| Basic Information | |
|---|---|
| Family ID | F083201 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VPLDKSEGAVKDKDILGSAEAPLVLPERLRTKALEISR |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.81 % |
| % of genes near scaffold ends (potentially truncated) | 94.69 % |
| % of genes from short scaffolds (< 2000 bps) | 79.65 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.920 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.620 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.204 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.637 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 62.83 |
| PF01797 | Y1_Tnp | 3.54 |
| PF07238 | PilZ | 1.77 |
| PF13431 | TPR_17 | 1.77 |
| PF13193 | AMP-binding_C | 0.88 |
| PF12710 | HAD | 0.88 |
| PF01548 | DEDD_Tnp_IS110 | 0.88 |
| PF13447 | Multi-haem_cyto | 0.88 |
| PF02687 | FtsX | 0.88 |
| PF02574 | S-methyl_trans | 0.88 |
| PF14329 | DUF4386 | 0.88 |
| PF12681 | Glyoxalase_2 | 0.88 |
| PF01066 | CDP-OH_P_transf | 0.88 |
| PF01381 | HTH_3 | 0.88 |
| PF01695 | IstB_IS21 | 0.88 |
| PF06500 | FrsA-like | 0.88 |
| PF07136 | DUF1385 | 0.88 |
| PF04072 | LCM | 0.88 |
| PF02954 | HTH_8 | 0.88 |
| PF13288 | DXPR_C | 0.88 |
| PF11154 | DUF2934 | 0.88 |
| PF05768 | Glrx-like | 0.88 |
| PF05977 | MFS_3 | 0.88 |
| PF07228 | SpoIIE | 0.88 |
| PF13519 | VWA_2 | 0.88 |
| PF04255 | DUF433 | 0.88 |
| PF01790 | LGT | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 63.72 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 3.54 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.88 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.88 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.88 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.88 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.88 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.88 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.88 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG3872 | Uncharacterized conserved protein YqhQ, DUF1385 family | Function unknown [S] | 0.88 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.92 % |
| Unclassified | root | N/A | 7.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10131217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300001137|JGI12637J13337_1009175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300001154|JGI12636J13339_1025731 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300001174|JGI12679J13547_1013612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 523 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100344701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1371 | Open in IMG/M |
| 3300003351|JGI26346J50198_1009673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 927 | Open in IMG/M |
| 3300003352|JGI26345J50200_1008261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1030 | Open in IMG/M |
| 3300003370|JGI26337J50220_1002666 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300003372|JGI26336J50218_1002595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1090 | Open in IMG/M |
| 3300004082|Ga0062384_100200286 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300005177|Ga0066690_10408057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 922 | Open in IMG/M |
| 3300005536|Ga0070697_100078813 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300005538|Ga0070731_10684527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300006172|Ga0075018_10148141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
| 3300006794|Ga0066658_10192721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
| 3300006794|Ga0066658_10875327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300007258|Ga0099793_10563598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300009012|Ga0066710_100884970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1373 | Open in IMG/M |
| 3300009088|Ga0099830_11068756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300009089|Ga0099828_10064256 | Not Available | 3088 | Open in IMG/M |
