| Basic Information | |
|---|---|
| Family ID | F083212 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 46 residues |
| Representative Sequence | NATIKKEAVLGLAAVSVKTQRDRWKVLNHYEELTKPPANSNAP |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.81 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (10.620 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.097 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.027 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 58.41 |
| PF07714 | PK_Tyr_Ser-Thr | 16.81 |
| PF01966 | HD | 1.77 |
| PF12401 | FhaA_N | 0.88 |
| PF00154 | RecA | 0.88 |
| PF08239 | SH3_3 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 300.88 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_108955664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300004114|Ga0062593_102630515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300005289|Ga0065704_10665489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300005290|Ga0065712_10446049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300005293|Ga0065715_10115748 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300005293|Ga0065715_10580154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300005293|Ga0065715_10883031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300005334|Ga0068869_100200630 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300005336|Ga0070680_100673641 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005336|Ga0070680_101826325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300005341|Ga0070691_10942942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300005343|Ga0070687_100213964 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300005345|Ga0070692_10028142 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| 3300005354|Ga0070675_100933302 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005440|Ga0070705_100156771 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300005440|Ga0070705_100599767 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300005444|Ga0070694_100935529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300005467|Ga0070706_100436893 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005468|Ga0070707_100942521 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300005539|Ga0068853_102415672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300005545|Ga0070695_101062809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300005545|Ga0070695_101201580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300005549|Ga0070704_100881771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300005564|Ga0070664_102093927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300005564|Ga0070664_102181312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005617|Ga0068859_100584294 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005617|Ga0068859_102157044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300005618|Ga0068864_101680311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300005841|Ga0068863_100724119 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005883|Ga0075299_1032193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300006169|Ga0082029_1780890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300006173|Ga0070716_100335135 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300006755|Ga0079222_11118869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300006806|Ga0079220_11491679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300006852|Ga0075433_11566120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300006880|Ga0075429_100092784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2633 | Open in IMG/M |
| 3300006904|Ga0075424_102283349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300006918|Ga0079216_11786264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300006954|Ga0079219_10052097 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300007076|Ga0075435_100294742 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300009011|Ga0105251_10380236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300009092|Ga0105250_10609647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300009098|Ga0105245_12165806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300009101|Ga0105247_10278583 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300009101|Ga0105247_11862070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300009147|Ga0114129_11386211 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300009156|Ga0111538_11514143 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300009174|Ga0105241_10962907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300009177|Ga0105248_10087247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3511 | Open in IMG/M |
