NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083201

Metagenome / Metatranscriptome Family F083201

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083201
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 40 residues
Representative Sequence VPLDKSEGAVKDKDILGSAEAPLVLPERLRTKALEISR
Number of Associated Samples 101
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.81 %
% of genes near scaffold ends (potentially truncated) 94.69 %
% of genes from short scaffolds (< 2000 bps) 79.65 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.920 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.620 % of family members)
Environment Ontology (ENVO) Unclassified
(29.204 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.637 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF02371Transposase_20 62.83
PF01797Y1_Tnp 3.54
PF07238PilZ 1.77
PF13431TPR_17 1.77
PF13193AMP-binding_C 0.88
PF12710HAD 0.88
PF01548DEDD_Tnp_IS110 0.88
PF13447Multi-haem_cyto 0.88
PF02687FtsX 0.88
PF02574S-methyl_trans 0.88
PF14329DUF4386 0.88
PF12681Glyoxalase_2 0.88
PF01066CDP-OH_P_transf 0.88
PF01381HTH_3 0.88
PF01695IstB_IS21 0.88
PF06500FrsA-like 0.88
PF07136DUF1385 0.88
PF04072LCM 0.88
PF02954HTH_8 0.88
PF13288DXPR_C 0.88
PF11154DUF2934 0.88
PF05768Glrx-like 0.88
PF05977MFS_3 0.88
PF07228SpoIIE 0.88
PF13519VWA_2 0.88
PF04255DUF433 0.88
PF01790LGT 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 63.72
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 3.54
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.88
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.88
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.88
COG0695GlutaredoxinPosttranslational modification, protein turnover, chaperones [O] 0.88
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.88
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.88
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.88
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.88
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.88
COG3118Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC familyPosttranslational modification, protein turnover, chaperones [O] 0.88
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.88
COG3872Uncharacterized conserved protein YqhQ, DUF1385 familyFunction unknown [S] 0.88
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.92 %
UnclassifiedrootN/A7.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10131217All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300001137|JGI12637J13337_1009175All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300001154|JGI12636J13339_1025731All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300001174|JGI12679J13547_1013612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3523Open in IMG/M
3300002245|JGIcombinedJ26739_100344701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1371Open in IMG/M
3300003351|JGI26346J50198_1009673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter927Open in IMG/M
3300003352|JGI26345J50200_1008261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans1030Open in IMG/M
3300003370|JGI26337J50220_1002666All Organisms → cellular organisms → Bacteria2058Open in IMG/M
3300003372|JGI26336J50218_1002595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans1090Open in IMG/M
3300004082|Ga0062384_100200286All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300005177|Ga0066690_10408057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter922Open in IMG/M
3300005536|Ga0070697_100078813All Organisms → cellular organisms → Bacteria2711Open in IMG/M
3300005538|Ga0070731_10684527All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300006172|Ga0075018_10148141All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1080Open in IMG/M
3300006794|Ga0066658_10192721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1073Open in IMG/M
3300006794|Ga0066658_10875327All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300007258|Ga0099793_10563598All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300009012|Ga0066710_100884970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1373Open in IMG/M
3300009088|Ga0099830_11068756All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300009089|Ga0099828_10064256Not Available3088Open in IMG/M
