Basic Information | |
---|---|
Family ID | F083277 |
Family Type | Metagenome |
Number of Sequences | 113 |
Average Sequence Length | 40 residues |
Representative Sequence | LTALCPVSQWDAVFASQVDSVITSPVVNPVPDESFAVPS |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.35 % |
% of genes from short scaffolds (< 2000 bps) | 79.65 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (83.186 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (44.248 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.150 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.381 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF13759 | 2OG-FeII_Oxy_5 | 35.40 |
PF00565 | SNase | 1.77 |
PF04773 | FecR | 0.88 |
PF01391 | Collagen | 0.88 |
PF00959 | Phage_lysozyme | 0.88 |
PF13479 | AAA_24 | 0.88 |
PF00856 | SET | 0.88 |
PF01476 | LysM | 0.88 |
PF03783 | CsgG | 0.88 |
PF10614 | CsgF | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 83.19 % |
All Organisms | root | All Organisms | 16.81 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 44.25% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 20.35% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.62% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.31% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 4.42% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.65% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.65% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.77% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.77% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.89% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.89% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.89% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.89% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.89% |
Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
3300003690 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly | Environmental | Open in IMG/M |
3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
3300025027 | Marine viral communities from the Pacific Ocean - LP-31 (SPAdes) | Environmental | Open in IMG/M |
3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
3300025667 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOWin2010_1000057729 | 3300000117 | Marine | CPVSQWDTVFASQVESVITSPVVPPVPDTSFSVPS* |
JGI24006J15134_100181601 | 3300001450 | Marine | SKADLVALCSVSQWDAVFASQVDSVITNPVVNPTADESFSVPS* |
JGI24006J15134_101851021 | 3300001450 | Marine | LVAICPVSRWDTIFASQVDSVITNPVVFSTPDNEFNVPS* |
JGI24005J15628_101610152 | 3300001589 | Marine | LVAICPVSRWDTIFASQVDSVITNPVVFSTPDTDFNVPS* |
JGI24513J20088_10176272 | 3300001720 | Marine | ALTALCPVSRWDAVFASQVESVITSPVVPPVPDESFSVPS* |
KVRMV2_1001015692 | 3300002231 | Marine Sediment | PVSQWDTVFASQVDSVITNPPTLSTPDQAFSVPS* |
KVWGV2_100154061 | 3300002242 | Marine Sediment | SNANLVAICPVSQWDAVFASQVDSVITNPPVQSTPDQAFSVPS* |
KVWGV2_1002668613 | 3300002242 | Marine Sediment | WTNAQLVALCPVSAWDAVFASQVDSVITNPPAVSTPDNDFNVPS* |
KVWGV2_101884433 | 3300002242 | Marine Sediment | NLVALCPVSQWDVVFASQVDSVITNPPAVSTPDIDFNVPS* |
KVWGV2_104095781 | 3300002242 | Marine Sediment | AALTAMCPTSSWDVVFASQVDSVITNPPSNPVPDEAFSVPSS* |
PicViral_10027496 | 3300003690 | Marine, Hydrothermal Vent Plume | FNLAALIAMCPTSLWDDVFDSQVESVITSPVVQPVPDESFSVPS* |
Ga0066851_102582851 | 3300005427 | Marine | AALTAMCPTSLWDSVFASQVDSVITNPIVPAVPDTAFEVPSS* |
Ga0066850_103450883 | 3300005605 | Marine | SFNLAALTAMCPTSLWDSVFASQVDSVITNPIVPAVPDTAFEVPSS* |
Ga0075441_100041021 | 3300006164 | Marine | PVSRWDAVFASQVESVITSPVVPPVPDTSFSVPS* |
Ga0075447_101321782 | 3300006191 | Marine | TSLWDDVFASQVDSVITNPIVNPVPDEAFPVPSS* |
Ga0075448_101412362 | 3300006352 | Marine | FNLAALTALCPVSQWDLVFASQVESVITSPVVPPVPDTSFSVPS* |
Ga0098033_11243902 | 3300006736 | Marine | FSKSDLTALCPTSQWDDVFASQVDSVITSPVVQPVPDESFAVPS* |
Ga0098040_10093186 | 3300006751 | Marine | LVALCPVSQWDAVFASQVDSVITNPPSQPVADNSFAVPS* |
Ga0098039_11072723 | 3300006753 | Marine | TSSWDVVFASQVESVITSPVVPPVPDEAFAVPSS* |
Ga0098039_11744551 | 3300006753 | Marine | LCPTSQWDDVFASQVDSVITSPVVNPVPDESFAVPS* |
Ga0098039_12401801 | 3300006753 | Marine | FNLAALTALCPVSHWDTVFASQVASVITSPVVPPVPDTSFAVPS* |
Ga0098039_12766771 | 3300006753 | Marine | SKAEIVELCPVAQWDTVFASQVDSVITNPAVPATPDNDFSIPS* |
Ga0098044_10632645 | 3300006754 | Marine | SNADLVALCPVSQWDAVFASQVDSVITNPPSDPVPDNSFSVPS* |
Ga0098044_12154442 | 3300006754 | Marine | SKSDLTALCPTSQWDAVFASQVDSVITSPVVNPVPDESFAVPS* |
Ga0098044_13085972 | 3300006754 | Marine | SNADLVALCPVSQWDAVFASQVDSVITNPPSDPVPDDSFSVPS* |
Ga0098054_11237833 | 3300006789 | Marine | AMCPVSQWDAVFASQVDSVITNPPSDPVPDQAFTVPSS* |
Ga0098055_11865491 | 3300006793 | Marine | CPTSHWDDVFASQVDSVITNPVVNPVPDESYTIPS* |
Ga0075467_106626952 | 3300006803 | Aqueous | AALTALCPVSHWDTVFASQVESVITSPVVPPVPDESFSVPS* |
Ga0098060_11689391 | 3300006921 | Marine | AKSSFNLAALTAMCPVSQWDAVFASQVDSVITNPATPAVPDQDFAVPSS* |