| 3300009553|Ga0105249_10450969 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300009553|Ga0105249_13442247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300010038|Ga0126315_11149963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300010042|Ga0126314_10460948 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300010042|Ga0126314_10839605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300010359|Ga0126376_11248396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300010359|Ga0126376_11316761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300010373|Ga0134128_12531434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300010397|Ga0134124_12834259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300010399|Ga0134127_12485051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300010401|Ga0134121_11043674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300010401|Ga0134121_12584914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300010403|Ga0134123_11081925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300011332|Ga0126317_10329972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300013100|Ga0157373_10029265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3969 | Open in IMG/M |
| 3300013100|Ga0157373_10641453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300013102|Ga0157371_10577667 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300013102|Ga0157371_11251722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300013297|Ga0157378_11749665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300013307|Ga0157372_12202254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300013308|Ga0157375_13354722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300014310|Ga0075331_1105416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300014325|Ga0163163_13189520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300015374|Ga0132255_104287306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 605 | Open in IMG/M |
| 3300025735|Ga0207713_1228083 | Not Available | 558 | Open in IMG/M |
| 3300025900|Ga0207710_10464868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300025901|Ga0207688_10323414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300025908|Ga0207643_10187971 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300025910|Ga0207684_10509848 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300025911|Ga0207654_10237775 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300025919|Ga0207657_11328503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300025920|Ga0207649_11524132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300025926|Ga0207659_10252777 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300025934|Ga0207686_10535536 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300025935|Ga0207709_10564537 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300025936|Ga0207670_11166743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300025942|Ga0207689_10863004 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300025942|Ga0207689_11459017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300025949|Ga0207667_10622889 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300025960|Ga0207651_10733681 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300025981|Ga0207640_10478239 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300026023|Ga0207677_10521465 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300026035|Ga0207703_10897460 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 848 | Open in IMG/M |
| 3300026088|Ga0207641_11115475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300026088|Ga0207641_12231630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300026095|Ga0207676_11043390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300026095|Ga0207676_12024797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300026116|Ga0207674_12237172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300026142|Ga0207698_10803981 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300027775|Ga0209177_10133601 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300027886|Ga0209486_10101961 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300028380|Ga0268265_11923196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300031562|Ga0310886_10094172 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300031854|Ga0310904_11280391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300031858|Ga0310892_10150037 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300031901|Ga0307406_11213157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031903|Ga0307407_10011112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4273 | Open in IMG/M |
