Basic Information | |
---|---|
Family ID | F083211 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 42 residues |
Representative Sequence | REAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.15 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.115 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.929 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.009 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.947 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF13432 | TPR_16 | 15.04 |
PF14622 | Ribonucleas_3_3 | 7.96 |
PF13414 | TPR_11 | 4.42 |
PF13374 | TPR_10 | 2.65 |
PF05170 | AsmA | 0.88 |
PF10502 | Peptidase_S26 | 0.88 |
PF14559 | TPR_19 | 0.88 |
PF13181 | TPR_8 | 0.88 |
PF13520 | AA_permease_2 | 0.88 |
PF07969 | Amidohydro_3 | 0.88 |
PF00717 | Peptidase_S24 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.12 % |
Unclassified | root | N/A | 0.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002909|JGI25388J43891_1018473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1240 | Open in IMG/M |
3300004081|Ga0063454_100748214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 746 | Open in IMG/M |
3300004092|Ga0062389_104393495 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300004605|Ga0068952_1189243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 563 | Open in IMG/M |
3300005406|Ga0070703_10174174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 826 | Open in IMG/M |
3300005536|Ga0070697_101188286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 680 | Open in IMG/M |
3300005538|Ga0070731_10605683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 729 | Open in IMG/M |
3300005541|Ga0070733_10022332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3939 | Open in IMG/M |
3300005553|Ga0066695_10015230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4170 | Open in IMG/M |
3300005558|Ga0066698_10119508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1756 | Open in IMG/M |
3300005576|Ga0066708_10463850 | Not Available | 814 | Open in IMG/M |
3300005591|Ga0070761_10084476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1814 | Open in IMG/M |
3300005598|Ga0066706_11131883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
3300005607|Ga0070740_10206277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 820 | Open in IMG/M |
3300005610|Ga0070763_10436545 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005842|Ga0068858_100720474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 971 | Open in IMG/M |
3300005843|Ga0068860_100413467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1336 | Open in IMG/M |
3300005878|Ga0075297_1017025 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300005921|Ga0070766_10491006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 815 | Open in IMG/M |
3300005950|Ga0066787_10062381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 737 | Open in IMG/M |
3300006046|Ga0066652_100516451 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300006050|Ga0075028_100356353 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300006172|Ga0075018_10001899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 7054 | Open in IMG/M |
3300006172|Ga0075018_10549589 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300006605|Ga0074057_10847893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 630 | Open in IMG/M |
3300006881|Ga0068865_100746653 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300009088|Ga0099830_10906387 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300009520|Ga0116214_1029093 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
