NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083212

Metagenome / Metatranscriptome Family F083212

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083212
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 46 residues
Representative Sequence NATIKKEAVLGLAAVSVKTQRDRWKVLNHYEELTKPPANSNAP
Number of Associated Samples 95
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.81 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(10.620 % of family members)
Environment Ontology (ENVO) Unclassified
(53.097 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(69.027 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.48%    β-sheet: 0.00%    Coil/Unstructured: 53.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF00069Pkinase 58.41
PF07714PK_Tyr_Ser-Thr 16.81
PF01966HD 1.77
PF12401FhaA_N 0.88
PF00154RecA 0.88
PF08239SH3_3 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 300.88
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_108955664All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300004114|Ga0062593_102630515All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300005289|Ga0065704_10665489All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300005290|Ga0065712_10446049All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300005293|Ga0065715_10115748All Organisms → cellular organisms → Bacteria2389Open in IMG/M
3300005293|Ga0065715_10580154All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300005293|Ga0065715_10883031All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300005334|Ga0068869_100200630All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300005336|Ga0070680_100673641All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300005336|Ga0070680_101826325All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300005341|Ga0070691_10942942All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300005343|Ga0070687_100213964All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300005345|Ga0070692_10028142All Organisms → cellular organisms → Bacteria2792Open in IMG/M
3300005354|Ga0070675_100933302All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005440|Ga0070705_100156771All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300005440|Ga0070705_100599767All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300005444|Ga0070694_100935529All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300005467|Ga0070706_100436893All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300005468|Ga0070707_100942521All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300005539|Ga0068853_102415672All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300005545|Ga0070695_101062809All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300005545|Ga0070695_101201580All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300005549|Ga0070704_100881771All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300005564|Ga0070664_102093927All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300005564|Ga0070664_102181312All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300005617|Ga0068859_100584294All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300005617|Ga0068859_102157044All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300005618|Ga0068864_101680311All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300005841|Ga0068863_100724119All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300005883|Ga0075299_1032193All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300006169|Ga0082029_1780890All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300006173|Ga0070716_100335135All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300006755|Ga0079222_11118869All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300006806|Ga0079220_11491679All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300006852|Ga0075433_11566120All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300006880|Ga0075429_100092784All Organisms → cellular organisms → Bacteria → Acidobacteria2633Open in IMG/M
3300006904|Ga0075424_102283349All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300006918|Ga0079216_11786264All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300006954|Ga0079219_10052097All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300007076|Ga0075435_100294742All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300009011|Ga0105251_10380236All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300009092|Ga0105250_10609647All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300009098|Ga0105245_12165806All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300009101|Ga0105247_10278583All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300009101|Ga0105247_11862070All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300009147|Ga0114129_11386211All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300009156|Ga0111538_11514143All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300009174|Ga0105241_10962907All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300009177|Ga0105248_10087247All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes3511Open in IMG/M