3300009090|Ga0099827_11506500Not Available586Open in IMG/M
3300009143|Ga0099792_10593744All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300009618|Ga0116127_1072591All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium942Open in IMG/M
3300009632|Ga0116102_1046945All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300009700|Ga0116217_10191895All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1346Open in IMG/M
3300009760|Ga0116131_1018365All Organisms → cellular organisms → Bacteria2586Open in IMG/M
3300009764|Ga0116134_1047954All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300010046|Ga0126384_11947431All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300010343|Ga0074044_10180889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1404Open in IMG/M
3300010379|Ga0136449_102770733All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300010379|Ga0136449_103050602All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300012096|Ga0137389_10301508All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300012189|Ga0137388_11279579All Organisms → cellular organisms → Bacteria → Acidobacteria672Open in IMG/M
3300014155|Ga0181524_10216569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter924Open in IMG/M
3300014167|Ga0181528_10058930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium2119Open in IMG/M
3300014489|Ga0182018_10142333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1375Open in IMG/M
3300014491|Ga0182014_10137423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1400Open in IMG/M
3300014495|Ga0182015_10189179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1381Open in IMG/M
3300014498|Ga0182019_10942027Not Available624Open in IMG/M
3300014501|Ga0182024_10005837All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae27335Open in IMG/M
3300014501|Ga0182024_10607960All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300018004|Ga0187865_1000769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae42060Open in IMG/M
3300018004|Ga0187865_1003201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13914Open in IMG/M
3300018015|Ga0187866_1249479Not Available637Open in IMG/M
3300018022|Ga0187864_10011974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5741Open in IMG/M
3300018057|Ga0187858_10376324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter886Open in IMG/M
3300018062|Ga0187784_10169897Not Available1781Open in IMG/M
3300018064|Ga0187773_10086526All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300021088|Ga0210404_10604378All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300021405|Ga0210387_10692669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter903Open in IMG/M
3300021407|Ga0210383_10900532All Organisms → cellular organisms → Bacteria → Acidobacteria754Open in IMG/M
3300022525|Ga0242656_1055240All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300023090|Ga0224558_1011070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5441Open in IMG/M
3300023090|Ga0224558_1134026All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300023101|Ga0224557_1003364All Organisms → cellular organisms → Bacteria12525Open in IMG/M
3300023259|Ga0224551_1000037All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13542Open in IMG/M
3300024295|Ga0224556_1057748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans954Open in IMG/M
3300025446|Ga0208038_1058904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300025457|Ga0208850_1013031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1553Open in IMG/M
3300025498|Ga0208819_1027270All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300025500|Ga0208686_1026726All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300025929|Ga0207664_10275442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1475Open in IMG/M
3300026335|Ga0209804_1085762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1468Open in IMG/M
3300026354|Ga0257180_1004035All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300026358|Ga0257166_1006267All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300026371|Ga0257179_1003312All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300026480|Ga0257177_1005337All Organisms → cellular organisms → Bacteria1556Open in IMG/M