3300009521|Ga0116222_1144236 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300009522|Ga0116218_1103312 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300009525|Ga0116220_10329928 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300010159|Ga0099796_10196873 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300010321|Ga0134067_10211299 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300010341|Ga0074045_10080043 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
3300010359|Ga0126376_11226807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
3300010361|Ga0126378_12597205 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300010364|Ga0134066_10365139 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300010379|Ga0136449_101417311 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300010398|Ga0126383_12028493 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300011270|Ga0137391_11561038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300011411|Ga0153933_1037067 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300012198|Ga0137364_11263911 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300012200|Ga0137382_10202559 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300012202|Ga0137363_10033323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3578 | Open in IMG/M |
3300012205|Ga0137362_10684865 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300012208|Ga0137376_11238423 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300012917|Ga0137395_10337244 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300012923|Ga0137359_11158807 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300012961|Ga0164302_10653939 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300013503|Ga0120127_10077833 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300014164|Ga0181532_10306678 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300015359|Ga0134085_10127007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
3300017943|Ga0187819_10761212 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300017955|Ga0187817_10201378 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300017970|Ga0187783_10393329 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300017970|Ga0187783_10789670 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300017970|Ga0187783_11128742 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300018007|Ga0187805_10098235 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300018017|Ga0187872_10263593 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300018085|Ga0187772_11327448 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300018088|Ga0187771_11177444 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300018433|Ga0066667_12231074 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300020579|Ga0210407_11418157 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300020582|Ga0210395_10238819 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300020583|Ga0210401_10007914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10593 | Open in IMG/M |
3300021088|Ga0210404_10159401 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300021171|Ga0210405_11335407 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300021178|Ga0210408_11514501 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300021344|Ga0193719_10396203 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300021401|Ga0210393_11637913 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300021402|Ga0210385_11297840 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300021405|Ga0210387_11274682 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300021432|Ga0210384_11107025 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300021432|Ga0210384_11440589 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300021433|Ga0210391_11045314 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300021479|Ga0210410_10170687 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