3300009553|Ga0105249_10450969All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300009553|Ga0105249_13442247All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300010038|Ga0126315_11149963All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300010042|Ga0126314_10460948All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300010042|Ga0126314_10839605All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300010359|Ga0126376_11248396All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300010359|Ga0126376_11316761All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300010373|Ga0134128_12531434All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300010397|Ga0134124_12834259All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300010399|Ga0134127_12485051All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300010401|Ga0134121_11043674All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300010401|Ga0134121_12584914All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300010403|Ga0134123_11081925All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300011332|Ga0126317_10329972All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300013100|Ga0157373_10029265All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes3969Open in IMG/M
3300013100|Ga0157373_10641453All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300013102|Ga0157371_10577667All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300013102|Ga0157371_11251722All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300013297|Ga0157378_11749665All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300013307|Ga0157372_12202254All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300013308|Ga0157375_13354722All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300014310|Ga0075331_1105416All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300014325|Ga0163163_13189520All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300015374|Ga0132255_104287306All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia605Open in IMG/M
3300025735|Ga0207713_1228083Not Available558Open in IMG/M
3300025900|Ga0207710_10464868All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300025901|Ga0207688_10323414All Organisms → cellular organisms → Bacteria → Acidobacteria947Open in IMG/M
3300025908|Ga0207643_10187971All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300025910|Ga0207684_10509848All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300025911|Ga0207654_10237775All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300025919|Ga0207657_11328503All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300025920|Ga0207649_11524132All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300025926|Ga0207659_10252777All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300025934|Ga0207686_10535536All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300025935|Ga0207709_10564537All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300025936|Ga0207670_11166743All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300025942|Ga0207689_10863004All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300025942|Ga0207689_11459017All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300025949|Ga0207667_10622889All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300025960|Ga0207651_10733681All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300025981|Ga0207640_10478239All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300026023|Ga0207677_10521465All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300026035|Ga0207703_10897460All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium848Open in IMG/M
3300026088|Ga0207641_11115475All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300026088|Ga0207641_12231630All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300026095|Ga0207676_11043390All Organisms → cellular organisms → Bacteria → Acidobacteria807Open in IMG/M
