_109189621	3300011332	Soil	YYSGSPEYAGTVNVVRLGAAGAVVVTRAELDIAREPSAVE*
Ga0153974_10476971	3300012180	Attine Ant Fungus Gardens	YSGSPEYAGTVNVVRLIAGGEVAVTRAALDIAREPSAVD*
Ga0137374_101200396	3300012204	Vadose Zone Soil	EYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD*
Ga0137370_104650792	3300012285	Vadose Zone Soil	EYAGTINVVRLSAGGDIAVTRAALEVAREPSAVD*
Ga0137368_104151552	3300012358	Vadose Zone Soil	VAAYYSGSPEYAGTINVVRLSAGGDIAVTRAALEVAGEPSAVD*
Ga0137360_105742632	3300012361	Vadose Zone Soil	SPEYAGTVNVVRLTVAGGVAVTRAALDIAREPSAVD*
Ga0150984_1079593942	3300012469	Avena Fatua Rhizosphere	NGTVAAYYSGSAEYAGTVNVVRLTGSGQVLVERMELDIPREVEPVYVP*
Ga0157335_10279991	3300012492	Arabidopsis Rhizosphere	YYSGSPEYAGTVNVVRLSPGGQVLVEWMELDIPREVEPVYVP*
Ga0157284_102022532	3300012893	Soil	AAYYSGSPEYAGTVNVVRLSAAGGVAVTRAELDIAREPSAVE*
Ga0137419_116928772	3300012925	Vadose Zone Soil	EYAGTANVIHLTTTGEVAVARAALDIAREPSAVD*
Ga0137407_110014143	3300012930	Vadose Zone Soil	YSGSPEYAGTVNLVRLTASGQVEVERAALDIAREPSALGE*
Ga0137410_100756701	3300012944	Vadose Zone Soil	AYYSGSPEYAGTVNVVRLTSAGQVLVERMELEIPREVEPVYVP*
Ga0126375_109504842	3300012948	Tropical Forest Soil	SGSPEYAGTVNLVRLTGAGEVVVTRMALDIAREVEPEYVP*
Ga0134110_105464511	3300012975	Grasslands Soil	SPEYAGTVNVVRLTGEGQVLVSLLELDIPREVEPVFVP*
Ga0157378_105398583	3300013297	Miscanthus Rhizosphere	YSGSPEYAGTVNVVRLSAAGGVAVTRAELDIAREPSAVE*
Ga0134081_102485122	3300014150	Grasslands Soil	AYYSGSPEYAGTVNVVRLTSTGTVSVERAAVDIAREPAALD*
Ga0181535_106313831	3300014199	Bog	SGSPEYAGTVNVVRLGDTGGVTVTHAPLDIAREISD*
Ga0132256_1021292402	3300015372	Arabidopsis Rhizosphere	GSPEYAGTVNVVRLTAGGGVAVARAELDIAREPSAVD*
Ga0182036_105019111	3300016270	Soil	SGSPEYAGTVNVVRLTAAGAVAVTRAALDIAREPSAVD
Ga0182034_101243641	3300016371	Soil	SPEYAGTVNVVRLTATGEVAVTRATLDIAREPSAVD
Ga0182040_118780731	3300016387	Soil	YYSGSPEYAGTVNVVRLTAGGQVEVTRAALDIAREPSSLDA
Ga0182038_114058132	3300016445	Soil	YSGSPEYAGTVNVVRLTAAGKVAVTRVPLGIAREPSAID
Ga0187781_113441952	3300017972	Tropical Peatland	GSPEYSGAVNVVRLSETEGVVVTRAPLDIARETGD
Ga0187780_107139891	3300017973	Tropical Peatland	PAYYSGSPEYSGGVNVVRLSPTDGVTVARAPLDIAREPT
Ga0187859_108373422	3300018047	Peatland	YSGSPEYAGTVNVVRLSEASGVTVTRAPLDITRETTE
Ga0066655_111866942	3300018431	Grasslands Soil	RATKVGAVTAYYSGSPEYAGTVNVVRLTSTGTVSVERAAVDIAREPAALD
Ga0066662_102316993	3300018468	Grasslands Soil	AAYYSGSPEYAGTVNVVRLTAGGEVAVTRAALDIAREPSAVD
Ga0190270_118862913	3300018469	Soil	SPEYAGTVNVVRLTAAGDVSVTRAALDIAREPSAID
Ga0193729_12317392	3300019887	Soil	YYSGSPEYAGTVNVVRLTVAGDVAVTRAELDIAREPSAVE
Ga0206350_111349601	3300020080	Corn, Switchgrass And Miscanthus Rhizosphere	AYYSGAPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE
Ga0210380_101573861	3300021082	Groundwater Sediment	YYSGSPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE
Ga0210385_107193061	3300021402	Soil	GSPEYAGTVNVVRLSVASGVTVTRAPLEIAREVPE
Ga0213878_105471171	3300021444	Bulk Soil	GSPEYAGTVNVVRLTPAGEVAVTRVALDIAREPSAVD
Ga0126371_126595312	3300021560	Tropical Forest Soil	YAGTVNVVRLTGDGQVLVSLMELDIPREVEPVFVP
Ga0126371_134876131	3300021560	Tropical Forest Soil	NGAVPAYYSGSPEFAGTINVVRMSEASGVTVTRAPLDIARELSE
Ga0222623_102783392	3300022694	Groundwater Sediment	GNGLAAYYSGSPEYAGTVNVVRLTRTGDVVVARSELDIAREPSA
Ga0207697_105570061	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	SGSPEYAGTVNVVRLGAAGAVAVTRAELDIARAPSAVE
Ga0207710_100768444	3300025900	Switchgrass Rhizosphere	GSPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE
Ga0209382_120742242	3300027909	Populus Rhizosphere	KVGDGVAAYYSGSPEFAGTVNVVRLTHAGQVVVARTELDIAREPSA
Ga0307309_100791451	3300028714	Soil	YYSGSPEYAGTVNVVRLTAAGDVAVTRAELDIAREPSAVE
Ga0302234_103173561	3300028773	Palsa	VVPAYYSGSPELAETVNVVRLGIGGVTVRREPLDGRGASGIA
Ga0307288_102204893	3300028778	Soil	SPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE
Ga0307495_102420311	3300031199	Soil	GSPEYAGTANVIRLTSKGEVAVTRAALDIAREPSAVD
Ga0307506_103618101	3300031366	Soil	YSGSPEYAGTVNLIRLAAGGQVTVTREALDITRDPFAV
Ga0318541_103299981	3300031545	Soil	YSGSPESAGTVNVVRLGDGGVTVTRAPLDIVREIID
Ga0318571_104715122	3300031549	Soil	AYYSGSPEYAGTVNVVRLTPAGEVAVTRVALDIAREPSAVD
Ga0318573_107103721	3300031564	Soil	YYSGSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD
Ga0318542_100747773	3300031668	Soil	GSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD
Ga0318561_107013841	3300031679	Soil	YSGSPEYVGTVNVVRLTAAGEVAVTRAALDIAREPSAVD
Ga0307474_110648591	3300031718	Hardwood Forest Soil	VVPAYYSGSPEYAGTINVVRLGKSGVTVTQAPLDIAREVVD
Ga0318501_104007472	3300031736	Soil	YYSGSPEYVGTVNVVRLTAAGEVAVTRAALDIAREPSAVD
Ga0318566_106427941	3300031779	Soil	VPAYSGSPEYAGTVNVVRLTVAGGVAVTRAALDIAREPSAVD
Ga0318517_100896002	3300031835	Soil	YSGSPEYAGTVNVVRLGSTGALRVERTAVSVAREPAALE
Ga0318511_101775472	3300031845	Soil	YYSGSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPPAVD
Ga0318520_109951162	3300031897	Soil	PEYAGTVNVVRLTAAGAVAVTRAALDIAREPSAVD
Ga0310916_103055264	3300031942	Soil	KASYCGSPSYAGSVNLVRLTAMGGVEVQRTKLDVAREPWATE
Ga0310909_111271802	3300031947	Soil	PEYAGTVNVVRLTAGGQVEVTRAALDIAREPSSLGV
Ga0318563_100048159	3300032009	Soil	AVAAYYSGSPEYAGTVNVVRLTATGEVAVTRAALDIAREPSAVD
Ga0318514_105134952	3300032066	Soil	EYAGTVNVVRLTAGGQVEVTRAALDIAREPSSLGV
Ga0335080_113598671	3300032828	Soil	AVPAYYSGSPEFAGTVNLVRLGEAGVTVTRAPLDIAREIVE
Ga0335081_107202893	3300032892	Soil	YYSGSPEYAGTVNVVRLGRGGVTVTRAPLDIAREPID
Ga0335074_114450751	3300032895	Soil	YSGSPEYTGTINVVRMSESAGVTITRAPLDIAREVTG
Ga0335076_102773761	3300032955	Soil	GAVPAYYSGSPEYSGAINVVRLSAMSGVTVTRAPLDIAREQSD
Ga0364933_122756_2_130	3300034150	Sediment	AAYYSGSPEYAGTVNVVRLIAAGDVEVIRAELDIAREPSAVG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign