| Basic Information | |
|---|---|
| Family ID | F083232 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MGFDPNRPYKANKTDYLNIIAAFLLTVIVVIWALN |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.65 % |
| % of genes near scaffold ends (potentially truncated) | 22.12 % |
| % of genes from short scaffolds (< 2000 bps) | 49.56 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (23.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.097 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.805 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.92% β-sheet: 0.00% Coil/Unstructured: 65.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01351 | RNase_HII | 31.86 |
| PF00378 | ECH_1 | 29.20 |
| PF10502 | Peptidase_S26 | 8.85 |
| PF00497 | SBP_bac_3 | 4.42 |
| PF00528 | BPD_transp_1 | 3.54 |
| PF00889 | EF_TS | 2.65 |
| PF02800 | Gp_dh_C | 2.65 |
| PF00717 | Peptidase_S24 | 2.65 |
| PF01746 | tRNA_m1G_MT | 1.77 |
| PF02899 | Phage_int_SAM_1 | 1.77 |
| PF14588 | YjgF_endoribonc | 0.88 |
| PF00312 | Ribosomal_S15 | 0.88 |
| PF02576 | RimP_N | 0.88 |
| PF13442 | Cytochrome_CBB3 | 0.88 |
| PF13231 | PMT_2 | 0.88 |
| PF01245 | Ribosomal_L19 | 0.88 |
| PF00044 | Gp_dh_N | 0.88 |
| PF06574 | FAD_syn | 0.88 |
| PF07722 | Peptidase_C26 | 0.88 |
| PF00696 | AA_kinase | 0.88 |
| PF04055 | Radical_SAM | 0.88 |
| PF13561 | adh_short_C2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 31.86 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 31.86 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 3.54 |
| COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 2.65 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.77 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.77 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 0.88 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0779 | Ribosome maturation factor RimP | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559013|NCBI_BBAY_READ_1105731280920 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10248102 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10000520 | All Organisms → cellular organisms → Bacteria | 24559 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1013053 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1000006 | All Organisms → cellular organisms → Bacteria | 41993 | Open in IMG/M |
| 3300000422|BB_Man_A_Liq_inBBDRAFT_1000017 | All Organisms → cellular organisms → Bacteria | 23054 | Open in IMG/M |
| 3300001355|JGI20158J14315_10065338 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300001937|GOS2252_1005851 | All Organisms → cellular organisms → Bacteria | 3197 | Open in IMG/M |
| 3300001946|GOS2244_1001547 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300001951|GOS2249_1019712 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300001963|GOS2229_1058889 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300001967|GOS2242_1029954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1454 | Open in IMG/M |
| 3300001969|GOS2233_1098758 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300001974|GOS2246_10160255 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300002040|GOScombined01_101223121 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300002040|GOScombined01_101685058 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300002040|GOScombined01_107078028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3222 | Open in IMG/M |
| 3300002242|KVWGV2_10906979 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005512|Ga0074648_1030478 | All Organisms → cellular organisms → Bacteria | 2728 | Open in IMG/M |
| 3300005522|Ga0066861_10011006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3282 | Open in IMG/M |
| 3300005522|Ga0066861_10023492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2235 | Open in IMG/M |
| 3300005522|Ga0066861_10042679 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005522|Ga0066861_10216313 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005606|Ga0066835_10209681 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005837|Ga0078893_10000298 | All Organisms → cellular organisms → Bacteria | 12286 | Open in IMG/M |
| 3300005837|Ga0078893_10298904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2775 | Open in IMG/M |
| 3300005838|Ga0008649_10000238 | All Organisms → cellular organisms → Bacteria | 50926 | Open in IMG/M |
| 3300006024|Ga0066371_10000309 | All Organisms → cellular organisms → Bacteria | 11025 | Open in IMG/M |
| 3300006027|Ga0075462_10012139 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300006027|Ga0075462_10062061 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300006166|Ga0066836_10283621 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300006166|Ga0066836_10979552 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006315|Ga0068487_1200637 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006318|Ga0068475_1351819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300006329|Ga0068486_1133099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2569 | Open in IMG/M |
| 3300006351|Ga0099953_1066568 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006403|Ga0075514_1181721 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300006620|Ga0101444_103040 | All Organisms → cellular organisms → Bacteria | 13193 | Open in IMG/M |
| 3300006842|Ga0068494_112640 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300006874|Ga0075475_10029285 | All Organisms → cellular organisms → Bacteria | 2667 | Open in IMG/M |
| 3300007144|Ga0101670_1037420 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300007725|Ga0102951_1015054 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
| 3300007862|Ga0105737_1001219 | All Organisms → cellular organisms → Bacteria | 5737 | Open in IMG/M |
| 3300008012|Ga0075480_10050119 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300009103|Ga0117901_1040378 | All Organisms → cellular organisms → Bacteria | 3212 | Open in IMG/M |
| 3300009130|Ga0118729_1041113 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
| 3300009132|Ga0118730_1070300 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300009593|Ga0115011_10122234 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300012919|Ga0160422_10664103 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012954|Ga0163111_11272782 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300013116|Ga0171646_1062304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1620 | Open in IMG/M |
| 3300017779|Ga0181395_1000002 | All Organisms → cellular organisms → Bacteria | 133285 | Open in IMG/M |
| 3300017818|Ga0181565_10097882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2082 | Open in IMG/M |
| 3300017818|Ga0181565_10197511 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300017949|Ga0181584_10093701 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300017949|Ga0181584_10265363 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300017949|Ga0181584_10356231 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300017950|Ga0181607_10006240 | All Organisms → cellular organisms → Bacteria | 10015 | Open in IMG/M |
| 3300017951|Ga0181577_10054203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2849 | Open in IMG/M |
| 3300017952|Ga0181583_10464204 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300017956|Ga0181580_10433248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 870 | Open in IMG/M |
| 3300017957|Ga0181571_10087407 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
| 3300017962|Ga0181581_10701891 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300018416|Ga0181553_10130035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1520 | Open in IMG/M |
| 3300018418|Ga0181567_10137774 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300018426|Ga0181566_10101742 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300018428|Ga0181568_11148143 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300019274|Ga0182073_1314427 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300019751|Ga0194029_1000882 | All Organisms → cellular organisms → Bacteria | 3762 | Open in IMG/M |
| 3300019765|Ga0194024_1000546 | All Organisms → cellular organisms → Bacteria | 7494 | Open in IMG/M |
| 3300020055|Ga0181575_10016472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4891 | Open in IMG/M |
| 3300020238|Ga0211492_1000090 | All Organisms → cellular organisms → Bacteria | 18493 | Open in IMG/M |
| 3300020247|Ga0211654_1000310 | All Organisms → cellular organisms → Bacteria | 9562 | Open in IMG/M |
| 3300020255|Ga0211586_1000090 | All Organisms → cellular organisms → Bacteria | 34191 | Open in IMG/M |
| 3300020260|Ga0211588_1050574 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300020267|Ga0211648_1009444 | All Organisms → cellular organisms → Bacteria | 2343 | Open in IMG/M |
| 3300020268|Ga0211495_1088271 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300020276|Ga0211509_1009162 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300020301|Ga0211650_1001222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 6750 | Open in IMG/M |
| 3300020319|Ga0211517_1019610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1369 | Open in IMG/M |
| 3300020336|Ga0211510_1004362 | All Organisms → cellular organisms → Bacteria | 4018 | Open in IMG/M |
| 3300020353|Ga0211613_1005658 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
| 3300020377|Ga0211647_10045236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1637 | Open in IMG/M |
| 3300020379|Ga0211652_10011522 | All Organisms → cellular organisms → Bacteria | 2664 | Open in IMG/M |
| 3300020395|Ga0211705_10007536 | All Organisms → cellular organisms → Bacteria | 4191 | Open in IMG/M |
| 3300020404|Ga0211659_10018791 | All Organisms → cellular organisms → Bacteria | 3411 | Open in IMG/M |
| 3300020418|Ga0211557_10042839 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300020431|Ga0211554_10000492 | All Organisms → cellular organisms → Bacteria | 29410 | Open in IMG/M |
| 3300020449|Ga0211642_10431313 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300020455|Ga0211664_10154751 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300020459|Ga0211514_10020263 | All Organisms → cellular organisms → Bacteria | 3584 | Open in IMG/M |
| 3300020460|Ga0211486_10413405 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300020465|Ga0211640_10545143 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300020467|Ga0211713_10001364 | All Organisms → cellular organisms → Bacteria | 15513 | Open in IMG/M |
| 3300020469|Ga0211577_10001703 | All Organisms → cellular organisms → Bacteria | 20937 | Open in IMG/M |
| 3300020469|Ga0211577_10887382 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300020474|Ga0211547_10538267 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021368|Ga0213860_10257278 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300021425|Ga0213866_10545009 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300021957|Ga0222717_10009493 | All Organisms → cellular organisms → Bacteria | 6829 | Open in IMG/M |
| 3300021957|Ga0222717_10016341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 5037 | Open in IMG/M |
| 3300021957|Ga0222717_10059139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2466 | Open in IMG/M |
| 3300021958|Ga0222718_10012700 | All Organisms → cellular organisms → Bacteria | 6133 | Open in IMG/M |
| 3300022074|Ga0224906_1000700 | All Organisms → cellular organisms → Bacteria | 18039 | Open in IMG/M |
| 3300022935|Ga0255780_10125321 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300024322|Ga0228656_1012397 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300024343|Ga0244777_10027631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3598 | Open in IMG/M |
| 3300026076|Ga0208261_1150683 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300026258|Ga0208130_1071942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1013 | Open in IMG/M |
| 3300026268|Ga0208641_1057356 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300026292|Ga0208277_1001871 | All Organisms → cellular organisms → Bacteria | 12113 | Open in IMG/M |
| 3300027827|Ga0209035_10118598 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300028194|Ga0257106_1010701 | All Organisms → cellular organisms → Bacteria | 3837 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 23.89% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 15.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.27% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 7.96% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.54% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.54% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.54% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.65% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.77% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.77% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.77% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.77% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.89% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.89% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.89% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.89% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.89% |
| Volcanic Co2 Seep | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep | 0.89% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.89% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Bioluminescent Bay | 0.89% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.89% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559013 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean1 (Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY01 3688) | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
| 3300000422 | Marine sediment microbial community from La Parguera, Puerto Rico - BB Mangrove A Sediment | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001937 | Marine microbial communities from the Equatorial Pacific Ocean - GS037 | Environmental | Open in IMG/M |
| 3300001946 | Marine microbial communities from North James Bay, Santigo Island, Equador | Environmental | Open in IMG/M |
| 3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006318 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0200m | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006620 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ10 time point | Environmental | Open in IMG/M |
| 3300006842 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_1_0025m | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007144 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', waterEBic1 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013116 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019274 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020255 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556136-ERR599013) | Environmental | Open in IMG/M |
| 3300020260 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556087-ERR599025) | Environmental | Open in IMG/M |
| 3300020267 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108) | Environmental | Open in IMG/M |
| 3300020268 | Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556113-ERR599107) | Environmental | Open in IMG/M |
| 3300020276 | Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858) | Environmental | Open in IMG/M |
| 3300020301 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX556086-ERR598997) | Environmental | Open in IMG/M |
| 3300020319 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX556039-ERR599073) | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020353 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean1-_00036540 | 2166559013 | Environmental And Host-Associated | MGFDPNRPYKANKTDYLNIALCIVLAVIAIIWALN |
| DelMOSum2010_102481022 | 3300000101 | Marine | MGFDPNRPYRANKTDYFNIIFSIVLAVVAIIWALS* |
| DelMOSpr2010_100005209 | 3300000116 | Marine | MGFDPNRPYKANRTDYVNIALSIVLAVIAIIWALS* |
| LPaug08P2610mDRAFT_10130532 | 3300000159 | Marine | MGFDPNKPYKANRTDYFNIILCIALAVIAIIWALN* |
| BB_Man_B_Liq_inBBDRAFT_100000641 | 3300000401 | Bioluminescent Bay | MGFDPNRPYKANKTDYINIVLAVALTAAVVIWALN* |
| BB_Man_A_Liq_inBBDRAFT_10000173 | 3300000422 | Bioluminescent Bay | MGFDPNRPYKANKTDYINIILAVALTAAVVIWALN* |
| JGI20158J14315_100653383 | 3300001355 | Pelagic Marine | MGFDPNRPYKANKTDYFNIVFCIILAAVAIIWALN* |
| GOS2252_10058514 | 3300001937 | Marine | MGFDPNKPYKANKTDYLNIIAALLLTIIVVIWALN* |
| GOS2244_10015472 | 3300001946 | Marine | MGFDPNKPYKANKTDYLNIVAALLLTIIVIIWALN* |
| GOS2249_10197122 | 3300001951 | Marine | MGFNPNREYKANKTDYVNIVAALILTVAVLIWALN* |
| GOS2229_10588895 | 3300001963 | Marine | MGFDPNRPYKANRTDYVNIALSIVLAVIAIIWALSKR |
| GOS2242_10299543 | 3300001967 | Marine | MGFDPNRPYKANKADYINIIFAFILTTIVVIWALN* |
| GOS2233_10987581 | 3300001969 | Marine | MGFDPNKPYKANKTDYLNIIAALLLTIIVVIWALRKD |
| GOS2246_101602553 | 3300001974 | Marine | MGFDPNRPYKANKTDYVNIALCIVLAVVAIIWALN* |
| GOScombined01_1012231212 | 3300002040 | Marine | MGFDPNRPYKANRTDYVNIALSIVLAIIAIIWALS* |
| GOScombined01_1016850583 | 3300002040 | Marine | MGFDPNRPYKANKTDYINIIFAFLLTAIVVIWALS* |
| GOScombined01_1070780286 | 3300002040 | Marine | MGFDPNKPYKANKTDYLNIVAALFLTIIVVIWALN* |
| KVWGV2_109069792 | 3300002242 | Marine Sediment | MGFDPNRPYKANKYDYANIIFCFLLAIFAIYWALN* |
| Ga0074648_10304781 | 3300005512 | Saline Water And Sediment | MGFDPNRPYKANKTDYINIIFAFILTAIVVIWALS* |
| Ga0066861_100110064 | 3300005522 | Marine | MGFDPNKPYKANKTDYLNIISALLLTIIVVIWALN* |
| Ga0066861_100234925 | 3300005522 | Marine | MGFDPNRPYKANKTDYLNIIAAFLLTVIVVIWALN* |
| Ga0066861_100426792 | 3300005522 | Marine | MGFDPNKPYKANKTDYLNIVAALLLTIIVVIWALN* |
| Ga0066861_102163132 | 3300005522 | Marine | MGFNPNREYKANKTDYVNIVAALILTIAVLIWALN* |
| Ga0066835_102096811 | 3300005606 | Marine | MGFDPNKPYKANKTDYINISAALLLTIIVIIWALRKDLR |
| Ga0078893_1000029816 | 3300005837 | Marine Surface Water | MGFDPNRPYKANKTDYLNIALCIVLAVIAIIWALN* |
| Ga0078893_102989045 | 3300005837 | Marine Surface Water | MGFDPNRPYKANKADYFNIALSVTLALIAIIWALN* |
| Ga0008649_1000023839 | 3300005838 | Marine | MGFDPNRPYKANRTDYFNIIFSIILAVVAIIWALS* |
| Ga0066371_1000030914 | 3300006024 | Marine | MGFDPNKPYKANKTDYINIIIAFILTAIVVIWALS* |
| Ga0075462_100121394 | 3300006027 | Aqueous | MGFDPNRPYKANKTDYLNIIFAIALTAAVVIWALS* |
| Ga0075462_100620613 | 3300006027 | Aqueous | MGFDPNRPYKANKVDYINIIAALILTVVVIVWAIS* |
| Ga0066836_102836212 | 3300006166 | Marine | MGFDPNKPYKANKTDYLNIISALLLTIIVVIWALNKRFAMD |
| Ga0066836_109795521 | 3300006166 | Marine | NVNMGFDPNRPYKANKYDYINIVFCIILAMLAIYWALN* |
| Ga0068487_12006372 | 3300006315 | Marine | MGFDPNRPYKANKYDYANIIFCFLLAVFAIYWALN* |
| Ga0068475_13518191 | 3300006318 | Marine | MGFDPNRPYKANKYDYANIIFCFLLAVFAIYWAQIKRPT |
| Ga0068486_11330995 | 3300006329 | Marine | MGFDPNRPYKANKYDYANIIFCFLLAVFAIYWALS* |
| Ga0099953_10665681 | 3300006351 | Marine | GFDPNKPYKANKTDYLNIIAALLLTIIVVIWALS* |
| Ga0075514_11817212 | 3300006403 | Aqueous | MGFDPNRPYKANRTDYVNLTLSIVLAVIAIIWALS* |
| Ga0101444_10304018 | 3300006620 | Marine Surface Water | MGFDPNKPYKANKTDYLNIIAALILTVIVIIWALN* |
| Ga0068494_1126402 | 3300006842 | Marine | MGFDPNKPYKANKTDYLNIIAALLLTIIVVIWALS* |
| Ga0075475_100292854 | 3300006874 | Aqueous | MGFDPNRPYKANKIDYLNIIGALLLIVIVITWALS* |
| Ga0101670_10374202 | 3300007144 | Volcanic Co2 Seep | MGFDPNKPYKANKTDYLNIISALLLTITVVIWALN* |
| Ga0102951_10150543 | 3300007725 | Water | MGFNPNREYKANKTDYVNIVAALILTIAVVIWALS* |
| Ga0105737_10012191 | 3300007862 | Estuary Water | MGFDPNRPYKANSTDYFNIIFSIILAVVAIIWALS* |
| Ga0075480_100501192 | 3300008012 | Aqueous | MGFDPNRPYKANKTDYVNIILAIALTAAVFIWAIS* |
| Ga0117901_10403785 | 3300009103 | Marine | MGFDPNRKYEANKIDYLNIVLAFLLALIAIIWAIN* |
| Ga0118729_10411133 | 3300009130 | Marine | MGFDPNRKYEPNKIDYLNIVLAFLLALIAIIWAIN* |
| Ga0118730_10703006 | 3300009132 | Marine | VYMGFDPNRKYEANKIDYLNIVLALLLALIAIIWAIN* |
| Ga0115011_101222342 | 3300009593 | Marine | MGFNPNREYKANKTDYVNIVAALILTTAVLIWALN* |
| Ga0160422_106641032 | 3300012919 | Seawater | MGFNPNREYKANKTDYVNIVSALILTVAVLIWALN* |
| Ga0163111_112727822 | 3300012954 | Surface Seawater | MGFDPNKPYKANKTDYLNIIAALLLTLVVVIWALN* |
| Ga0171646_10623044 | 3300013116 | Marine | VYMGFDPNRKYEANKIDYLNIVLAFLLALIAIIWAIN* |
| Ga0181395_100000234 | 3300017779 | Seawater | MGFDPNKPYKANNTDYINIIFAFILTAIVVIWALS |
| Ga0181565_100978824 | 3300017818 | Salt Marsh | MGFDPNKPYKANKTDYLNIVAALLLTTIVLIWALN |
| Ga0181565_101975113 | 3300017818 | Salt Marsh | MGFDPNKPYKANKTDYLNIVAALLLTIIVVIWALN |
| Ga0181584_100937014 | 3300017949 | Salt Marsh | MGFDPNRPYKANKTDYVNIILAIALTTAVVIWAIS |
| Ga0181584_102653631 | 3300017949 | Salt Marsh | MGFDPNRPYKANKTDYLNIILAVALTAAVVIWALN |
| Ga0181584_103562312 | 3300017949 | Salt Marsh | MGFDPNRPYKANKTDYINIILAVALTAAVVIWALN |
| Ga0181607_100062404 | 3300017950 | Salt Marsh | MGFNPNREYKANKTDYVNIVAALILTIAVLIWALN |
| Ga0181577_100542035 | 3300017951 | Salt Marsh | MGFDPNRPYKANKTDYVNIILAIALTAAVVIWAIS |
| Ga0181583_104642043 | 3300017952 | Salt Marsh | NVCMGFDPNKPYKANKTDYLNIVAALFLTIIVVIWALN |
| Ga0181580_104332481 | 3300017956 | Salt Marsh | VCMGFDPNKPYKANKTDYLNIISALLLTIIVVIWALN |
| Ga0181571_100874073 | 3300017957 | Salt Marsh | MGFDPNKPYKANKTDYLNIVAALLLTTIVIIWALN |
| Ga0181581_107018912 | 3300017962 | Salt Marsh | MGFDPNRPYKANKTDYVNIILAVALTAAVVIWALN |
| Ga0181553_101300354 | 3300018416 | Salt Marsh | MGFDTNKPYKANKTDYLNIVAALLLTTIVLIWALN |
| Ga0181567_101377741 | 3300018418 | Salt Marsh | MGFDPNRPYKANKIDYLNIIGALLLIVIVITWALS |
| Ga0181566_101017423 | 3300018426 | Salt Marsh | MGFDPNRPYKANKTDYVNIILAITLTAAVVIWAIS |
| Ga0181568_111481431 | 3300018428 | Salt Marsh | MGFDPNRPYKANKIDYLNIIGALLLIIIVITWALS |
| Ga0182073_13144272 | 3300019274 | Salt Marsh | MGFDPNRPYKANKTDYLNIIFAIALTAAVVIWALS |
| Ga0194029_10008825 | 3300019751 | Freshwater | MGFDPNRPYKANRTDYVNIALSIVLAVIAIIWALS |
| Ga0194024_100054610 | 3300019765 | Freshwater | MGFDPNRPYKANKTDYFNIIFAFILTAIVVIWALS |
| Ga0181575_100164722 | 3300020055 | Salt Marsh | MGFDPNRPYKANKTDYINIIFAFILTAIVVIWALN |
| Ga0211492_100009022 | 3300020238 | Marine | MGFDPNRPYKANKADYFNIALSVTLALIAIIWALN |
| Ga0211654_10003101 | 3300020247 | Marine | MGFDPNRPYKANKTDYLNIIAAFLLTVIVVIWALN |
| Ga0211586_100009029 | 3300020255 | Marine | MGFDPNRKYEANKIDYLNIVLAFLLALIAIIWAIN |
| Ga0211588_10505741 | 3300020260 | Marine | MGFDPNRPYKANKYDYANIIFCFLLAVFAIYWALN |
| Ga0211648_10094443 | 3300020267 | Marine | MGFDPNKPYKANKTDYLNIIAALLLTIIVVIWALN |
| Ga0211495_10882711 | 3300020268 | Marine | IMGFDPNRPYKANKYDYANIIFCFLLALFAIYWALN |
| Ga0211509_10091622 | 3300020276 | Marine | MGFDPNKPYKANKTDYINIIFAFILTAIVVIWALS |
| Ga0211650_10012221 | 3300020301 | Marine | VCMGFDPNKPYKANKTDYLNIIAALLLTIIVVIWALN |
| Ga0211517_10196103 | 3300020319 | Marine | MGFDPNKPYKANKTDYLNIIAALILTVIVIIWALN |
| Ga0211510_10043623 | 3300020336 | Marine | MGFNPNKEYRANKTDYINIIFAVILTVAVVIWALN |
| Ga0211613_10056583 | 3300020353 | Marine | MGFNPNRKYDANKIDYLNIVLAFLLALIAIIWAIN |
| Ga0211647_100452364 | 3300020377 | Marine | MGFDPNKPYKANKTDYLNIVAALLLTIIVIIWALN |
| Ga0211652_100115226 | 3300020379 | Marine | MGFDPNRPYKANKADYINIIFAFILTTIVVIWALN |
| Ga0211705_100075362 | 3300020395 | Marine | MGFDPNRPYKANKTDYLNIVAALILTIIVVIWALN |
| Ga0211659_100187912 | 3300020404 | Marine | MGFNPNREYKANKTDYVNIVAALILTVAVLIWALN |
| Ga0211557_100428394 | 3300020418 | Marine | MGFDPNRPYKANKTDYINIIFAFILTAVVVIWALS |
| Ga0211554_1000049233 | 3300020431 | Marine | MGFDPNRPYRANKTDYFNIIFSIVLAVVAIIWALS |
| Ga0211642_104313132 | 3300020449 | Marine | NMGFDPNRPYKANKYDYINIVFCIILAMLAIYWALN |
| Ga0211664_101547512 | 3300020455 | Marine | MGFNPNKPYKANKTDYLNIIAALLLTIIVVIWALN |
| Ga0211514_100202635 | 3300020459 | Marine | MGFDPNKPYKANKTDYINIIFAFILTAIVVIWALN |
| Ga0211486_104134051 | 3300020460 | Marine | MGFDPNRPYKANKYDYINISICIILAILAISWALN |
| Ga0211640_105451432 | 3300020465 | Marine | VVMGFDPNKPYKANKTDYINIIFAFILTTIVVIWALS |
| Ga0211713_1000136419 | 3300020467 | Marine | MGFNPNRKYDANKTDYLNIVLAFLLTLIAIIWAIN |
| Ga0211577_1000170320 | 3300020469 | Marine | MGFDPNRPYKANRTDYFNIIFSIILAVVAIIWALS |
| Ga0211577_108873821 | 3300020469 | Marine | NVVMGFDPNRPYKANKTDYFNIVFSIILAAVAIIWALN |
| Ga0211547_105382672 | 3300020474 | Marine | MGFNPNKEYKANKTDYINIIIAVILTVAVVIWALN |
| Ga0213860_102572782 | 3300021368 | Seawater | MGFDPNKPYKANKTDYINIVLAVALTAAVVIWALN |
| Ga0213866_105450092 | 3300021425 | Seawater | VVMGFDPNRPYKANKTDYINIIFAFILTAIVVIWALS |
| Ga0222717_100094939 | 3300021957 | Estuarine Water | MGFNPNREYKANKTDYVNIVAALILTIAVVIWALS |
| Ga0222717_100163415 | 3300021957 | Estuarine Water | MGFDPNRPYKANKTDYINIIFSFILTAIVVIWALS |
| Ga0222717_100591392 | 3300021957 | Estuarine Water | MGFDPNRPYKANKVDYINIIAALILTVVVIVWAIS |
| Ga0222718_100127006 | 3300021958 | Estuarine Water | MGFNPNREYKANKTDYVNIVAALILTIAVVIWALN |
| Ga0224906_100070015 | 3300022074 | Seawater | MGFNPNKEYKANKTDYVNILSALILTIAVVIWALN |
| Ga0255780_101253211 | 3300022935 | Salt Marsh | VYMGFDPNRPYKANKTDYVNIILAISLTAAVVIWAIS |
| Ga0228656_10123973 | 3300024322 | Seawater | MGFDPNRPYKANKTDYLNIALCIVLAVIGIIWALN |
| Ga0244777_100276316 | 3300024343 | Estuarine | MGFDPNRPYKANSTDYFNIIFSIILAVVAIIWALS |
| Ga0208261_11506832 | 3300026076 | Marine | MGFDPNRPYKANKTDYINIIFAFILIAIVVIWALS |
| Ga0208130_10719423 | 3300026258 | Marine | MGFDPNKPYKANKTDYLNIILALLLTIIVVIWALN |
| Ga0208641_10573563 | 3300026268 | Marine | MGFDPNRPYKANKFDYINIVFCFILALLAIFWALN |
| Ga0208277_100187117 | 3300026292 | Marine | MGFDPNKPYKANKTDYINIIIAFILTAIVVIWALS |
| Ga0209035_101185983 | 3300027827 | Marine | MGFNPNKPYKANKADYFNIALSVTLALIAIIWALN |
| Ga0257106_10107013 | 3300028194 | Marine | MGFDPNKPYKANRTDYFNIILCIALAVIAIIWALN |
| ⦗Top⦘ |