3300021559|Ga0210409_10514700 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300022522|Ga0242659_1012686 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300022717|Ga0242661_1074096 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300022724|Ga0242665_10368229 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300023101|Ga0224557_1073416 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300024295|Ga0224556_1079643 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300025893|Ga0207682_10607800 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300025914|Ga0207671_10134143 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
3300025914|Ga0207671_10449555 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300025972|Ga0207668_10150453 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
3300026214|Ga0209838_1060563 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300026309|Ga0209055_1117391 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300026343|Ga0209159_1169248 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300027738|Ga0208989_10019312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2344 | Open in IMG/M |
3300027853|Ga0209274_10095939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1458 | Open in IMG/M |
3300027855|Ga0209693_10157813 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300027889|Ga0209380_10336311 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300027894|Ga0209068_10069459 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
3300028016|Ga0265354_1006918 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300028380|Ga0268265_10280155 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300028381|Ga0268264_10328685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1448 | Open in IMG/M |
3300030659|Ga0316363_10115849 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300031716|Ga0310813_10101388 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
3300031740|Ga0307468_100545475 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300031890|Ga0306925_11609696 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300031912|Ga0306921_12676412 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031946|Ga0310910_10178592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1638 | Open in IMG/M |
3300031954|Ga0306926_10847542 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300031962|Ga0307479_10258911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1719 | Open in IMG/M |
3300032160|Ga0311301_10412925 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
3300032180|Ga0307471_100490188 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300032205|Ga0307472_100077059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2200 | Open in IMG/M |
3300032261|Ga0306920_101452517 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300032782|Ga0335082_11461613 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300032828|Ga0335080_12395159 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300032955|Ga0335076_11047498 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300033158|Ga0335077_10536572 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.85% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.19% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.31% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.42% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.54% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004605 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25388J43891_10184732 | 3300002909 | Grasslands Soil | FDLQEDREAALGHYRAALNAGAALPEAKAAAERGIQQAYEPPSHPQ* |