Ga0098053_10262911 | 3300006923 | Marine | NLAALTAMCPTSQWDAVFASQVESVITSPVVPPVPDEAFAVPSS* |
Ga0098051_10680771 | 3300006924 | Marine | PVSQWDAVFASQVDSVITNPATPAVPDQDFAVPSS* |
Ga0098041_11558112 | 3300006928 | Marine | LTAMCPVSQWDAVFASQVDSVITNPPSDPVPDQAFTVPSS* |
Ga0098041_12875212 | 3300006928 | Marine | LCPTSQWDIVFASQVDSVITSPVVEPVPDESFAVPS* |
Ga0098036_100449612 | 3300006929 | Marine | EGIFPTAKWDAIFASQVDSVITNPPVKPVPDTAYTIPS* |
Ga0075444_101127411 | 3300006947 | Marine | ALTALCPVASWDAVFASQVDSVITNPVVDPVPDTAFAVPS* |
Ga0098046_10082581 | 3300006990 | Marine | NADLVAICPVSQWDAVFASQVDSVITNPPVQSTPDQSFNVPS* |
Ga0070747_10187051 | 3300007276 | Aqueous | KSSFNLAALTAMCPVSQWDAVFASQVDSVITNPVVNPVPDEAFTVPSS* |
Ga0110931_11198242 | 3300007963 | Marine | ALCPVSAWDAVFASQVDSVITNPPAVSTADTDFNVPS* |
Ga0114898_10500331 | 3300008216 | Deep Ocean | LMPTDHWDTVFASQVDSVITSPVVPPTADESFSIPS* |
Ga0114899_12251552 | 3300008217 | Deep Ocean | TALCPTSSWDAVFASQVDSVITNPPSDPVPDESFAVPS* |
Ga0114904_10701461 | 3300008218 | Deep Ocean | ICPVSQWDTVFASQVDSVITNPPVESTPDKEFNVPS* |
Ga0114905_11184071 | 3300008219 | Deep Ocean | AALTALCPTSHWDAVFASQVESVITSPVVQPVPDEAFAVPSS* |
Ga0114916_10726391 | 3300008221 | Deep Ocean | ALTAMCPVSKWDVVFASQVESVITNPVVNPVPDEAFPVPSS* |
Ga0117901_10069308 | 3300009103 | Marine | PVSQWDTVFASQVDSVITNPIVPPVPDTDFAVPSS* |
Ga0118722_10724678 | 3300009376 | Marine | TSQWDTVFASQVDSVITNPVVPPVPDEAFAVPSS* |
Ga0114993_100874741 | 3300009409 | Marine | LAALTALCPVSHWDLVFDSQVDSVITNPVVNPVPDTSFVVPS* |
Ga0114902_10905032 | 3300009413 | Deep Ocean | SKSELEALCPTSHWDTVFASQVDSVITSPVVHPVPDTAYTIPS* |
Ga0114909_11429852 | 3300009414 | Deep Ocean | ICPVSQWDTVFASQVDSVITNPPVESTPDQEFSVPS* |
Ga0114915_10936811 | 3300009428 | Deep Ocean | FYLAALTALCPVSHWDAVFASQVASVITSPVVPPVPDESFSVPS* |
Ga0115003_102290761 | 3300009512 | Marine | AKGSFNLAALTALCPVAKWDAVFASQVESVITSPVVPPVPDTSFSVPS* |
Ga0115003_108481761 | 3300009512 | Marine | ADLVALCSIAQWDAVFASQVDSVITNPVSNPTADESFSVPS* |
Ga0115003_109085181 | 3300009512 | Marine | NLAALTALCPVSHWDAVFTSQVESVITSPVVPPVADTSFSVPS* |
Ga0114914_10124131 | 3300009601 | Deep Ocean | CPVSRWDAVFASQVESVITSPVVPPVPDESFSVPS* |
Ga0114900_11163961 | 3300009602 | Deep Ocean | EIEALMPISHWDEVFASQVDSVITSPVVPPTADESFSIPS* |
Ga0114911_11354311 | 3300009603 | Deep Ocean | PISHWDEVFASQVDSVITSPVVPPTADESFSIPS* |
Ga0114911_12021951 | 3300009603 | Deep Ocean | TSQWDVVFASQVDSVITNPPSNPVPDEAFTVPSS* |
Ga0114901_10243761 | 3300009604 | Deep Ocean | PIALWDGVFASQVDSVITNPPKLPESDTDFTIPS* |
