NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083211

Metagenome / Metatranscriptome Family F083211

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083211
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 42 residues
Representative Sequence REAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ
Number of Associated Samples 108
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.15 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.929 % of family members)
Environment Ontology (ENVO) Unclassified
(23.009 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.947 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 39.71%    β-sheet: 0.00%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13432TPR_16 15.04
PF14622Ribonucleas_3_3 7.96
PF13414TPR_11 4.42
PF13374TPR_10 2.65
PF05170AsmA 0.88
PF10502Peptidase_S26 0.88
PF14559TPR_19 0.88
PF13181TPR_8 0.88
PF13520AA_permease_2 0.88
PF07969Amidohydro_3 0.88
PF00717Peptidase_S24 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002909|JGI25388J43891_1018473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1240Open in IMG/M
3300004081|Ga0063454_100748214All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae746Open in IMG/M
3300004092|Ga0062389_104393495All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300004605|Ga0068952_1189243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae563Open in IMG/M
3300005406|Ga0070703_10174174All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter826Open in IMG/M
3300005536|Ga0070697_101188286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae680Open in IMG/M
3300005538|Ga0070731_10605683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae729Open in IMG/M
3300005541|Ga0070733_10022332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3939Open in IMG/M
3300005553|Ga0066695_10015230All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter4170Open in IMG/M
3300005558|Ga0066698_10119508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1756Open in IMG/M
3300005576|Ga0066708_10463850Not Available814Open in IMG/M
3300005591|Ga0070761_10084476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1814Open in IMG/M
3300005598|Ga0066706_11131883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae597Open in IMG/M
3300005607|Ga0070740_10206277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae820Open in IMG/M
3300005610|Ga0070763_10436545All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005842|Ga0068858_100720474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae971Open in IMG/M
3300005843|Ga0068860_100413467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1336Open in IMG/M
3300005878|Ga0075297_1017025All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300005921|Ga0070766_10491006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae815Open in IMG/M
3300005950|Ga0066787_10062381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae737Open in IMG/M
3300006046|Ga0066652_100516451All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300006050|Ga0075028_100356353All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300006172|Ga0075018_10001899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium7054Open in IMG/M
3300006172|Ga0075018_10549589All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300006605|Ga0074057_10847893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae630Open in IMG/M
3300006881|Ga0068865_100746653All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300009088|Ga0099830_10906387All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300009520|Ga0116214_1029093All Organisms → cellular organisms → Bacteria1984Open in IMG/M
3300009521|Ga0116222_1144236All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300009522|Ga0116218_1103312All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300009525|Ga0116220_10329928All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300010159|Ga0099796_10196873All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300010321|Ga0134067_10211299All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300010341|Ga0074045_10080043All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300010359|Ga0126376_11226807All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300010361|Ga0126378_12597205All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300010364|Ga0134066_10365139All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300010379|Ga0136449_101417311All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300010398|Ga0126383_12028493All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300011270|Ga0137391_11561038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300011411|Ga0153933_1037067All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300012198|Ga0137364_11263911All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300012200|Ga0137382_10202559All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300012202|Ga0137363_10033323All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3578Open in IMG/M
3300012205|Ga0137362_10684865All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300012208|Ga0137376_11238423All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300012917|Ga0137395_10337244All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300012923|Ga0137359_11158807All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300012961|Ga0164302_10653939All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300013503|Ga0120127_10077833All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300014164|Ga0181532_10306678All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300015359|Ga0134085_10127007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1072Open in IMG/M
3300017943|Ga0187819_10761212All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300017955|Ga0187817_10201378All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300017970|Ga0187783_10393329All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300017970|Ga0187783_10789670All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300017970|Ga0187783_11128742All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300018007|Ga0187805_10098235All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300018017|Ga0187872_10263593All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300018085|Ga0187772_11327448All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300018088|Ga0187771_11177444All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300018433|Ga0066667_12231074All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300020579|Ga0210407_11418157All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300020582|Ga0210395_10238819All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300020583|Ga0210401_10007914All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10593Open in IMG/M
3300021088|Ga0210404_10159401All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300021171|Ga0210405_11335407All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300021178|Ga0210408_11514501All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300021344|Ga0193719_10396203All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300021401|Ga0210393_11637913All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300021402|Ga0210385_11297840All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300021405|Ga0210387_11274682All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300021432|Ga0210384_11107025All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300021432|Ga0210384_11440589All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300021433|Ga0210391_11045314All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300021479|Ga0210410_10170687All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300021559|Ga0210409_10514700All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300022522|Ga0242659_1012686All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300022717|Ga0242661_1074096All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300022724|Ga0242665_10368229All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300023101|Ga0224557_1073416All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300024295|Ga0224556_1079643All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300025893|Ga0207682_10607800All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300025914|Ga0207671_10134143All Organisms → cellular organisms → Bacteria1903Open in IMG/M
3300025914|Ga0207671_10449555All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300025972|Ga0207668_10150453All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300026214|Ga0209838_1060563All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300026309|Ga0209055_1117391All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300026343|Ga0209159_1169248All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300027738|Ga0208989_10019312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2344Open in IMG/M
3300027853|Ga0209274_10095939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1458Open in IMG/M
3300027855|Ga0209693_10157813All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300027889|Ga0209380_10336311All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300027894|Ga0209068_10069459All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300028016|Ga0265354_1006918All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300028380|Ga0268265_10280155All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300028381|Ga0268264_10328685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1448Open in IMG/M
3300030659|Ga0316363_10115849All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300031716|Ga0310813_10101388All Organisms → cellular organisms → Bacteria2238Open in IMG/M
3300031740|Ga0307468_100545475All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300031890|Ga0306925_11609696All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300031912|Ga0306921_12676412All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031946|Ga0310910_10178592All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1638Open in IMG/M
3300031954|Ga0306926_10847542All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300031962|Ga0307479_10258911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1719Open in IMG/M
3300032160|Ga0311301_10412925All Organisms → cellular organisms → Bacteria2059Open in IMG/M
3300032180|Ga0307471_100490188All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300032205|Ga0307472_100077059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2200Open in IMG/M
3300032261|Ga0306920_101452517All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300032782|Ga0335082_11461613All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300032828|Ga0335080_12395159All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300032955|Ga0335076_11047498All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300033158|Ga0335077_10536572All Organisms → cellular organisms → Bacteria1231Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.19%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.31%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.42%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.77%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.77%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.89%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002909Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cmEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004605Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005878Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011411Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026214Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25388J43891_101847323300002909Grasslands SoilFDLQEDREAALGHYRAALNAGAALPEAKAAAERGIQQAYEPPSHPQ*
Ga0063454_10074821413300004081SoilRIFDLQEDREAAVGHYKAAVIASSTLPEAKAAAELGLQKPYEPTRRSQ*
Ga0062389_10439349523300004092Bog Forest SoilFDLQEDRAAALDQYRAALTAGGSLPEAKAAAEHGIEQPYEPPSHPQ*
Ga0068952_118924313300004605Peatlands SoilEDRAAALDQYRAALTAGGALPEAKAAAERGIEQPYEPPGHSSNE*
Ga0070703_1017417423300005406Corn, Switchgrass And Miscanthus RhizosphereGRIFDLQEDREAAIDQYRAAVTAGSGLPEAKAAAELGLQKPYEPTRRSQ*
Ga0070697_10118828613300005536Corn, Switchgrass And Miscanthus RhizosphereQENREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ*
Ga0070731_1060568323300005538Surface SoilALDHYRAAETAGSGLPEAKAAAELGLRQPYEPPSHPQ*
Ga0070733_1002233213300005541Surface SoilALDHYRAALNAGGGLPEIKAAAERGIKQPYEPPTKPQQQPD*
Ga0066695_1001523013300005553SoilDQYRAALTAGASLPEAKAAAERGIQQPYEPPSHPQ*
Ga0066698_1011950813300005558SoilGRIFDLQAERGAAIDHYRAALTAGASLPEAKAAAERGIQQPYEPPSHPQ*
Ga0066708_1046385023300005576SoilHYRAALNAGAALPEAKAAAERGIQQPYEPPSRPQ*
Ga0070761_1008447633300005591SoilVDQYRAALTAGGSLPEAKAAAERGIQQPYEPPSHPQQQD*
Ga0066706_1113188323300005598SoilFDLQENRAAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ*