Ga0063454_1007482141 | 3300004081 | Soil | RIFDLQEDREAAVGHYKAAVIASSTLPEAKAAAELGLQKPYEPTRRSQ* |
Ga0062389_1043934952 | 3300004092 | Bog Forest Soil | FDLQEDRAAALDQYRAALTAGGSLPEAKAAAEHGIEQPYEPPSHPQ* |
Ga0068952_11892431 | 3300004605 | Peatlands Soil | EDRAAALDQYRAALTAGGALPEAKAAAERGIEQPYEPPGHSSNE* |
Ga0070703_101741742 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | GRIFDLQEDREAAIDQYRAAVTAGSGLPEAKAAAELGLQKPYEPTRRSQ* |
Ga0070697_1011882861 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | QENREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ* |
Ga0070731_106056832 | 3300005538 | Surface Soil | ALDHYRAAETAGSGLPEAKAAAELGLRQPYEPPSHPQ* |
Ga0070733_100223321 | 3300005541 | Surface Soil | ALDHYRAALNAGGGLPEIKAAAERGIKQPYEPPTKPQQQPD* |
Ga0066695_100152301 | 3300005553 | Soil | DQYRAALTAGASLPEAKAAAERGIQQPYEPPSHPQ* |
Ga0066698_101195081 | 3300005558 | Soil | GRIFDLQAERGAAIDHYRAALTAGASLPEAKAAAERGIQQPYEPPSHPQ* |
Ga0066708_104638502 | 3300005576 | Soil | HYRAALNAGAALPEAKAAAERGIQQPYEPPSRPQ* |
Ga0070761_100844763 | 3300005591 | Soil | VDQYRAALTAGGSLPEAKAAAERGIQQPYEPPSHPQQQD* |
Ga0066706_111318832 | 3300005598 | Soil | FDLQENRAAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ* |
Ga0070740_102062772 | 3300005607 | Surface Soil | VNHYKAALTASANLPEAKAAAERGLAQPYEPPSHAQQQ* |
Ga0070763_104365452 | 3300005610 | Soil | DQYRAALTAGGSLPEAKAAAEHGIEKPYEPPSRPQQQE* |
Ga0068858_1007204741 | 3300005842 | Switchgrass Rhizosphere | QEDREAAVGHYKAAVIASSTLPEAKAAAELGLQKPYEPTRRSQ* |
Ga0068860_1004134673 | 3300005843 | Switchgrass Rhizosphere | IFDLQEDREAAVGHYKAAVIASSTLPEAKAAAELGLQKPYEPTRRSQ* |
Ga0075297_10170251 | 3300005878 | Rice Paddy Soil | LGHYKAALGASTSLPEAKAAAERGLQQQYAPPKSADKQ* |
Ga0070766_104910061 | 3300005921 | Soil | QEDRAAAVDQYRAALTAGGSLPEAKAAAERGIQQPYEPPSRPQQQD* |
Ga0066787_100623812 | 3300005950 | Soil | EERDAALDHYRAALNAGEQLPEAKAAAQAGLQQPYEPPSHPQ* |
Ga0066652_1005164511 | 3300006046 | Soil | ALGHYRAALNAGAALPEAKAAAERGIQQAYEPPSHPQ* |
Ga0075028_1003563532 | 3300006050 | Watersheds | FDLQEDRPAALDHYRAAENAGSTLPEAKAAAELGLRQPYEPRRDPKQGDPQ* |
Ga0075018_100018991 | 3300006172 | Watersheds | LQEDRAAALDQYRAALTAGGSLPEAKAAAEHGIEKPYEPPSRPQQE* |
Ga0075018_105495891 | 3300006172 | Watersheds | AIGQYRAAVTAGSGLPEAKAAAELGLQKPYEPTRRSQ* |
Ga0074057_108478932 | 3300006605 | Soil | LQEDREAAVGHYKAAVIASSTLPEAKAAAELGLQKPYEPTRRSQ* |
Ga0068865_1007466532 | 3300006881 | Miscanthus Rhizosphere | FDLQEDREAAVGHYKAAVIAGSTLPEAKAAAELGLQKPYEPTRRSQ* |
Ga0099830_109063871 | 3300009088 | Vadose Zone Soil | EREAALSEYRAALSAGGDLPEIKAAAQRGIEQPYEPPSKPQ* |
Ga0116214_10290931 | 3300009520 | Peatlands Soil | LDQYRAALSAGVSLPEAKAAAEHGIEQPYEPPSHPQQ* |
Ga0116222_11442362 | 3300009521 | Peatlands Soil | AALDQYRAALSAGGALPEAKAAAEHGIEQPYEPPSHPQ* |
Ga0116218_11033121 | 3300009522 | Peatlands Soil | LDQYRAALSAGGALPEAKAAAEHGIQQPYEPPSHPQQQ* |
Ga0116220_103299281 | 3300009525 | Peatlands Soil | QYRAALSAGGALPEAKAAAEHGIQQPYEPPSHPQQQ* |
Ga0099796_101968732 | 3300010159 | Vadose Zone Soil | LGRIFDLQEDREAAMDHYRAAATAGSGLPEAKAAAELGLQKPYEPTRRSQ* |
Ga0134067_102112991 | 3300010321 | Grasslands Soil | EDRAAALDHYRAAANAGSGLPEAKAAAELGMQQPYEPPSHPQ* |
Ga0074045_100800434 | 3300010341 | Bog Forest Soil | VQYRAALSAGESLPEAKAAAEHGIAQPYEPPSHPQ* |
Ga0126376_112268071 | 3300010359 | Tropical Forest Soil | NQYHAALSTGGSLPEVKAAAESGLQQPYEPPAPR* |
Ga0126378_125972051 | 3300010361 | Tropical Forest Soil | LQENREAALNHYRAALSAGGSLPEAKAAAERGLEQPYEPPASSQQ* |
Ga0134066_103651392 | 3300010364 | Grasslands Soil | FDLQENRDAAVEQYRAALTAGAALPEAKAAAERGLAAPYEPPGGARKQDEDQ* |