| 3300031944|Ga0310884_11086637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031995|Ga0307409_101377963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300032004|Ga0307414_10106012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2126 | Open in IMG/M |
| 3300032004|Ga0307414_10978859 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300032005|Ga0307411_11544822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300033412|Ga0310810_10649142 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300034820|Ga0373959_0023102 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 7.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.54% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1089556641 | 3300000955 | Soil | TIKKEAILGLSLISVRTQKQADRWKVLNHYEQMAKPSNSNAP* |
| Ga0062593_1026305151 | 3300004114 | Soil | GSPSPANATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP* |
| Ga0065704_106654891 | 3300005289 | Switchgrass Rhizosphere | ATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPTNSNAR* |
| Ga0065712_104460491 | 3300005290 | Miscanthus Rhizosphere | KSDSNPSPSNATIKKEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP* |
| Ga0065715_101157481 | 3300005293 | Miscanthus Rhizosphere | PSPANATIKKEAILGLSMISVRTQKDRWKVLNHYEELTKPPTNSNAP* |
| Ga0065715_105801541 | 3300005293 | Miscanthus Rhizosphere | AFDAAVSKSDLNPSPANATIKKEAILGLSMISVKTQKDRWKVLNHYDELTKPPANSNAP* |
| Ga0065715_108830311 | 3300005293 | Miscanthus Rhizosphere | SPANATIKKEAVFGLAAVSVKSQRQGDRWKVLNHYEQLTKPPANSNAP* |
| Ga0068869_1002006302 | 3300005334 | Miscanthus Rhizosphere | ANATIKKDAVLGLAVISVRTQTQRDRWKVLNHYEELTKPPANTNAP* |
| Ga0070680_1006736412 | 3300005336 | Corn Rhizosphere | NATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKAPANSPAP* |
| Ga0070680_1018263251 | 3300005336 | Corn Rhizosphere | ESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0070691_109429422 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVLGLAAISVRTQRDRWKVLNHYEELTKPPASANTPSAP* |
| Ga0070687_1002139642 | 3300005343 | Switchgrass Rhizosphere | DATPSAANATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKPPANSTAP* |
| Ga0070692_100281424 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | SPANATIKKEAILGLSMISVRTQKDRWKVLNHYEELTKPPTNSNAP* |
| Ga0070675_1009333022 | 3300005354 | Miscanthus Rhizosphere | IKKEAILGLAALSFRTNRDRWKTLNQYEELTKAPANSPAP* |
| Ga0070705_1001567712 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SKADLNPSAANATIKKEATLGLAMISVRTQKDRWKVLNHYEELTKPAANTNAP* |
| Ga0070705_1005997672 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IKKEAVFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP* |
| Ga0070694_1009355292 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | PSPANATIKKEAVLGLAAISVRTQRDRWKVLNHFEELTKPPANTNAP* |
| Ga0070706_1004368931 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EAILGLAAISVRTQRDRWKVLNHYEELTKPPAGANTPTSP* |
| Ga0070707_1009425211 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ATIKKEAVFGLAAVSVKSQRQGDRWKVLNHYEQLTKPPANSNAP* |
| Ga0068853_1024156721 | 3300005539 | Corn Rhizosphere | KSDLNPSPANATIKKEAILGLAAVSVRTQRDRWKVLNHYEELTKPPANTNAP* |
| Ga0070695_1010628091 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKPPANSTAP* |
| Ga0070695_1012015801 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AKADGSPSPANATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP* |
| Ga0070704_1008817712 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | IAKADAAPSPTNATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKPPANSTAP* |
| Ga0070664_1020939271 | 3300005564 | Corn Rhizosphere | AAPSPTSATIKKEAILGLAALSFKTQRDRWKTLNQYEELTKPPANTAAP* |
| Ga0070664_1021813121 | 3300005564 | Corn Rhizosphere | PTNATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKAPANSPAP* |
| Ga0068859_1005842941 | 3300005617 | Switchgrass Rhizosphere | AISKSDLNPSPANATIKKEAVLGLAAISVRTQRDRWKVLNHYEELTKPPANTNAP* |
| Ga0068859_1021570442 | 3300005617 | Switchgrass Rhizosphere | ADLNPTPANATIKKEATLGLAMISVRTQKDRWKVLNHYEELTKRPTNSNAP* |
| Ga0068864_1016803111 | 3300005618 | Switchgrass Rhizosphere | VLGLAAVSVRTQRDRWKVLNHYEELTKPPANTNAP* |
| Ga0068863_1007241192 | 3300005841 | Switchgrass Rhizosphere | KKEAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0075299_10321932 | 3300005883 | Rice Paddy Soil | KKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0082029_17808901 | 3300006169 | Termite Nest | KEAILGLSMISVRTQKDRWKVLNHYEELTKTPTNSNAP* |
| Ga0070716_1003351352 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TIKKEAVFGLAAVSVKTQRDRWKVLNHYEELTKPPQSANTPAAP* |
| Ga0079222_111188691 | 3300006755 | Agricultural Soil | GLAAVSVRTQKDRWKVLNHYEEITKPPAATSSPQTP* |
| Ga0079220_114916791 | 3300006806 | Agricultural Soil | KKEAVLALAAISVKTQRDHWKVLNQYEELTKPPTPANSPQTP* |
| Ga0075433_115661202 | 3300006852 | Populus Rhizosphere | DANPSPANATIKKEAVLGLAAISVRTQRDRWKVLNHYEELTKPPASTNTPSAP* |
| Ga0075429_1000927843 | 3300006880 | Populus Rhizosphere | SPASTTIKKEAILGLAALSFKTQRDRWKTLNQYEELTKPPANSAAP* |
| Ga0075424_1022833492 | 3300006904 | Populus Rhizosphere | KEAVLGLAAVSVKTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0079216_117862641 | 3300006918 | Agricultural Soil | KESILGLAIISVRTQTQRDRWKVLNHYEELTKPPAGSTASPAP* |
| Ga0079219_100520972 | 3300006954 | Agricultural Soil | GLSLISVRTQTQKDRWKVLNHYEEMTKPPANSNAP* |
| Ga0075435_1002947421 | 3300007076 | Populus Rhizosphere | DAVLGLAAVSVKTQRQGDRWKVLNHYEQLTKPPTNSNAP* |
| Ga0105251_103802361 | 3300009011 | Switchgrass Rhizosphere | AAIAKADSNPSPANATIKKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0105250_106096471 | 3300009092 | Switchgrass Rhizosphere | PANATIKKEAVLGLAAISIRTQKDRWKVLNHYEELTKPPASANTPSAP* |
| Ga0105245_121658062 | 3300009098 | Miscanthus Rhizosphere | AAISKADQNPSPANATIKKESILGLSLISVKTQTQKDRWKVLNHYEQMTKPPANSNAP* |
| Ga0105247_102785831 | 3300009101 | Switchgrass Rhizosphere | KEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP* |
| Ga0105247_118620701 | 3300009101 | Switchgrass Rhizosphere | IKKEATLGLAMISVRTQKDRWKVLNHYEELTKPPTNSNAP* |
| Ga0114129_113862111 | 3300009147 | Populus Rhizosphere | KKEATLGLAMISVRTQKDRWKVLNHYEELTKPAANTNAP* |
| Ga0111538_115141431 | 3300009156 | Populus Rhizosphere | KEAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0105241_109629071 | 3300009174 | Corn Rhizosphere | EAILGLSMISVRTQKDRWKVLNHYEELTKPPTNSNAP* |
| Ga0105248_100872471 | 3300009177 | Switchgrass Rhizosphere | PSNATIKKEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP* |
| Ga0105249_104509692 | 3300009553 | Switchgrass Rhizosphere | PSPANATIKKEAILGLSMITVRTQKDRWKVLNHYEELTKTPTNSNAP* |
| Ga0105249_134422471 | 3300009553 | Switchgrass Rhizosphere | DSNPSPANATIKKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0126315_111499631 | 3300010038 | Serpentine Soil | AKADSNPSPATATIKKEAILGLSMVSVKTQTQKDKWKVLNHYDTLIKPPANPNAP* |
| Ga0126314_104609482 | 3300010042 | Serpentine Soil | AAIAKADSTPSPANATIKKESILGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0126314_108396051 | 3300010042 | Serpentine Soil | ATIKKEAILGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP* |
| Ga0126376_112483962 | 3300010359 | Tropical Forest Soil | SKADANPSPANATIKKEAVLGLAAVTVKTQRDRWKVLNHYEEMTKPPANSNAP* |
| Ga0126376_113167612 | 3300010359 | Tropical Forest Soil | EAVLGLAAVSVRTQKARWKVLNHYEELTKPPANSNAP* |
| Ga0134128_125314341 | 3300010373 | Terrestrial Soil | VLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0134124_128342591 | 3300010397 | Terrestrial Soil | TPANATIKKEATLGLAMITVRTQKDRWKVLNHYEELTKPPANSNAP* |
| Ga0134127_124850512 | 3300010399 | Terrestrial Soil | GLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0134121_110436742 | 3300010401 | Terrestrial Soil | SPASATIKKEAILGLAALSFRTNRDRWKTLNQYEEMTHPPANSNAP* |
| Ga0134121_125849141 | 3300010401 | Terrestrial Soil | ANATIKKEAVLGLAAVTVKTQRDRWKVLNHYEEMTKPPANSNAP* |
| Ga0134123_110819252 | 3300010403 | Terrestrial Soil | DAAIAKADSNPSPANATIKREAILGLSMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP* |
| Ga0126317_103299722 | 3300011332 | Soil | SPANAMIKKESVLGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0157373_100292651 | 3300013100 | Corn Rhizosphere | KADSSPSPANATIKKEAVLGLSLIIERTQTQKDRWKVLNHYEELTKPPANSNAP* |
| Ga0157373_106414531 | 3300013100 | Corn Rhizosphere | NPSPANATIKKEAIFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP* |
| Ga0157371_105776671 | 3300013102 | Corn Rhizosphere | ATIKKEAIFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP* |
| Ga0157371_112517222 | 3300013102 | Corn Rhizosphere | AAIAKADANPSPANATIKRDAVLGLAAISVRTQTQRDRWKVLNHYEELTKPPANTNAP* |
| Ga0157378_117496651 | 3300013297 | Miscanthus Rhizosphere | PANATIKKEAIFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP* |
| Ga0157372_122022542 | 3300013307 | Corn Rhizosphere | AIAKADAAPSPANATIKKEAILGLAALSFRTNQGRWKTLNQYEELTKPPANSPAP* |
| Ga0157375_133547221 | 3300013308 | Miscanthus Rhizosphere | SPSPANSTIKKEAILGLGMVSVKTQTQKDKWKVLNHYNELTKPPANSNAP* |
| Ga0075331_11054161 | 3300014310 | Natural And Restored Wetlands | KSDSNPTPASATIKRDSILGLAAISVRTQRDRWKVLNHYEEVTRPPANTNAP* |
| Ga0163163_131895202 | 3300014325 | Switchgrass Rhizosphere | LGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP* |
| Ga0132255_1042873061 | 3300015374 | Arabidopsis Rhizosphere | KKEAILGLSMISVRTQKDRWKVLNHYEELTKTPTNSNAP* |
| Ga0207713_12280832 | 3300025735 | Switchgrass Rhizosphere | LGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207710_104648681 | 3300025900 | Switchgrass Rhizosphere | ITKADANPSPANATIKKEAIFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP |
| Ga0207688_103234143 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ANATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP |
| Ga0207643_101879711 | 3300025908 | Miscanthus Rhizosphere | VLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207684_105098482 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KEAILGLAAISVRTQRDRWKVLNHYEELTKPPAGANTPTSP |
| Ga0207654_102377751 | 3300025911 | Corn Rhizosphere | IKKEAVLGLAAVSVRTQRDRWKVLNHYEEMTKPPANSNAP |
| Ga0207657_113285032 | 3300025919 | Corn Rhizosphere | NATIKREAILGLSMVSVKTQTQKDKWKVLNQYDALIKPSANSNAPQQ |
| Ga0207649_115241321 | 3300025920 | Corn Rhizosphere | GKSDSNPSPSNATIKKEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP |
| Ga0207659_102527772 | 3300025926 | Miscanthus Rhizosphere | SPANATIKKESVLGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207686_105355362 | 3300025934 | Miscanthus Rhizosphere | VLGLASVSVKTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207709_105645372 | 3300025935 | Miscanthus Rhizosphere | GLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207670_111667431 | 3300025936 | Switchgrass Rhizosphere | EAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207689_108630041 | 3300025942 | Miscanthus Rhizosphere | NATVKKEAILGLSMISVRTQKDRWKVLNHYEELTKTPTNSNAP |
| Ga0207689_114590171 | 3300025942 | Miscanthus Rhizosphere | EAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP |
| Ga0207667_106228891 | 3300025949 | Corn Rhizosphere | ISKADANPSPANATIKKDAVLGLAAISVRTQRDRWKVLNHYEELTKPPANTNAP |
| Ga0207651_107336811 | 3300025960 | Switchgrass Rhizosphere | SVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207640_104782391 | 3300025981 | Corn Rhizosphere | PANATIKREAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207677_105214651 | 3300026023 | Miscanthus Rhizosphere | KKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0207703_108974601 | 3300026035 | Switchgrass Rhizosphere | DAAITRSDVNPTPANVTIKKEAIFGLAVVSVRTQTQKDRWKVLNHYEELTKPSANTNAP |
| Ga0207641_111154752 | 3300026088 | Switchgrass Rhizosphere | LGLSLISVRTQTQKDRWKVLNHYEQMTKPPANSNAP |
| Ga0207641_122316301 | 3300026088 | Switchgrass Rhizosphere | SKSDLNPTPANATIKKEAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANTNAP |
| Ga0207676_110433901 | 3300026095 | Switchgrass Rhizosphere | AAISKSDLNPTPTNATVKKEAILGLGMISVKTQKDRWKVLHHYDELTKPPTNSNAP |
| Ga0207676_120247971 | 3300026095 | Switchgrass Rhizosphere | AAIAKADAAPSPTSATIKKEAILGLAALSFKTQRDRWKTLNQYEELTKPPANTAAP |
| Ga0207674_122371722 | 3300026116 | Corn Rhizosphere | SNPSPTNATIKKEAIFGLSMVSVKTQTQKDKWKVLNHYDQMTKPPSNSNAP |
| Ga0207698_108039812 | 3300026142 | Corn Rhizosphere | KESVLGLSLISVRTNTQRDRGKVLNHYEELTKPPANSNAP |
| Ga0209177_101336012 | 3300027775 | Agricultural Soil | ANPSPANATIKKEAVFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP |
| Ga0209486_101019612 | 3300027886 | Agricultural Soil | SATIKKEAILGLAALSFRTNRDRWKTLNQYEEMTKPPANSSAP |
| Ga0268265_119231962 | 3300028380 | Switchgrass Rhizosphere | DAAIAKADGSPSPANATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP |
| Ga0310886_100941721 | 3300031562 | Soil | TPSAANATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKPPANSTAP |
| Ga0310904_112803911 | 3300031854 | Soil | GLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0310892_101500372 | 3300031858 | Soil | ANATIKKEAILGLAALSFRTNRDRWKTLNHYEELTKPPANSTAP |
| Ga0307406_112131571 | 3300031901 | Rhizosphere | SPANATVKKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0307407_100111125 | 3300031903 | Rhizosphere | PANATIKKEAVLGLAAVSVRTQRDRWKVLNHYEELTRPPANTNAP |
| Ga0310884_110866372 | 3300031944 | Soil | ATIKKEAILGLAALSFRTNRDRWKTLNHYEELTKPPANSTAP |
| Ga0307409_1013779632 | 3300031995 | Rhizosphere | ANATIKKEAVLGLAAVSVRTQRDRWKVLNHYEELTRPPANTNAP |
| Ga0307414_101060123 | 3300032004 | Rhizosphere | PANATVKKEAVLGLAAVSVRTQRDRWKVLNHYEELTRPPANTNAP |
| Ga0307414_109788592 | 3300032004 | Rhizosphere | ILGLAALSFKTQRDRWKTLNQYEELTKPPANSAAP |
| Ga0307411_115448222 | 3300032005 | Rhizosphere | PSPANATIKKESILGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0310810_106491421 | 3300033412 | Soil | NATIKKEAVLGLAAVSVKTQRDRWKVLNHYEELTKPPANSNAP |
| Ga0373959_0023102_1095_1205 | 3300034820 | Rhizosphere Soil | AVLGLAAVSVRTQRDRWKVLNHYEEMTKPPANSNAP |
| ⦗Top⦘ |