3300026482|Ga0257172_1013057All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300026498|Ga0257156_1015620All Organisms → cellular organisms → Bacteria1481Open in IMG/M
3300026499|Ga0257181_1004740All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300026502|Ga0255350_1094709All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300026507|Ga0257165_1007860All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300027629|Ga0209422_1031403Not Available1305Open in IMG/M
3300027681|Ga0208991_1194292All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300027745|Ga0209908_10041544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter983Open in IMG/M
3300027767|Ga0209655_10009561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3288Open in IMG/M
3300027768|Ga0209772_10146176All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300027812|Ga0209656_10360227All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300027829|Ga0209773_10042847All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300027846|Ga0209180_10073760All Organisms → cellular organisms → Bacteria1918Open in IMG/M
3300027862|Ga0209701_10167243All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300027869|Ga0209579_10117969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1410Open in IMG/M
3300028779|Ga0302266_10019025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3648Open in IMG/M
3300028783|Ga0302279_10032029All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3544Open in IMG/M
3300028783|Ga0302279_10032704All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3490Open in IMG/M
3300028792|Ga0307504_10016827All Organisms → cellular organisms → Bacteria1756Open in IMG/M
3300028813|Ga0302157_10355266All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300028854|Ga0302268_1002002All Organisms → cellular organisms → Bacteria9990Open in IMG/M
3300029908|Ga0311341_10697274All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300029911|Ga0311361_10451054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1314Open in IMG/M
3300029953|Ga0311343_10276759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1650Open in IMG/M
3300029994|Ga0302283_1046050All Organisms → cellular organisms → Bacteria2048Open in IMG/M
3300031236|Ga0302324_102455662Not Available638Open in IMG/M
3300031524|Ga0302320_10029207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10556Open in IMG/M
3300031524|Ga0302320_10778731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1064Open in IMG/M
3300031708|Ga0310686_104277495All Organisms → cellular organisms → Bacteria4909Open in IMG/M
3300031754|Ga0307475_10173832All Organisms → cellular organisms → Bacteria → Acidobacteria1717Open in IMG/M
3300032160|Ga0311301_10664954All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300032770|Ga0335085_10439693All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300032828|Ga0335080_10624216All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1131Open in IMG/M
3300032828|Ga0335080_10643499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1110Open in IMG/M
3300032828|Ga0335080_11210089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3759Open in IMG/M
3300032898|Ga0335072_10242404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2082Open in IMG/M
3300032954|Ga0335083_10275954Not Available1489Open in IMG/M
3300032955|Ga0335076_10841068All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300033402|Ga0326728_10310443All Organisms → cellular organisms → Bacteria → Acidobacteria1428Open in IMG/M
3300033402|Ga0326728_10501873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter985Open in IMG/M
3300033405|Ga0326727_10001989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae72386Open in IMG/M
3300033405|Ga0326727_10349659All Organisms → cellular organisms → Bacteria → Acidobacteria1402Open in IMG/M
3300033405|Ga0326727_10487589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300033433|Ga0326726_10100006All Organisms → cellular organisms → Bacteria → Acidobacteria2594Open in IMG/M
3300033828|Ga0334850_017015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1361Open in IMG/M