Ga0136449_1014173111 | 3300010379 | Peatlands Soil | IFDLQEDRAAALDQYRAALTAGGALPEAKAAAERGIEQPYEPPGHSSNE* |
Ga0126383_120284931 | 3300010398 | Tropical Forest Soil | DTAVDHYRAALNTGGTLPEVKAAAERGLQQPYEPPAPRR* |
Ga0137391_115610381 | 3300011270 | Vadose Zone Soil | NEYRAALSTGADLPEIKAAAQRGLEQPYEPPSKPQ* |
Ga0153933_10370671 | 3300011411 | Attine Ant Fungus Gardens | EAALDQYRAALSAGGSLPEAKAAAEHGIEQPYEPPSHPQQ* |
Ga0137364_112639112 | 3300012198 | Vadose Zone Soil | DLQENREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ* |
Ga0137382_102025591 | 3300012200 | Vadose Zone Soil | REAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ* |
Ga0137363_100333235 | 3300012202 | Vadose Zone Soil | QEDRPAALDHYRAAESAGSALPEAKAAAELGLRQPYEPHSHPQ* |
Ga0137362_106848651 | 3300012205 | Vadose Zone Soil | QYRAAVTAGSGLPEAKAAAEMGLQKPYEPTRRSQ* |
Ga0137376_112384231 | 3300012208 | Vadose Zone Soil | FDLQENREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ* |
Ga0137395_103372441 | 3300012917 | Vadose Zone Soil | RIFDLQEDREAALGHYRAALNAGAALPEAKAAAERGIQQAYEPPSHPQ* |
Ga0137359_111588071 | 3300012923 | Vadose Zone Soil | HYHAALNAASTLPEVKAAAERGLQKPYEPSGVPQQPN* |
Ga0164302_106539391 | 3300012961 | Soil | QEDREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ* |
Ga0120127_100778331 | 3300013503 | Permafrost | DQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ* |
Ga0181532_103066781 | 3300014164 | Bog | QYRAALTAGGSLPEAKAAAERGIQQPYEPPSHPQQQD* |
Ga0134085_101270071 | 3300015359 | Grasslands Soil | DAAIDQYRAALTAGASLPEAKAAAERGIQQPYEPPSHPQ* |
Ga0187819_107612121 | 3300017943 | Freshwater Sediment | ILDMQEDREAALNHYRAALTTGASLPEAKAAAERGIAQPYEPPGHPQETKD |
Ga0187817_102013783 | 3300017955 | Freshwater Sediment | IFDLQKDREAALAQYRAALTAGAELPEAKAAAERGIQQPYEAHAHPQ |
Ga0187783_103933292 | 3300017970 | Tropical Peatland | DLEEDRAAALEHYRSALRASASLPEAKAAAEHGIEQPFELPSHSQNEQNKN |
Ga0187783_107896702 | 3300017970 | Tropical Peatland | EHYRSALRASASLPEAKAAAEHGIAQPFALPNHSQNEQDKN |
Ga0187783_111287422 | 3300017970 | Tropical Peatland | SALRASASLPEAKAAAEHGIEQPFELPSHSQNEENKN |
Ga0187805_100982351 | 3300018007 | Freshwater Sediment | AALDQYRAALSAGGALPEAKAAAEHGIEQPYEPPSHPQ |
Ga0187872_102635931 | 3300018017 | Peatland | RAAALDQYHAALTAGGALPEAKAAAERGIEEPYEPPSHPRQE |
Ga0187772_113274481 | 3300018085 | Tropical Peatland | AAAIDHYRLALSASASLPEAKAAAEHGLAQPFELPTHPQNDTGKRN |
Ga0187771_111774441 | 3300018088 | Tropical Peatland | AALDHYRAALSASVSLPEAKAAAERGLQQPYEPPHQPQDTKN |
Ga0066667_122310741 | 3300018433 | Grasslands Soil | NREAALNHYRAAKTAGGSLPEAKAAAERGLEQPYEPPASPQ |
Ga0210407_114181571 | 3300020579 | Soil | EAALDHYRAAANAGSALPEAKAAAELGLQQPYEPARRPQ |
Ga0210395_102388193 | 3300020582 | Soil | QYRAALTAGGLLPEAKAAAERGIQQPYEPPSHPQQQD |
Ga0210401_100079141 | 3300020583 | Soil | AALDQYRAALSAGGSLPEAKAAAEHGIAQPYEPPSHPQQ |
Ga0210404_101594011 | 3300021088 | Soil | LDQYRAALNAGGALPEVKEAAERGMQKPYEPPAKPR |
Ga0210405_113354071 | 3300021171 | Soil | REAAIDQYRAAVTAGSGLPEAKAAAESGLQKPYEPTRRSQ |
Ga0210408_115145011 | 3300021178 | Soil | DLKEQRETALDHYRAALSTGGILPEVKEAAERGLRQPYEPPASRQ |
Ga0193719_103962032 | 3300021344 | Soil | VDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ |
Ga0210393_116379131 | 3300021401 | Soil | FDLQEERAAALDQYRAALTAGGSLPEAKAAAERGIAHPYEPPSHPQQQD |
Ga0210385_112978402 | 3300021402 | Soil | FDLQEQRENALDQYHAALNAGGALPEVKAAAEHGLQKPYEPPAARQ |
Ga0210387_112746822 | 3300021405 | Soil | DHYRAALTTGGELPEVKAAAERGIQTPYEPPARPQ |
Ga0210384_111070251 | 3300021432 | Soil | NREAALDQYRAALTAGGSLPEAKAAAERGIQQPYEPPSRPQQE |
Ga0210384_114405891 | 3300021432 | Soil | QEDREAALDHYRAAANAGSALPEAKAAAELGLQQPYEPARRPQ |