Ga0070740_1020627723300005607Surface SoilVNHYKAALTASANLPEAKAAAERGLAQPYEPPSHAQQQ*
Ga0070763_1043654523300005610SoilDQYRAALTAGGSLPEAKAAAEHGIEKPYEPPSRPQQQE*
Ga0068858_10072047413300005842Switchgrass RhizosphereQEDREAAVGHYKAAVIASSTLPEAKAAAELGLQKPYEPTRRSQ*
Ga0068860_10041346733300005843Switchgrass RhizosphereIFDLQEDREAAVGHYKAAVIASSTLPEAKAAAELGLQKPYEPTRRSQ*
Ga0075297_101702513300005878Rice Paddy SoilLGHYKAALGASTSLPEAKAAAERGLQQQYAPPKSADKQ*
Ga0070766_1049100613300005921SoilQEDRAAAVDQYRAALTAGGSLPEAKAAAERGIQQPYEPPSRPQQQD*
Ga0066787_1006238123300005950SoilEERDAALDHYRAALNAGEQLPEAKAAAQAGLQQPYEPPSHPQ*
Ga0066652_10051645113300006046SoilALGHYRAALNAGAALPEAKAAAERGIQQAYEPPSHPQ*
Ga0075028_10035635323300006050WatershedsFDLQEDRPAALDHYRAAENAGSTLPEAKAAAELGLRQPYEPRRDPKQGDPQ*
Ga0075018_1000189913300006172WatershedsLQEDRAAALDQYRAALTAGGSLPEAKAAAEHGIEKPYEPPSRPQQE*
Ga0075018_1054958913300006172WatershedsAIGQYRAAVTAGSGLPEAKAAAELGLQKPYEPTRRSQ*
Ga0074057_1084789323300006605SoilLQEDREAAVGHYKAAVIASSTLPEAKAAAELGLQKPYEPTRRSQ*
Ga0068865_10074665323300006881Miscanthus RhizosphereFDLQEDREAAVGHYKAAVIAGSTLPEAKAAAELGLQKPYEPTRRSQ*
Ga0099830_1090638713300009088Vadose Zone SoilEREAALSEYRAALSAGGDLPEIKAAAQRGIEQPYEPPSKPQ*
Ga0116214_102909313300009520Peatlands SoilLDQYRAALSAGVSLPEAKAAAEHGIEQPYEPPSHPQQ*
Ga0116222_114423623300009521Peatlands SoilAALDQYRAALSAGGALPEAKAAAEHGIEQPYEPPSHPQ*
Ga0116218_110331213300009522Peatlands SoilLDQYRAALSAGGALPEAKAAAEHGIQQPYEPPSHPQQQ*
Ga0116220_1032992813300009525Peatlands SoilQYRAALSAGGALPEAKAAAEHGIQQPYEPPSHPQQQ*
Ga0099796_1019687323300010159Vadose Zone SoilLGRIFDLQEDREAAMDHYRAAATAGSGLPEAKAAAELGLQKPYEPTRRSQ*
Ga0134067_1021129913300010321Grasslands SoilEDRAAALDHYRAAANAGSGLPEAKAAAELGMQQPYEPPSHPQ*
Ga0074045_1008004343300010341Bog Forest SoilVQYRAALSAGESLPEAKAAAEHGIAQPYEPPSHPQ*
Ga0126376_1122680713300010359Tropical Forest SoilNQYHAALSTGGSLPEVKAAAESGLQQPYEPPAPR*
Ga0126378_1259720513300010361Tropical Forest SoilLQENREAALNHYRAALSAGGSLPEAKAAAERGLEQPYEPPASSQQ*
Ga0134066_1036513923300010364Grasslands SoilFDLQENRDAAVEQYRAALTAGAALPEAKAAAERGLAAPYEPPGGARKQDEDQ*
Ga0136449_10141731113300010379Peatlands SoilIFDLQEDRAAALDQYRAALTAGGALPEAKAAAERGIEQPYEPPGHSSNE*
Ga0126383_1202849313300010398Tropical Forest SoilDTAVDHYRAALNTGGTLPEVKAAAERGLQQPYEPPAPRR*
Ga0137391_1156103813300011270Vadose Zone SoilNEYRAALSTGADLPEIKAAAQRGLEQPYEPPSKPQ*
Ga0153933_103706713300011411Attine Ant Fungus GardensEAALDQYRAALSAGGSLPEAKAAAEHGIEQPYEPPSHPQQ*
Ga0137364_1126391123300012198Vadose Zone SoilDLQENREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ*
Ga0137382_1020255913300012200Vadose Zone SoilREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ*
Ga0137363_1003332353300012202Vadose Zone SoilQEDRPAALDHYRAAESAGSALPEAKAAAELGLRQPYEPHSHPQ*
Ga0137362_1068486513300012205Vadose Zone SoilQYRAAVTAGSGLPEAKAAAEMGLQKPYEPTRRSQ*
Ga0137376_1123842313300012208Vadose Zone SoilFDLQENREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ*
Ga0137395_1033724413300012917Vadose Zone SoilRIFDLQEDREAALGHYRAALNAGAALPEAKAAAERGIQQAYEPPSHPQ*
Ga0137359_1115880713300012923Vadose Zone SoilHYHAALNAASTLPEVKAAAERGLQKPYEPSGVPQQPN*
Ga0164302_1065393913300012961SoilQEDREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ*
Ga0120127_1007783313300013503PermafrostDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ*
Ga0181532_1030667813300014164BogQYRAALTAGGSLPEAKAAAERGIQQPYEPPSHPQQQD*
Ga0134085_1012700713300015359Grasslands SoilDAAIDQYRAALTAGASLPEAKAAAERGIQQPYEPPSHPQ*
Ga0187819_1076121213300017943Freshwater SedimentILDMQEDREAALNHYRAALTTGASLPEAKAAAERGIAQPYEPPGHPQETKD
Ga0187817_1020137833300017955Freshwater SedimentIFDLQKDREAALAQYRAALTAGAELPEAKAAAERGIQQPYEAHAHPQ
Ga0187783_1039332923300017970Tropical PeatlandDLEEDRAAALEHYRSALRASASLPEAKAAAEHGIEQPFELPSHSQNEQNKN
Ga0187783_1078967023300017970Tropical PeatlandEHYRSALRASASLPEAKAAAEHGIAQPFALPNHSQNEQDKN
Ga0187783_1112874223300017970Tropical PeatlandSALRASASLPEAKAAAEHGIEQPFELPSHSQNEENKN
Ga0187805_1009823513300018007Freshwater SedimentAALDQYRAALSAGGALPEAKAAAEHGIEQPYEPPSHPQ
Ga0187872_1026359313300018017PeatlandRAAALDQYHAALTAGGALPEAKAAAERGIEEPYEPPSHPRQE
Ga0187772_1132744813300018085Tropical PeatlandAAAIDHYRLALSASASLPEAKAAAEHGLAQPFELPTHPQNDTGKRN
Ga0187771_1117744413300018088Tropical PeatlandAALDHYRAALSASVSLPEAKAAAERGLQQPYEPPHQPQDTKN