| 3300009090|Ga0099827_11506500 | Not Available | 586 | Open in IMG/M |
| 3300009143|Ga0099792_10593744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300009618|Ga0116127_1072591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300009632|Ga0116102_1046945 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300009700|Ga0116217_10191895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300009760|Ga0116131_1018365 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300009764|Ga0116134_1047954 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300010046|Ga0126384_11947431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300010343|Ga0074044_10180889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1404 | Open in IMG/M |
| 3300010379|Ga0136449_102770733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300010379|Ga0136449_103050602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300012096|Ga0137389_10301508 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300012189|Ga0137388_11279579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300014155|Ga0181524_10216569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 924 | Open in IMG/M |
| 3300014167|Ga0181528_10058930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2119 | Open in IMG/M |
| 3300014489|Ga0182018_10142333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
| 3300014491|Ga0182014_10137423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1400 | Open in IMG/M |
| 3300014495|Ga0182015_10189179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1381 | Open in IMG/M |
| 3300014498|Ga0182019_10942027 | Not Available | 624 | Open in IMG/M |
| 3300014501|Ga0182024_10005837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 27335 | Open in IMG/M |
| 3300014501|Ga0182024_10607960 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300018004|Ga0187865_1000769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 42060 | Open in IMG/M |
| 3300018004|Ga0187865_1003201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13914 | Open in IMG/M |
| 3300018015|Ga0187866_1249479 | Not Available | 637 | Open in IMG/M |
| 3300018022|Ga0187864_10011974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5741 | Open in IMG/M |
| 3300018057|Ga0187858_10376324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 886 | Open in IMG/M |
| 3300018062|Ga0187784_10169897 | Not Available | 1781 | Open in IMG/M |
| 3300018064|Ga0187773_10086526 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300021088|Ga0210404_10604378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300021405|Ga0210387_10692669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 903 | Open in IMG/M |
| 3300021407|Ga0210383_10900532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300022525|Ga0242656_1055240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300023090|Ga0224558_1011070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5441 | Open in IMG/M |
| 3300023090|Ga0224558_1134026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300023101|Ga0224557_1003364 | All Organisms → cellular organisms → Bacteria | 12525 | Open in IMG/M |
| 3300023259|Ga0224551_1000037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13542 | Open in IMG/M |
| 3300024295|Ga0224556_1057748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 954 | Open in IMG/M |
| 3300025446|Ga0208038_1058904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300025457|Ga0208850_1013031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1553 | Open in IMG/M |
| 3300025498|Ga0208819_1027270 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300025500|Ga0208686_1026726 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300025929|Ga0207664_10275442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1475 | Open in IMG/M |
| 3300026335|Ga0209804_1085762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1468 | Open in IMG/M |