Ga0114901_10326161 | 3300009604 | Deep Ocean | PVSQWDAIFASQVDSVITSPVVPPVADESFAVPS* |
Ga0114901_10401771 | 3300009604 | Deep Ocean | PVSHWDTVFASQVDSVITNPPTQSTPDQAFSVPS* |
Ga0114906_12246051 | 3300009605 | Deep Ocean | ICPVSEWDTIFASQVDSVITNPPVESTPDQAFSVPS* |
Ga0098056_13201733 | 3300010150 | Marine | CPVSKWDAVFASQVDSVITNPAAASTPDEAFSVPS* |
Ga0098059_11719611 | 3300010153 | Marine | KGTFSKSDLTALCPTSQWDTVFASQVDSVITSPVVNPVPDESFAVPS* |
Ga0098059_12120721 | 3300010153 | Marine | TSSWDAVFASQVDSVITNPIVPAVPDTAFEVPSS* |
Ga0114934_104913602 | 3300011013 | Deep Subsurface | CPVSHWDTIFASQVNSVITSPVSAPVADHGFAVPS* |
Ga0114934_105131161 | 3300011013 | Deep Subsurface | TKAQLEALCPVSKWDEVFASQVDSVITNPVVTPVADTDYSIPS* |
Ga0180120_101945111 | 3300017697 | Freshwater To Marine Saline Gradient | SWSNADLVALCPVSHWDVVFASQVDSVITNPVVFSTPDTEFNVPS |
Ga0181387_10692091 | 3300017709 | Seawater | NAQLVALCPVSQWDAVFASQVDSVITNPPAENTPDNDFNIPS |
Ga0181383_11584312 | 3300017720 | Seawater | PTAHWDTVFASQVDSVITNPPTQAVADNDFSVPSS |
Ga0181417_11214641 | 3300017730 | Seawater | NLAALTAMCPVSQWDDVFASQVESVITSPVVQPVPDQAFTVPSS |
Ga0181416_10032058 | 3300017731 | Seawater | LVAICPISKWDVVFASQVDSVITNPPVESTPDRAFNVPS |
Ga0181427_11232051 | 3300017745 | Seawater | ALCPVSHWDTVFASQVDSVITNPVVSPTADESFSIPS |
Ga0181427_11418381 | 3300017745 | Seawater | LVALCPVSQWDAVFASQVDSVITNPPAENTPDNDFNIPS |
Ga0181389_10122931 | 3300017746 | Seawater | ADLVAICPVSQWDAVFASQVNSVITNPPVESTPDQAFSVPS |
Ga0187219_11930001 | 3300017751 | Seawater | GRKKSQLEALCPTSHWDVVFASQVDSVITNPVVTPVPDTAYSIPS |
Ga0181385_12155811 | 3300017764 | Seawater | AICPVSQWDTVFASQVDSVITNPPVESTPDSAFNVPS |
Ga0181406_10965561 | 3300017767 | Seawater | TNANLVAICPVSLWDTVFASQVDSVITNPPVESTPDEAFSVPS |
Ga0181406_11308332 | 3300017767 | Seawater | LTAMCPVSQWDAVFASQVESVITSPVVQPVPDQAFTVPSS |
Ga0181432_10851691 | 3300017775 | Seawater | LAALTALCPVSRWDAIFASQVDSVITSPVVPPVADESFAVPS |
Ga0211503_103604181 | 3300020478 | Marine | ALTAMCPTSQWDAVFASQVDSVITNPPSDPVPDTDFAVPSS |
Ga0207885_1138493 | 3300025027 | Marine | IEALCPTSQWDGVFASQVDSVITNPVVNPVPDTSYAIPS |
Ga0207901_10449572 | 3300025045 | Marine | AALTALCPVAQWDAVFASQVDSVITSPVVPPVPDTAFAVPS |
Ga0207902_10388601 | 3300025046 | Marine | AALTALCPVSSWDAIFASQVASVITSPVVPPVADESFAVPS |
Ga0207906_10297521 | 3300025052 | Marine | LADLTALCPVSHWDTVFASQVDSVITSPVVPPTPDESFAVPS |
Ga0208012_10594761 | 3300025066 | Marine | LTALCPVSQWDAVFASQVDSVITSPVVNPVPDESFAVPS |
Ga0208668_10387702 | 3300025078 | Marine | AALTAMCPTSSWDAVFASQVESVITSPVVQPVPDESFAVPSS |