Ga0066667_1223107413300018433Grasslands SoilNREAALNHYRAAKTAGGSLPEAKAAAERGLEQPYEPPASPQ
Ga0210407_1141815713300020579SoilEAALDHYRAAANAGSALPEAKAAAELGLQQPYEPARRPQ
Ga0210395_1023881933300020582SoilQYRAALTAGGLLPEAKAAAERGIQQPYEPPSHPQQQD
Ga0210401_1000791413300020583SoilAALDQYRAALSAGGSLPEAKAAAEHGIAQPYEPPSHPQQ
Ga0210404_1015940113300021088SoilLDQYRAALNAGGALPEVKEAAERGMQKPYEPPAKPR
Ga0210405_1133540713300021171SoilREAAIDQYRAAVTAGSGLPEAKAAAESGLQKPYEPTRRSQ
Ga0210408_1151450113300021178SoilDLKEQRETALDHYRAALSTGGILPEVKEAAERGLRQPYEPPASRQ
Ga0193719_1039620323300021344SoilVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ
Ga0210393_1163791313300021401SoilFDLQEERAAALDQYRAALTAGGSLPEAKAAAERGIAHPYEPPSHPQQQD
Ga0210385_1129784023300021402SoilFDLQEQRENALDQYHAALNAGGALPEVKAAAEHGLQKPYEPPAARQ
Ga0210387_1127468223300021405SoilDHYRAALTTGGELPEVKAAAERGIQTPYEPPARPQ
Ga0210384_1110702513300021432SoilNREAALDQYRAALTAGGSLPEAKAAAERGIQQPYEPPSRPQQE
Ga0210384_1144058913300021432SoilQEDREAALDHYRAAANAGSALPEAKAAAELGLQQPYEPARRPQ
Ga0210391_1104531413300021433SoilQRETALDHYRAALRTGGILPEVKEAAERGLRQPYEPPASRQ
Ga0210410_1017068713300021479SoilLVQYRAALSAGESLPEAKAAAEHGIAQPYEPPSHPQ
Ga0210409_1051470023300021559SoilLQEDREAAVVQYRAALDAGSALPEARAAAQHGLEKPYEPPSHPR
Ga0242659_101268623300022522SoilAALDQYRAALTAGGTLPEAKAAAERGIQQPYEPPSHPQ
Ga0242661_107409623300022717SoilEAALDQYRAALTAGGTLPEAKAAAERGIQQPYEPPSHPQ
Ga0242665_1036822923300022724SoilFDLQEDREAAMDHYRAAATAGSGLPEAKAAAELGLQKPYEPTRRSQ
Ga0224557_107341633300023101SoilSALDQYRAALTAGGALPEAKAAAEHGIEQPYEPPSHPQQE
Ga0224556_107964313300024295SoilDREQALTHYRAALTAGASLPEAKAAAQRGLAQPYEPPHPQQQQP
Ga0207682_1060780023300025893Miscanthus RhizosphereAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ
Ga0207671_1013414333300025914Corn RhizosphereLQEDREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ
Ga0207671_1044955523300025914Corn RhizosphereDHYRAAETAGSTLPEAKAAAELGLRQPYEPRRDPKQDDSKDPN
Ga0207668_1015045313300025972Switchgrass RhizosphereRILDLQEVREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ
Ga0209838_106056323300026214SoilEERDAALDHYRAALNAGEQLPEAKAAAQAGLQQPYEPPSHPQ
Ga0209055_111739113300026309SoilENREAAVDQYRAALNAGASLPEAKAAAERGLQQPYEPPSHPQ
Ga0209159_116924823300026343SoilDAAIDQYRAALTAGASLPEAKAAAERGIQQPYEPPSHPQ
Ga0208989_1001931213300027738Forest SoilQAALDQYRAALNAGGALPEVKEAAERGLQQPYEPPAKPR
Ga0209274_1009593913300027853SoilVDQYRAALTAGGSLPEAKAAAERGIQQPYEPPSHPQQQD
Ga0209693_1015781323300027855SoilDQYRAALTAGGSLPEAKAAAEHGIEKPYEPPSRPQQQE
Ga0209380_1033631113300027889SoilREAALDQYRAALSAGGSLPEAKAAAEHGIEQPYEPPSHPQQ
Ga0209068_1006945933300027894WatershedsDLQEDREAALDHYRAAVNAGSALPEAKAAAELGLQQPYEPTRHPQ
Ga0265354_100691823300028016RhizosphereRAALTAGGSLPEAKAAAEHGIAHPYEPPSHPQQQD
Ga0268265_1028015513300028380Switchgrass RhizosphereDLQEDREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ
Ga0268264_1032868533300028381Switchgrass RhizosphereGRIFDLQEDREAAVGHYKAAVIAGSTLPEAKAAAELGLQKPYEPTRRSQ
Ga0316363_1011584923300030659Peatlands SoilRAAALDHYRAALSAGASLPEAKAAAERGIQQPYEPPTQPQKQDE
Ga0310813_1010138843300031716SoilREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ
Ga0307468_10054547523300031740Hardwood Forest SoilDREAAMDHYRAAATAGSSLPEAKAAAERGLQKPYEPTRRSQ
Ga0306925_1160969613300031890SoilETAVTHYRAALSAAGSLPEAKAAAERGLQQPYEPPAPAQ
Ga0306921_1267641223300031912SoilDREAALVQYRAALSAGESLPEAKAAAEHGIAQPYEPPSHPSQQ
Ga0310910_1017859233300031946SoilLDLEEDRAAAIDHYRLALSASASLPEAKAAAEHGLAQPFVPPPHPQNDPGKRN
Ga0306926_1084754213300031954SoilAAIDHYRLALSASASLPEAKAAAEHGLAQPFVPPAHPQNDPGKRN
Ga0307479_1025891133300031962Hardwood Forest SoilDREAAMDHYRAAATAGSGLPEAKAAAELGLQKPYEPTRRSQ
Ga0311301_1041292513300032160Peatlands SoilDVQEDREAALGHYRAALTAGATVPEAKAAAERGIQQPYEPPNHQPKEP
Ga0307471_10049018813300032180Hardwood Forest SoilAALDHYRAAANAGSALPEAKAAAELGLQQPYEPARRPQ
Ga0307472_10007705913300032205Hardwood Forest SoilDLQENRPVAIDHYRAALNAGASLPEAKAAAERGLQQPYEPRSHPE
Ga0306920_10145251723300032261SoilREAAMDQYRAALSTGGTLPEVKSAAERGLQQPYEPPTSPQPQE
Ga0335082_1146161313300032782SoilLDHYRAALTAASTLPEAKAAAEKGIQQPYEPPRHPQQ
Ga0335080_1239515923300032828SoilDLQNNRELALSHYRTALSAGGALPGVKAAAERGLQQPYEPPSHSNQ
Ga0335076_1104749823300032955SoilHYRAALNLGAEVPEVKAAAERGLQTPYEPPSHPQQN
Ga0335077_1053657213300033158SoilDRAAAIDHYRLALSASASLPEAKAAAEHGLAQPFEIPTHPQNDPGKRN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.