| 3300026354|Ga0257180_1004035 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300026358|Ga0257166_1006267 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300026371|Ga0257179_1003312 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300026480|Ga0257177_1005337 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300026482|Ga0257172_1013057 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300026498|Ga0257156_1015620 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300026499|Ga0257181_1004740 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300026502|Ga0255350_1094709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300026507|Ga0257165_1007860 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300027629|Ga0209422_1031403 | Not Available | 1305 | Open in IMG/M |
| 3300027681|Ga0208991_1194292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300027745|Ga0209908_10041544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 983 | Open in IMG/M |
| 3300027767|Ga0209655_10009561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3288 | Open in IMG/M |
| 3300027768|Ga0209772_10146176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300027812|Ga0209656_10360227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300027829|Ga0209773_10042847 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300027846|Ga0209180_10073760 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300027862|Ga0209701_10167243 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300027869|Ga0209579_10117969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1410 | Open in IMG/M |
| 3300028779|Ga0302266_10019025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3648 | Open in IMG/M |
| 3300028783|Ga0302279_10032029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3544 | Open in IMG/M |
| 3300028783|Ga0302279_10032704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3490 | Open in IMG/M |
| 3300028792|Ga0307504_10016827 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300028813|Ga0302157_10355266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300028854|Ga0302268_1002002 | All Organisms → cellular organisms → Bacteria | 9990 | Open in IMG/M |
| 3300029908|Ga0311341_10697274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300029911|Ga0311361_10451054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
| 3300029953|Ga0311343_10276759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1650 | Open in IMG/M |
| 3300029994|Ga0302283_1046050 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300031236|Ga0302324_102455662 | Not Available | 638 | Open in IMG/M |
| 3300031524|Ga0302320_10029207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10556 | Open in IMG/M |
| 3300031524|Ga0302320_10778731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300031708|Ga0310686_104277495 | All Organisms → cellular organisms → Bacteria | 4909 | Open in IMG/M |
| 3300031754|Ga0307475_10173832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1717 | Open in IMG/M |
| 3300032160|Ga0311301_10664954 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300032770|Ga0335085_10439693 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300032828|Ga0335080_10624216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300032828|Ga0335080_10643499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1110 | Open in IMG/M |
| 3300032828|Ga0335080_11210089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 759 | Open in IMG/M |
| 3300032898|Ga0335072_10242404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2082 | Open in IMG/M |
| 3300032954|Ga0335083_10275954 | Not Available | 1489 | Open in IMG/M |
| 3300032955|Ga0335076_10841068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300033402|Ga0326728_10310443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300033402|Ga0326728_10501873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 985 | Open in IMG/M |
| 3300033405|Ga0326727_10001989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 72386 | Open in IMG/M |
| 3300033405|Ga0326727_10349659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
| 3300033405|Ga0326727_10487589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
| 3300033433|Ga0326726_10100006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2594 | Open in IMG/M |
| 3300033828|Ga0334850_017015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1361 | Open in IMG/M |
| 3300034199|Ga0370514_021320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1573 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.62% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 8.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.19% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 6.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.31% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 5.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.54% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.77% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.89% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.89% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028854 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101312172 | 3300000567 | Peatlands Soil | VALDKSEGSVKGKNILGSAEAPLASPERLRTKPLEISR* |
| JGI12637J13337_10091752 | 3300001137 | Forest Soil | KKKPWEPLDKSEVPVKSVVVLGGAQAPPVLPERLRTKTLEISR* |
| JGI12636J13339_10257312 | 3300001154 | Forest Soil | PTQRVPLDKSEVPVKSVVVLGGAQAPPVLPERLRTKTLEISR* |
| JGI12679J13547_10136122 | 3300001174 | Forest Soil | LISLVAPTQRVPLDKSEVPVKSVVVLGGAQAPPVLPERLRTKTLEISR* |
| JGIcombinedJ26739_1003447014 | 3300002245 | Forest Soil | PLDKSEGVVKDKDILGGARAPPGLPERLRTKTLEISR* |
| JGI26346J50198_10096731 | 3300003351 | Bog Forest Soil | IRNPRVPLDKSEGSVKGIVVLGGAPAPPALPERLRTKTLEISR* |
| JGI26345J50200_10082612 | 3300003352 | Bog Forest Soil | GPRLXVPLDKSEGGVKDKSILTVFLAPLFCQRDLRTKTLEISR* |
| JGI26337J50220_10026662 | 3300003370 | Bog Forest Soil | MRVPLDKSEGGVKDKSILTVFLAPLFCQRDLRTKTLEISR* |
| JGI26336J50218_10025951 | 3300003372 | Bog Forest Soil | RFGCRVPLDKSEGGVKDKNILSVFLAPLVLPERLRTKTLEISR* |
| Ga0062384_1002002861 | 3300004082 | Bog Forest Soil | GVRLDKSEGAVKDKDILGSDEHRLLCQRRLRTKALGISR* |
| Ga0066690_104080571 | 3300005177 | Soil | RVALDKSEGSVKDKNLLCSAGAPRWSPEGLRTKTLEISR* |
| Ga0070697_1000788134 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VEITRVPLDKSEGSVKGIVILGGASAPLALPERLRTKTLEISR |
| Ga0070731_106845272 | 3300005538 | Surface Soil | DKSEGGVKDKDILCSAVAPLFSPEGLRTKTLEISR* |
| Ga0075018_101481411 | 3300006172 | Watersheds | LALDKNEGAVKGKLLPPVFSAPLCSPERLRTKTLEISR* |
| Ga0066658_101927212 | 3300006794 | Soil | SRRVALDKSEGFVKRIVIRCSAMSTATLPERLRTKTLEISP* |
| Ga0066658_108753272 | 3300006794 | Soil | SRRVALDKSEGFVKRIVIRCSAMSTATLPERLRTKTLEISR* |
| Ga0099793_105635982 | 3300007258 | Vadose Zone Soil | VPLDKSEGAVKDKDILGSAEAPLVLPERLRTKALEISR* |
| Ga0066710_1008849702 | 3300009012 | Grasslands Soil | RVALDKSEVSVKGIVLLSGASAPLALPERLRTKTLEISR |
| Ga0099830_110687562 | 3300009088 | Vadose Zone Soil | KSEGAVKDKNILGSAVAPLALPERLRTKALEISR* |
| Ga0099828_100642562 | 3300009089 | Vadose Zone Soil | VGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEIS |
| Ga0099827_115065002 | 3300009090 | Vadose Zone Soil | MGVALDKSEGSVKDKNLLCSAGAPRCLPERLRTKTLEISR |
| Ga0099792_105937441 | 3300009143 | Vadose Zone Soil | RRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR* |
| Ga0116127_10725913 | 3300009618 | Peatland | LQRWAEDKTGVPLDKREGSVKGKLLLGGVFAPLVSPERLRTKALEISRGI |
| Ga0116102_10469452 | 3300009632 | Peatland | VALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR* |
| Ga0116217_101918951 | 3300009700 | Peatlands Soil | RRLVPLDKSEGSVKGIVVLGGAAAPLGLPERLRTKALEISR* |
| Ga0116131_10183651 | 3300009760 | Peatland | MSGPVPLDKSAGSVKGIVLLGGASAPLGLPERLRTKTL |
| Ga0116134_10479542 | 3300009764 | Peatland | RLDKSEGAVKDKNILGSAEAPLALPERLRTKTLEISR* |
| Ga0126384_119474311 | 3300010046 | Tropical Forest Soil | LDKSEGSVKDIVVLCRAEAPLALPERLRTKTLEISR* |
| Ga0074044_101808891 | 3300010343 | Bog Forest Soil | RVPLDKSEGGVKDKSILTVFLAPLFCQRDLRTKTLEISR* |