3300026095|Ga0207676_12024797All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300026116|Ga0207674_12237172All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300026142|Ga0207698_10803981All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300027775|Ga0209177_10133601All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300027886|Ga0209486_10101961All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300028380|Ga0268265_11923196All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300031562|Ga0310886_10094172All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300031854|Ga0310904_11280391All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300031858|Ga0310892_10150037All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300031901|Ga0307406_11213157All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300031903|Ga0307407_10011112All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes4273Open in IMG/M
3300031944|Ga0310884_11086637All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300031995|Ga0307409_101377963All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300032004|Ga0307414_10106012All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2126Open in IMG/M
3300032004|Ga0307414_10978859All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300032005|Ga0307411_11544822All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300033412|Ga0310810_10649142All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300034820|Ga0373959_0023102All Organisms → cellular organisms → Bacteria1207Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere8.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere7.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.31%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.31%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.31%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere3.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.54%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.77%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.89%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005883Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014310Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10895566413300000955SoilTIKKEAILGLSLISVRTQKQADRWKVLNHYEQMAKPSNSNAP*
Ga0062593_10263051513300004114SoilGSPSPANATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP*
Ga0065704_1066548913300005289Switchgrass RhizosphereATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPTNSNAR*
Ga0065712_1044604913300005290Miscanthus RhizosphereKSDSNPSPSNATIKKEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP*
Ga0065715_1011574813300005293Miscanthus RhizospherePSPANATIKKEAILGLSMISVRTQKDRWKVLNHYEELTKPPTNSNAP*
Ga0065715_1058015413300005293Miscanthus RhizosphereAFDAAVSKSDLNPSPANATIKKEAILGLSMISVKTQKDRWKVLNHYDELTKPPANSNAP*
Ga0065715_1088303113300005293Miscanthus RhizosphereSPANATIKKEAVFGLAAVSVKSQRQGDRWKVLNHYEQLTKPPANSNAP*
Ga0068869_10020063023300005334Miscanthus RhizosphereANATIKKDAVLGLAVISVRTQTQRDRWKVLNHYEELTKPPANTNAP*
Ga0070680_10067364123300005336Corn RhizosphereNATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKAPANSPAP*
Ga0070680_10182632513300005336Corn RhizosphereESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP*
Ga0070691_1094294223300005341Corn, Switchgrass And Miscanthus RhizosphereEAVLGLAAISVRTQRDRWKVLNHYEELTKPPASANTPSAP*
Ga0070687_10021396423300005343Switchgrass RhizosphereDATPSAANATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKPPANSTAP*
Ga0070692_1002814243300005345Corn, Switchgrass And Miscanthus RhizosphereSPANATIKKEAILGLSMISVRTQKDRWKVLNHYEELTKPPTNSNAP*
Ga0070675_10093330223300005354Miscanthus RhizosphereIKKEAILGLAALSFRTNRDRWKTLNQYEELTKAPANSPAP*
Ga0070705_10015677123300005440Corn, Switchgrass And Miscanthus RhizosphereSKADLNPSAANATIKKEATLGLAMISVRTQKDRWKVLNHYEELTKPAANTNAP*
Ga0070705_10059976723300005440Corn, Switchgrass And Miscanthus RhizosphereIKKEAVFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP*
Ga0070694_10093552923300005444Corn, Switchgrass And Miscanthus RhizospherePSPANATIKKEAVLGLAAISVRTQRDRWKVLNHFEELTKPPANTNAP*
Ga0070706_10043689313300005467Corn, Switchgrass And Miscanthus RhizosphereEAILGLAAISVRTQRDRWKVLNHYEELTKPPAGANTPTSP*
Ga0070707_10094252113300005468Corn, Switchgrass And Miscanthus RhizosphereATIKKEAVFGLAAVSVKSQRQGDRWKVLNHYEQLTKPPANSNAP*
Ga0068853_10241567213300005539Corn RhizosphereKSDLNPSPANATIKKEAILGLAAVSVRTQRDRWKVLNHYEELTKPPANTNAP*
Ga0070695_10106280913300005545Corn, Switchgrass And Miscanthus RhizosphereATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKPPANSTAP*
Ga0070695_10120158013300005545Corn, Switchgrass And Miscanthus RhizosphereAKADGSPSPANATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP*
Ga0070704_10088177123300005549Corn, Switchgrass And Miscanthus RhizosphereIAKADAAPSPTNATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKPPANSTAP*
Ga0070664_10209392713300005564Corn RhizosphereAAPSPTSATIKKEAILGLAALSFKTQRDRWKTLNQYEELTKPPANTAAP*
Ga0070664_10218131213300005564Corn RhizospherePTNATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKAPANSPAP*
Ga0068859_10058429413300005617Switchgrass RhizosphereAISKSDLNPSPANATIKKEAVLGLAAISVRTQRDRWKVLNHYEELTKPPANTNAP*
Ga0068859_10215704423300005617Switchgrass RhizosphereADLNPTPANATIKKEATLGLAMISVRTQKDRWKVLNHYEELTKRPTNSNAP*
Ga0068864_10168031113300005618Switchgrass RhizosphereVLGLAAVSVRTQRDRWKVLNHYEELTKPPANTNAP*
Ga0068863_10072411923300005841Switchgrass RhizosphereKKEAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP*
Ga0075299_103219323300005883Rice Paddy SoilKKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP*
Ga0082029_178089013300006169Termite NestKEAILGLSMISVRTQKDRWKVLNHYEELTKTPTNSNAP*
Ga0070716_10033513523300006173Corn, Switchgrass And Miscanthus RhizosphereTIKKEAVFGLAAVSVKTQRDRWKVLNHYEELTKPPQSANTPAAP*
Ga0079222_1111886913300006755Agricultural SoilGLAAVSVRTQKDRWKVLNHYEEITKPPAATSSPQTP*
Ga0079220_1149167913300006806Agricultural SoilKKEAVLALAAISVKTQRDHWKVLNQYEELTKPPTPANSPQTP*
Ga0075433_1156612023300006852Populus RhizosphereDANPSPANATIKKEAVLGLAAISVRTQRDRWKVLNHYEELTKPPASTNTPSAP*
Ga0075429_10009278433300006880Populus RhizosphereSPASTTIKKEAILGLAALSFKTQRDRWKTLNQYEELTKPPANSAAP*
Ga0075424_10228334923300006904Populus RhizosphereKEAVLGLAAVSVKTQRDRWKVLNHYEELTKPPANSNAP*
Ga0079216_1178626413300006918Agricultural SoilKESILGLAIISVRTQTQRDRWKVLNHYEELTKPPAGSTASPAP*
Ga0079219_1005209723300006954Agricultural SoilGLSLISVRTQTQKDRWKVLNHYEEMTKPPANSNAP*
Ga0075435_10029474213300007076Populus RhizosphereDAVLGLAAVSVKTQRQGDRWKVLNHYEQLTKPPTNSNAP*
Ga0105251_1038023613300009011Switchgrass RhizosphereAAIAKADSNPSPANATIKKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP*
Ga0105250_1060964713300009092Switchgrass RhizospherePANATIKKEAVLGLAAISIRTQKDRWKVLNHYEELTKPPASANTPSAP*
Ga0105245_1216580623300009098Miscanthus RhizosphereAAISKADQNPSPANATIKKESILGLSLISVKTQTQKDRWKVLNHYEQMTKPPANSNAP*
Ga0105247_1027858313300009101Switchgrass RhizosphereKEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP*
Ga0105247_1186207013300009101Switchgrass RhizosphereIKKEATLGLAMISVRTQKDRWKVLNHYEELTKPPTNSNAP*
Ga0114129_1138621113300009147Populus RhizosphereKKEATLGLAMISVRTQKDRWKVLNHYEELTKPAANTNAP*
Ga0111538_1151414313300009156Populus RhizosphereKEAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP*
Ga0105241_1096290713300009174Corn RhizosphereEAILGLSMISVRTQKDRWKVLNHYEELTKPPTNSNAP*
Ga0105248_1008724713300009177Switchgrass RhizospherePSNATIKKEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP*
Ga0105249_1045096923300009553Switchgrass RhizospherePSPANATIKKEAILGLSMITVRTQKDRWKVLNHYEELTKTPTNSNAP*
Ga0105249_1344224713300009553Switchgrass RhizosphereDSNPSPANATIKKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP*
Ga0126315_1114996313300010038Serpentine SoilAKADSNPSPATATIKKEAILGLSMVSVKTQTQKDKWKVLNHYDTLIKPPANPNAP*
Ga0126314_1046094823300010042Serpentine SoilAAIAKADSTPSPANATIKKESILGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP*
Ga0126314_1083960513300010042Serpentine SoilATIKKEAILGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP*
Ga0126376_1124839623300010359Tropical Forest SoilSKADANPSPANATIKKEAVLGLAAVTVKTQRDRWKVLNHYEEMTKPPANSNAP*
Ga0126376_1131676123300010359Tropical Forest SoilEAVLGLAAVSVRTQKARWKVLNHYEELTKPPANSNAP*
Ga0134128_1253143413300010373Terrestrial SoilVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP*
Ga0134124_1283425913300010397Terrestrial SoilTPANATIKKEATLGLAMITVRTQKDRWKVLNHYEELTKPPANSNAP*
Ga0134127_1248505123300010399Terrestrial SoilGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP*
Ga0134121_1104367423300010401Terrestrial SoilSPASATIKKEAILGLAALSFRTNRDRWKTLNQYEEMTHPPANSNAP*
Ga0134121_1258491413300010401Terrestrial SoilANATIKKEAVLGLAAVTVKTQRDRWKVLNHYEEMTKPPANSNAP*
Ga0134123_1108192523300010403Terrestrial SoilDAAIAKADSNPSPANATIKREAILGLSMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP*
Ga0126317_1032997223300011332SoilSPANAMIKKESVLGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP*
Ga0157373_1002926513300013100Corn RhizosphereKADSSPSPANATIKKEAVLGLSLIIERTQTQKDRWKVLNHYEELTKPPANSNAP*
Ga0157373_1064145313300013100Corn RhizosphereNPSPANATIKKEAIFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP*
Ga0157371_1057766713300013102Corn RhizosphereATIKKEAIFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP*
Ga0157371_1125172223300013102Corn RhizosphereAAIAKADANPSPANATIKRDAVLGLAAISVRTQTQRDRWKVLNHYEELTKPPANTNAP*