Ga0208669_11028982 | 3300025099 | Marine | AKSSFNLAALTAMCPVSQWDAVFASQVDSVITNPATPAVPDQDFAVPSS |
Ga0208013_10014731 | 3300025103 | Marine | TAMCPTSQWDGVFASQVDSVITNPPSNPVPDNDFSVPSS |
Ga0208013_10169373 | 3300025103 | Marine | ALCPVSHWDAVFASQVDSVITNPIVPPVPDSDFAVPSS |
Ga0208553_11400501 | 3300025109 | Marine | LCPTSHWDDVFASQVDSVITNPVVNPVPDESYTIPS |
Ga0208158_11599791 | 3300025110 | Marine | FNTTKWDAVFTSQVDSVITNPVVNAEPDNDFAIPSS |
Ga0208433_11112122 | 3300025114 | Marine | TALCPTSKWDAVFASQVDSVITNPVVNPVPDESFAVPS |
Ga0209644_11211182 | 3300025125 | Marine | SNANLVALCPVSHWDVVFASQLASVITSPVVQPVPDTSFAVPS |
Ga0209348_11442732 | 3300025127 | Marine | DLVELCPVSQWDVVFASQVDSVITNPVVRSTPDNSFNVPS |
Ga0208919_100716312 | 3300025128 | Marine | LEGIFPTAKWDAIFASQVDSVITNPPVKPVPDTAYTIPS |
Ga0209232_10992753 | 3300025132 | Marine | NADLVAICPVSQWDAVFASQVDSVITNPPVQSTPDQAFYVPS |
Ga0208182_11019391 | 3300025251 | Deep Ocean | SELEDLLPTSHWDTVFASQVDSVITNPVVNPVADDSYVIPS |
Ga0208179_10812671 | 3300025267 | Deep Ocean | CPVTHWDTVFASQVESVITSPVVPPEPDDSFSIPS |
Ga0208814_10319341 | 3300025276 | Deep Ocean | TALCPVSHWDTVFASQVASVITSPVVLPVPDTSFNVPS |
Ga0208180_10319591 | 3300025277 | Deep Ocean | CPVSHWDTVFASQVDSVITNPPTQSTPDQAFSVPS |
Ga0208449_11425702 | 3300025280 | Deep Ocean | NLVAICPVSQWDTVFASQVDSVITNPPVESTPDSAFNVPS |
Ga0208030_10516404 | 3300025282 | Deep Ocean | KAQIVALCPVTHWDTVFASQVESVITSPVVPPEPDDSFSIPS |
Ga0208316_10429461 | 3300025296 | Deep Ocean | CPTSHWDAVFASQVESVITSPIVQPVPDEAFAVPSS |
Ga0209043_11670593 | 3300025667 | Marine | MFPTSKWDDVFDSQVDSVITSPVVPPVPDEAFQVPSS |
Ga0208767_101753311 | 3300025769 | Aqueous | AALTALCPVSQWDAIFASQVESVITSPVVPPVPDTSFSVPS |
Ga0209757_101726621 | 3300025873 | Marine | EALMPISHWDTVFASQVDSVITSPVVPPTADESFSIPS |
Ga0208408_11638341 | 3300026260 | Marine | ADLVAICPVSQWDAVFASQVDSVITNPPSDPVPDDSFSVPS |
Ga0209071_12077721 | 3300027686 | Marine | CPTSLWDDVFDSQVDSVITSPVVPPVPDEAFEVPSS |
Ga0256382_10421673 | 3300028022 | Seawater | AICPVSEWDAIFASQVDSVITNPPVESTPDQAFSVPS |
Ga0256382_11279491 | 3300028022 | Seawater | LCPVSHWDVVFASQVNSVITNPVVNPVPDTSFVMPS |
Ga0256383_1115171 | 3300028448 | Seawater | EGLMPIAHWDTVFASQVDSVITNPVTDPVADESFSIPS |
Ga0315331_101308021 | 3300031774 | Seawater | ALTAMCPVSQWDAVFASQVDSVITNPIVPAVPDTAFEVPSS |
Ga0310344_109700992 | 3300032006 | Seawater | MCPTSHWDAIFASQVDSVITNPPSDPVPDEAFSVPSS |
Ga0314858_102583_2_124 | 3300033742 | Sea-Ice Brine | ALTALCPVSRWDAVFASQVDSVITNPVVPPVADESFSVPS |
⦗Top⦘ |