3300034199|Ga0370514_021320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1573Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.62%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog8.85%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil7.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.19%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.19%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil6.19%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.31%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil5.31%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.42%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.54%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.77%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.77%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.89%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.89%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.89%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001137Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3EnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001174Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003351Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2EnvironmentalOpen in IMG/M
3300003352Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1EnvironmentalOpen in IMG/M
3300003370Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2EnvironmentalOpen in IMG/M
3300003372Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300026371Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026502Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1EnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028854Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033828Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1013121723300000567Peatlands SoilVALDKSEGSVKGKNILGSAEAPLASPERLRTKPLEISR*
JGI12637J13337_100917523300001137Forest SoilKKKPWEPLDKSEVPVKSVVVLGGAQAPPVLPERLRTKTLEISR*
JGI12636J13339_102573123300001154Forest SoilPTQRVPLDKSEVPVKSVVVLGGAQAPPVLPERLRTKTLEISR*
JGI12679J13547_101361223300001174Forest SoilLISLVAPTQRVPLDKSEVPVKSVVVLGGAQAPPVLPERLRTKTLEISR*
JGIcombinedJ26739_10034470143300002245Forest SoilPLDKSEGVVKDKDILGGARAPPGLPERLRTKTLEISR*
JGI26346J50198_100967313300003351Bog Forest SoilIRNPRVPLDKSEGSVKGIVVLGGAPAPPALPERLRTKTLEISR*
JGI26345J50200_100826123300003352Bog Forest SoilGPRLXVPLDKSEGGVKDKSILTVFLAPLFCQRDLRTKTLEISR*
JGI26337J50220_100266623300003370Bog Forest SoilMRVPLDKSEGGVKDKSILTVFLAPLFCQRDLRTKTLEISR*
JGI26336J50218_100259513300003372Bog Forest SoilRFGCRVPLDKSEGGVKDKNILSVFLAPLVLPERLRTKTLEISR*
Ga0062384_10020028613300004082Bog Forest SoilGVRLDKSEGAVKDKDILGSDEHRLLCQRRLRTKALGISR*
Ga0066690_1040805713300005177SoilRVALDKSEGSVKDKNLLCSAGAPRWSPEGLRTKTLEISR*
Ga0070697_10007881343300005536Corn, Switchgrass And Miscanthus RhizosphereVEITRVPLDKSEGSVKGIVILGGASAPLALPERLRTKTLEISR
Ga0070731_1068452723300005538Surface SoilDKSEGGVKDKDILCSAVAPLFSPEGLRTKTLEISR*
Ga0075018_1014814113300006172WatershedsLALDKNEGAVKGKLLPPVFSAPLCSPERLRTKTLEISR*
Ga0066658_1019272123300006794SoilSRRVALDKSEGFVKRIVIRCSAMSTATLPERLRTKTLEISP*
Ga0066658_1087532723300006794SoilSRRVALDKSEGFVKRIVIRCSAMSTATLPERLRTKTLEISR*
Ga0099793_1056359823300007258Vadose Zone SoilVPLDKSEGAVKDKDILGSAEAPLVLPERLRTKALEISR*
Ga0066710_10088497023300009012Grasslands SoilRVALDKSEVSVKGIVLLSGASAPLALPERLRTKTLEISR
Ga0099830_1106875623300009088Vadose Zone SoilKSEGAVKDKNILGSAVAPLALPERLRTKALEISR*
Ga0099828_1006425623300009089Vadose Zone SoilVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEIS
Ga0099827_1150650023300009090Vadose Zone SoilMGVALDKSEGSVKDKNLLCSAGAPRCLPERLRTKTLEISR
Ga0099792_1059374413300009143Vadose Zone SoilRRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR*
Ga0116127_107259133300009618PeatlandLQRWAEDKTGVPLDKREGSVKGKLLLGGVFAPLVSPERLRTKALEISRGI
Ga0116102_104694523300009632PeatlandVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR*
Ga0116217_1019189513300009700Peatlands SoilRRLVPLDKSEGSVKGIVVLGGAAAPLGLPERLRTKALEISR*
Ga0116131_101836513300009760PeatlandMSGPVPLDKSAGSVKGIVLLGGASAPLGLPERLRTKTL
Ga0116134_104795423300009764PeatlandRLDKSEGAVKDKNILGSAEAPLALPERLRTKTLEISR*
Ga0126384_1194743113300010046Tropical Forest SoilLDKSEGSVKDIVVLCRAEAPLALPERLRTKTLEISR*
Ga0074044_1018088913300010343Bog Forest SoilRVPLDKSEGGVKDKSILTVFLAPLFCQRDLRTKTLEISR*