| Ga0136449_1027707331 | 3300010379 | Peatlands Soil | LDKSEGSVKGKNIRCRAEAPLVLPERLRTKALEISR* |
| Ga0136449_1030506022 | 3300010379 | Peatlands Soil | LVPLDKSEGSVKGIVVLGGAAAPLGLPERLRTKALEISR* |
| Ga0137389_103015082 | 3300012096 | Vadose Zone Soil | RVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR* |
| Ga0137388_112795792 | 3300012189 | Vadose Zone Soil | DKSEGAVKDKNILGSAVAPLALPERLRTKALEISR* |
| Ga0181524_102165691 | 3300014155 | Bog | YVRRVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR* |
| Ga0181528_100589301 | 3300014167 | Bog | RVPLDKREGSVKGKLVLGDAEAPLFSPERLRTKTLEISR* |
| Ga0182018_101423331 | 3300014489 | Palsa | LDKSEGGVKDKSILSVFGTAFLPERLRTKTLEISR* |
| Ga0182014_101374231 | 3300014491 | Bog | LDKREGSVKDKDILGSAEAPLALPERLRTKALEISR* |
| Ga0182015_101891792 | 3300014495 | Palsa | VALDKSEGGVKDKSILSVFGTAFLPERLRTKTLEISR* |
| Ga0182019_109420271 | 3300014498 | Fen | MPLDKREGSVKGKNILGSAEAPLALPERLRTKALEISR* |
| Ga0182024_1000583727 | 3300014501 | Permafrost | MLTEKKPGVPLDKSEGAVKDKNILGSAGAPLRLPERLRTKTLEISP* |
| Ga0182024_106079601 | 3300014501 | Permafrost | PLDKSEGAVKDKNILGSAGAPLRLPERLRTKTLEISP* |
| Ga0187865_100076936 | 3300018004 | Peatland | MQWVPLDKSEGSVKDKLILCSAEAPFFSPERLRTKALEISRG |
| Ga0187865_100320114 | 3300018004 | Peatland | VPLDKSEGSVKDKLILCSAEAPFFSPERLRTKALEISRGI |
| Ga0187866_12494791 | 3300018015 | Peatland | VALDKREGSVKGKNILGSAEAPLALPERLRTKALEI |
| Ga0187864_100119741 | 3300018022 | Peatland | VALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR |
| Ga0187858_103763242 | 3300018057 | Peatland | RVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR |
| Ga0187784_101698972 | 3300018062 | Tropical Peatland | VPLDKNEGSVKGIVVLGGARAPLVLPERLRTKALEIS |
| Ga0187773_100865261 | 3300018064 | Tropical Peatland | KELRVRLDKSEGSVKDKDILSGAEHRLVSPEGLRTKTLEISR |
| Ga0210404_106043781 | 3300021088 | Soil | DKSEGGVKDKNIVAGVFGTAFLPERLRTKTLEISR |
| Ga0210387_106926692 | 3300021405 | Soil | VALTQNWVALDKNEDAVKDKGILCSAEAPFCSPERLRTKTLEISR |
| Ga0210383_109005322 | 3300021407 | Soil | PLDKSEGAVKDKDILGSAEAPLLLPERLRTKALEISR |
| Ga0242656_10552401 | 3300022525 | Soil | CRVPLDKSEGGVKDKSILSVFLAPLFSQRGLRTKTLEISR |
| Ga0224558_10110704 | 3300023090 | Soil | VALDKSEGSVKSKVILCSAEAPLLSPERLRTKTLEISR |
| Ga0224558_11340261 | 3300023090 | Soil | VALDKREGSVKGKNILGSAEAPLALPERLRTKALEIS |
| Ga0224557_10033641 | 3300023101 | Soil | LDKREGSVKDKDILGSAEAPLALPERLRTKALEISR |
| Ga0224551_100003712 | 3300023259 | Soil | MLTEKKPGVPLDKSEGAVKDKNILGSAGAPLRLPERLRTKTLEISP |
| Ga0224556_10577481 | 3300024295 | Soil | IKQRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR |
| Ga0208038_10589043 | 3300025446 | Peatland | VPLDKREGSVKGKLLLGGVFAPLVSPERLRTKALEISRGII |
| Ga0208850_10130311 | 3300025457 | Arctic Peat Soil | NLGVPLDKSEGSVKGKDLLSSVGAPLALPERLRTKALEISR |
| Ga0208819_10272701 | 3300025498 | Peatland | QLRRVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR |
| Ga0208686_10267262 | 3300025500 | Peatland | CTRVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR |
| Ga0207664_102754421 | 3300025929 | Agricultural Soil | ALDKNEGGVKGMVVLGSAAAPLFSPERLRTKTLEISR |
| Ga0209804_10857623 | 3300026335 | Soil | YAMAQDGRVALDKSEGSVKGIVIRGSAMSTATLPERLRTKTLEISR |
| Ga0257180_10040351 | 3300026354 | Soil | IVGRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0257166_10062672 | 3300026358 | Soil | VGRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0257179_10033121 | 3300026371 | Soil | PLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0257177_10053372 | 3300026480 | Soil | ILIDWRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0257172_10130571 | 3300026482 | Soil | LRIGRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0257156_10156201 | 3300026498 | Soil | GGWAIDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0257181_10047402 | 3300026499 | Soil | RTEGLSIGDKSRFQWRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0255350_10947092 | 3300026502 | Soil | APWRVALDKREGSVKDKDILGSAEAPLALPERLRTKALEISR |