Ga0157378_1174966513300013297Miscanthus RhizospherePANATIKKEAIFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP*
Ga0157372_1220225423300013307Corn RhizosphereAIAKADAAPSPANATIKKEAILGLAALSFRTNQGRWKTLNQYEELTKPPANSPAP*
Ga0157375_1335472213300013308Miscanthus RhizosphereSPSPANSTIKKEAILGLGMVSVKTQTQKDKWKVLNHYNELTKPPANSNAP*
Ga0075331_110541613300014310Natural And Restored WetlandsKSDSNPTPASATIKRDSILGLAAISVRTQRDRWKVLNHYEEVTRPPANTNAP*
Ga0163163_1318952023300014325Switchgrass RhizosphereLGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP*
Ga0132255_10428730613300015374Arabidopsis RhizosphereKKEAILGLSMISVRTQKDRWKVLNHYEELTKTPTNSNAP*
Ga0207713_122808323300025735Switchgrass RhizosphereLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP
Ga0207710_1046486813300025900Switchgrass RhizosphereITKADANPSPANATIKKEAIFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP
Ga0207688_1032341433300025901Corn, Switchgrass And Miscanthus RhizosphereANATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP
Ga0207643_1018797113300025908Miscanthus RhizosphereVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP
Ga0207684_1050984823300025910Corn, Switchgrass And Miscanthus RhizosphereKEAILGLAAISVRTQRDRWKVLNHYEELTKPPAGANTPTSP
Ga0207654_1023777513300025911Corn RhizosphereIKKEAVLGLAAVSVRTQRDRWKVLNHYEEMTKPPANSNAP
Ga0207657_1132850323300025919Corn RhizosphereNATIKREAILGLSMVSVKTQTQKDKWKVLNQYDALIKPSANSNAPQQ
Ga0207649_1152413213300025920Corn RhizosphereGKSDSNPSPSNATIKKEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP
Ga0207659_1025277723300025926Miscanthus RhizosphereSPANATIKKESVLGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP
Ga0207686_1053553623300025934Miscanthus RhizosphereVLGLASVSVKTQRDRWKVLNHYEELTKPPANSNAP
Ga0207709_1056453723300025935Miscanthus RhizosphereGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP
Ga0207670_1116674313300025936Switchgrass RhizosphereEAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP
Ga0207689_1086300413300025942Miscanthus RhizosphereNATVKKEAILGLSMISVRTQKDRWKVLNHYEELTKTPTNSNAP
Ga0207689_1145901713300025942Miscanthus RhizosphereEAILGLSMISVKTQKDRWKVLNHYEELTKTPTNSNAP
Ga0207667_1062288913300025949Corn RhizosphereISKADANPSPANATIKKDAVLGLAAISVRTQRDRWKVLNHYEELTKPPANTNAP
Ga0207651_1073368113300025960Switchgrass RhizosphereSVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP
Ga0207640_1047823913300025981Corn RhizospherePANATIKREAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANSNAP
Ga0207677_1052146513300026023Miscanthus RhizosphereKKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP
Ga0207703_1089746013300026035Switchgrass RhizosphereDAAITRSDVNPTPANVTIKKEAIFGLAVVSVRTQTQKDRWKVLNHYEELTKPSANTNAP
Ga0207641_1111547523300026088Switchgrass RhizosphereLGLSLISVRTQTQKDRWKVLNHYEQMTKPPANSNAP
Ga0207641_1223163013300026088Switchgrass RhizosphereSKSDLNPTPANATIKKEAVLGLAAVSVRTQRDRWKVLNHYEELTKPPANTNAP
Ga0207676_1104339013300026095Switchgrass RhizosphereAAISKSDLNPTPTNATVKKEAILGLGMISVKTQKDRWKVLHHYDELTKPPTNSNAP
Ga0207676_1202479713300026095Switchgrass RhizosphereAAIAKADAAPSPTSATIKKEAILGLAALSFKTQRDRWKTLNQYEELTKPPANTAAP
Ga0207674_1223717223300026116Corn RhizosphereSNPSPTNATIKKEAIFGLSMVSVKTQTQKDKWKVLNHYDQMTKPPSNSNAP
Ga0207698_1080398123300026142Corn RhizosphereKESVLGLSLISVRTNTQRDRGKVLNHYEELTKPPANSNAP
Ga0209177_1013360123300027775Agricultural SoilANPSPANATIKKEAVFGLSMVGLKTQTQKDKWKALNHYDALTKPPANSNAP
Ga0209486_1010196123300027886Agricultural SoilSATIKKEAILGLAALSFRTNRDRWKTLNQYEEMTKPPANSSAP
Ga0268265_1192319623300028380Switchgrass RhizosphereDAAIAKADGSPSPANATIKREAIFGLGMVSVKTQTQKDKWKVLNHYDALTKPPANSNAP
Ga0310886_1009417213300031562SoilTPSAANATIKKEAILGLAALSFRTNRDRWKTLNQYEELTKPPANSTAP
Ga0310904_1128039113300031854SoilGLSLISVRTNTQRDRWKVLNHYEELTKPPANSNAP
Ga0310892_1015003723300031858SoilANATIKKEAILGLAALSFRTNRDRWKTLNHYEELTKPPANSTAP
Ga0307406_1121315713300031901RhizosphereSPANATVKKESVLGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP
Ga0307407_1001111253300031903RhizospherePANATIKKEAVLGLAAVSVRTQRDRWKVLNHYEELTRPPANTNAP
Ga0310884_1108663723300031944SoilATIKKEAILGLAALSFRTNRDRWKTLNHYEELTKPPANSTAP
Ga0307409_10137796323300031995RhizosphereANATIKKEAVLGLAAVSVRTQRDRWKVLNHYEELTRPPANTNAP
Ga0307414_1010601233300032004RhizospherePANATVKKEAVLGLAAVSVRTQRDRWKVLNHYEELTRPPANTNAP
Ga0307414_1097885923300032004RhizosphereILGLAALSFKTQRDRWKTLNQYEELTKPPANSAAP
Ga0307411_1154482223300032005RhizospherePSPANATIKKESILGLSLISVRTQTQRDRWKVLNHYEELTKPPANSNAP
Ga0310810_1064914213300033412SoilNATIKKEAVLGLAAVSVKTQRDRWKVLNHYEELTKPPANSNAP
Ga0373959_0023102_1095_12053300034820Rhizosphere SoilAVLGLAAVSVRTQRDRWKVLNHYEEMTKPPANSNAP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.