Ga0210391_110453141 | 3300021433 | Soil | QRETALDHYRAALRTGGILPEVKEAAERGLRQPYEPPASRQ |
Ga0210410_101706871 | 3300021479 | Soil | LVQYRAALSAGESLPEAKAAAEHGIAQPYEPPSHPQ |
Ga0210409_105147002 | 3300021559 | Soil | LQEDREAAVVQYRAALDAGSALPEARAAAQHGLEKPYEPPSHPR |
Ga0242659_10126862 | 3300022522 | Soil | AALDQYRAALTAGGTLPEAKAAAERGIQQPYEPPSHPQ |
Ga0242661_10740962 | 3300022717 | Soil | EAALDQYRAALTAGGTLPEAKAAAERGIQQPYEPPSHPQ |
Ga0242665_103682292 | 3300022724 | Soil | FDLQEDREAAMDHYRAAATAGSGLPEAKAAAELGLQKPYEPTRRSQ |
Ga0224557_10734163 | 3300023101 | Soil | SALDQYRAALTAGGALPEAKAAAEHGIEQPYEPPSHPQQE |
Ga0224556_10796431 | 3300024295 | Soil | DREQALTHYRAALTAGASLPEAKAAAQRGLAQPYEPPHPQQQQP |
Ga0207682_106078002 | 3300025893 | Miscanthus Rhizosphere | AMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ |
Ga0207671_101341433 | 3300025914 | Corn Rhizosphere | LQEDREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ |
Ga0207671_104495552 | 3300025914 | Corn Rhizosphere | DHYRAAETAGSTLPEAKAAAELGLRQPYEPRRDPKQDDSKDPN |
Ga0207668_101504531 | 3300025972 | Switchgrass Rhizosphere | RILDLQEVREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ |
Ga0209838_10605632 | 3300026214 | Soil | EERDAALDHYRAALNAGEQLPEAKAAAQAGLQQPYEPPSHPQ |
Ga0209055_11173911 | 3300026309 | Soil | ENREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ |
Ga0209159_11692482 | 3300026343 | Soil | DAAIDQYRAALTAGASLPEAKAAAERGIQQPYEPPSHPQ |
Ga0208989_100193121 | 3300027738 | Forest Soil | QAALDQYRAALNAGGALPEVKEAAERGLQQPYEPPAKPR |
Ga0209274_100959391 | 3300027853 | Soil | VDQYRAALTAGGSLPEAKAAAERGIQQPYEPPSHPQQQD |
Ga0209693_101578132 | 3300027855 | Soil | DQYRAALTAGGSLPEAKAAAEHGIEKPYEPPSRPQQQE |
Ga0209380_103363111 | 3300027889 | Soil | REAALDQYRAALSAGGSLPEAKAAAEHGIEQPYEPPSHPQQ |
Ga0209068_100694593 | 3300027894 | Watersheds | DLQEDREAALDHYRAAVNAGSALPEAKAAAELGLQQPYEPTRHPQ |
Ga0265354_10069182 | 3300028016 | Rhizosphere | RAALTAGGSLPEAKAAAEHGIAHPYEPPSHPQQQD |
Ga0268265_102801551 | 3300028380 | Switchgrass Rhizosphere | DLQEDREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ |
Ga0268264_103286853 | 3300028381 | Switchgrass Rhizosphere | GRIFDLQEDREAAVGHYKAAVIAGSTLPEAKAAAELGLQKPYEPTRRSQ |
Ga0316363_101158492 | 3300030659 | Peatlands Soil | RAAALDHYRAALSAGASLPEAKAAAERGIQQPYEPPTQPQKQDE |
Ga0310813_101013884 | 3300031716 | Soil | REAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ |
Ga0307468_1005454752 | 3300031740 | Hardwood Forest Soil | DREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ |
Ga0306925_116096961 | 3300031890 | Soil | ETAVTHYRAALSAAGSLPEAKAAAERGLQQPYEPPAPAQ |
Ga0306921_126764122 | 3300031912 | Soil | DREAALVQYRAALSAGESLPEAKAAAEHGIAQPYEPPSHPSQQ |
Ga0310910_101785923 | 3300031946 | Soil | LDLEEDRAAAIDHYRLALSASASLPEAKAAAEHGLAQPFVPPPHPQNDPGKRN |
Ga0306926_108475421 | 3300031954 | Soil | AAIDHYRLALSASASLPEAKAAAEHGLAQPFVPPAHPQNDPGKRN |
Ga0307479_102589113 | 3300031962 | Hardwood Forest Soil | DREAAMDHYRAAATAGSGLPEAKAAAELGLQKPYEPTRRSQ |
Ga0311301_104129251 | 3300032160 | Peatlands Soil | DVQEDREAALGHYRAALTAGATVPEAKAAAERGIQQPYEPPNHQPKEP |
Ga0307471_1004901881 | 3300032180 | Hardwood Forest Soil | AALDHYRAAANAGSALPEAKAAAELGLQQPYEPARRPQ |
Ga0307472_1000770591 | 3300032205 | Hardwood Forest Soil | DLQENRPVAIDHYRAALNAGASLPEAKAAAERGLQQPYEPRSHPE |
Ga0306920_1014525172 | 3300032261 | Soil | REAAMDQYRAALSTGGTLPEVKSAAERGLQQPYEPPTSPQPQE |
Ga0335082_114616131 | 3300032782 | Soil | LDHYRAALTAASTLPEAKAAAEKGIQQPYEPPRHPQQ |
Ga0335080_123951592 | 3300032828 | Soil | DLQNNRELALSHYRTALSAGGALPGVKAAAERGLQQPYEPPSHSNQ |
Ga0335076_110474982 | 3300032955 | Soil | HYRAALNLGAEVPEVKAAAERGLQTPYEPPSHPQQN |
Ga0335077_105365721 | 3300033158 | Soil | DRAAAIDHYRLALSASASLPEAKAAAEHGLAQPFEIPTHPQNDPGKRN |
⦗Top⦘ |