| Ga0257165_10078601 | 3300026507 | Soil | MVGRVVLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0209422_10314031 | 3300027629 | Forest Soil | LISLVAPTQRVPLDKSEVPVKSVVVLGGAQAPPVLPERLRTKT |
| Ga0208991_11942922 | 3300027681 | Forest Soil | PLDKSEGGVKDKSILSVFLAPLFLPERLRTKALEILR |
| Ga0209908_100415441 | 3300027745 | Thawing Permafrost | ARIRGVALDKSEGGVKDKSILSVFGTAFLPERLRTKTLEISR |
| Ga0209655_100095613 | 3300027767 | Bog Forest Soil | RVPLDKSEGGVKDKSILTVFLAPLFCQRDLRTKTLEISR |
| Ga0209772_101461762 | 3300027768 | Bog Forest Soil | CRVALDKREGSVKDKDILGSAEAQLALPERLRTKTLEISR |
| Ga0209656_103602272 | 3300027812 | Bog Forest Soil | KNGRVPLDKSEGAVKDKDILGSAGAPLRLPERLRTQTLEISP |
| Ga0209773_100428473 | 3300027829 | Bog Forest Soil | VPLDKSEGGVKDKNILSVFLAPLVLPERLRTKTLEISR |
| Ga0209180_100737601 | 3300027846 | Vadose Zone Soil | DKGRKKWRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0209701_101672432 | 3300027862 | Vadose Zone Soil | RVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR |
| Ga0209579_101179692 | 3300027869 | Surface Soil | PLDKSEGGVKDKDILCSAVAPLFSPEGLRTKTLEISR |
| Ga0302266_100190251 | 3300028779 | Bog | VALDKREGSVKDKDILGSAEAPLALPERLRTKALE |
| Ga0302279_100320296 | 3300028783 | Bog | ADAPWRVALDKREGSVKDKDILGSAEAPLALPERLRTKALEISR |
| Ga0302279_100327041 | 3300028783 | Bog | VALDKREGSVKDKDILGSAEAPLALPERLRTKALEISR |
| Ga0307504_100168271 | 3300028792 | Soil | SGVPLDKSEGGVKDKSILPVFWAPLFCQRGLRTKTLEISR |
| Ga0302157_103552662 | 3300028813 | Bog | AIKQRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR |
| Ga0302268_10020021 | 3300028854 | Bog | CSTAIADAPWRVALDKREGSVKDKDILGSAEAPLALPERLRTKALEISR |
| Ga0311341_106972742 | 3300029908 | Bog | RRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR |
| Ga0311361_104510542 | 3300029911 | Bog | RVPKTMRVPLDKREGSVKGKLVLGDAEAPLFSPERLRTKTLEISR |
| Ga0311343_102767592 | 3300029953 | Bog | PFPQRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR |
| Ga0302283_10460505 | 3300029994 | Fen | PLDKREGSVKDKDILGSAEAPLALPERLRTKALEISR |
| Ga0302324_1024556621 | 3300031236 | Palsa | SLHMAGCRVRLDKTEGAVKDKDILGSAEASLALPERLRTKALEIPR |
| Ga0302320_100292071 | 3300031524 | Bog | MPLDKNEGAVKDKDILSSAGHRFFSPEGLRTKTLEMKISRSS |
| Ga0302320_107787312 | 3300031524 | Bog | VPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR |
| Ga0310686_1042774957 | 3300031708 | Soil | RVALDKSEGAVKDKLSLSVFFPPLVSPERLRTKTLEISR |
| Ga0307475_101738321 | 3300031754 | Hardwood Forest Soil | VSLDKSEAGVKDKNMLAGVFGTAFLPERLRTKTLEISR |
| Ga0311301_106649541 | 3300032160 | Peatlands Soil | MRVALDKSEGSVKGKNIRCRAEAPLVLPERLRTKALE |
| Ga0335085_104396931 | 3300032770 | Soil | WGVPLDKSEGSVKDKDILGSAKHRFCSPERLRTKTLEISR |
| Ga0335080_106242162 | 3300032828 | Soil | DKSEGFVKGIVVLGGAQAPPVLPERLRTKTLEISR |
| Ga0335080_106434991 | 3300032828 | Soil | LVADWRVALDKSEGSVKDKDILGGALAPLSSPQRLRTKTLEISR |
| Ga0335080_112100891 | 3300032828 | Soil | VALDKSEGSVKDKDILGGALAPLSSPQRLRTKTLE |
| Ga0335072_102424043 | 3300032898 | Soil | TAIGQVALDKSEVSVKGTDILGGAQAPPAFSDQRRLRTKTLEISR |
| Ga0335083_102759541 | 3300032954 | Soil | MIQLHRRVKCRVPLDKREGAVKDKDILGSVEAPLALPERLRTKTLEI |
| Ga0335076_108410682 | 3300032955 | Soil | RSRVALDKSEGFVKGIVVLGGAQAPPVLPERLRTKTLEISR |
| Ga0326728_103104431 | 3300033402 | Peat Soil | MAAASLRVPLDKSEGGVKDKVILCHAEAPLAVPERLRTKTLEISRES |
| Ga0326728_105018731 | 3300033402 | Peat Soil | VALDKSEGGVKDKVILCHAEAPLAVPERLRTKTLEIS |
| Ga0326727_100019891 | 3300033405 | Peat Soil | VPLDKSEGSVKGKNILGSAEAPLALPERLRTKALEISRGIT |
| Ga0326727_103496591 | 3300033405 | Peat Soil | MAAASLRVPLDKSEGGVKDKVILCHAEAPLAVPERLRTK |
| Ga0326727_104875891 | 3300033405 | Peat Soil | LRLSIDKSEGSVKGKNILGSAEAPLALPERLRTKALEISRGITYRW |
| Ga0326726_101000061 | 3300033433 | Peat Soil | LSLDLRQLGVRLDKSEGAVKGKDVLGSAEAPLVSPERLRTKTLEISR |
| Ga0334850_017015_1243_1359 | 3300033828 | Soil | VPLDKSEGGVKDKNILSVFSAPLFCQRGLRTKTLEISR |
| Ga0370514_021320_1447_1572 | 3300034199 | Untreated Peat Soil | SSRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR |
| ⦗Top⦘ |