Ga0136449_10277073313300010379Peatlands SoilLDKSEGSVKGKNIRCRAEAPLVLPERLRTKALEISR*
Ga0136449_10305060223300010379Peatlands SoilLVPLDKSEGSVKGIVVLGGAAAPLGLPERLRTKALEISR*
Ga0137389_1030150823300012096Vadose Zone SoilRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR*
Ga0137388_1127957923300012189Vadose Zone SoilDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR*
Ga0181524_1021656913300014155BogYVRRVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR*
Ga0181528_1005893013300014167BogRVPLDKREGSVKGKLVLGDAEAPLFSPERLRTKTLEISR*
Ga0182018_1014233313300014489PalsaLDKSEGGVKDKSILSVFGTAFLPERLRTKTLEISR*
Ga0182014_1013742313300014491BogLDKREGSVKDKDILGSAEAPLALPERLRTKALEISR*
Ga0182015_1018917923300014495PalsaVALDKSEGGVKDKSILSVFGTAFLPERLRTKTLEISR*
Ga0182019_1094202713300014498FenMPLDKREGSVKGKNILGSAEAPLALPERLRTKALEISR*
Ga0182024_10005837273300014501PermafrostMLTEKKPGVPLDKSEGAVKDKNILGSAGAPLRLPERLRTKTLEISP*
Ga0182024_1060796013300014501PermafrostPLDKSEGAVKDKNILGSAGAPLRLPERLRTKTLEISP*
Ga0187865_1000769363300018004PeatlandMQWVPLDKSEGSVKDKLILCSAEAPFFSPERLRTKALEISRG
Ga0187865_1003201143300018004PeatlandVPLDKSEGSVKDKLILCSAEAPFFSPERLRTKALEISRGI
Ga0187866_124947913300018015PeatlandVALDKREGSVKGKNILGSAEAPLALPERLRTKALEI
Ga0187864_1001197413300018022PeatlandVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR
Ga0187858_1037632423300018057PeatlandRVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR
Ga0187784_1016989723300018062Tropical PeatlandVPLDKNEGSVKGIVVLGGARAPLVLPERLRTKALEIS
Ga0187773_1008652613300018064Tropical PeatlandKELRVRLDKSEGSVKDKDILSGAEHRLVSPEGLRTKTLEISR
Ga0210404_1060437813300021088SoilDKSEGGVKDKNIVAGVFGTAFLPERLRTKTLEISR
Ga0210387_1069266923300021405SoilVALTQNWVALDKNEDAVKDKGILCSAEAPFCSPERLRTKTLEISR
Ga0210383_1090053223300021407SoilPLDKSEGAVKDKDILGSAEAPLLLPERLRTKALEISR
Ga0242656_105524013300022525SoilCRVPLDKSEGGVKDKSILSVFLAPLFSQRGLRTKTLEISR
Ga0224558_101107043300023090SoilVALDKSEGSVKSKVILCSAEAPLLSPERLRTKTLEISR
Ga0224558_113402613300023090SoilVALDKREGSVKGKNILGSAEAPLALPERLRTKALEIS
Ga0224557_100336413300023101SoilLDKREGSVKDKDILGSAEAPLALPERLRTKALEISR
Ga0224551_1000037123300023259SoilMLTEKKPGVPLDKSEGAVKDKNILGSAGAPLRLPERLRTKTLEISP
Ga0224556_105774813300024295SoilIKQRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR
Ga0208038_105890433300025446PeatlandVPLDKREGSVKGKLLLGGVFAPLVSPERLRTKALEISRGII
Ga0208850_101303113300025457Arctic Peat SoilNLGVPLDKSEGSVKGKDLLSSVGAPLALPERLRTKALEISR
Ga0208819_102727013300025498PeatlandQLRRVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR
Ga0208686_102672623300025500PeatlandCTRVALDKREGSVKGKNILGSAEAPLALPERLRTKALEISR
Ga0207664_1027544213300025929Agricultural SoilALDKNEGGVKGMVVLGSAAAPLFSPERLRTKTLEISR
Ga0209804_108576233300026335SoilYAMAQDGRVALDKSEGSVKGIVIRGSAMSTATLPERLRTKTLEISR
Ga0257180_100403513300026354SoilIVGRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0257166_100626723300026358SoilVGRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0257179_100331213300026371SoilPLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0257177_100533723300026480SoilILIDWRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0257172_101305713300026482SoilLRIGRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0257156_101562013300026498SoilGGWAIDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0257181_100474023300026499SoilRTEGLSIGDKSRFQWRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0255350_109470923300026502SoilAPWRVALDKREGSVKDKDILGSAEAPLALPERLRTKALEISR
Ga0257165_100786013300026507SoilMVGRVVLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0209422_103140313300027629Forest SoilLISLVAPTQRVPLDKSEVPVKSVVVLGGAQAPPVLPERLRTKT
Ga0208991_119429223300027681Forest SoilPLDKSEGGVKDKSILSVFLAPLFLPERLRTKALEILR
Ga0209908_1004154413300027745Thawing PermafrostARIRGVALDKSEGGVKDKSILSVFGTAFLPERLRTKTLEISR
Ga0209655_1000956133300027767Bog Forest SoilRVPLDKSEGGVKDKSILTVFLAPLFCQRDLRTKTLEISR
Ga0209772_1014617623300027768Bog Forest SoilCRVALDKREGSVKDKDILGSAEAQLALPERLRTKTLEISR
Ga0209656_1036022723300027812Bog Forest SoilKNGRVPLDKSEGAVKDKDILGSAGAPLRLPERLRTQTLEISP
Ga0209773_1004284733300027829Bog Forest SoilVPLDKSEGGVKDKNILSVFLAPLVLPERLRTKTLEISR
Ga0209180_1007376013300027846Vadose Zone SoilDKGRKKWRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0209701_1016724323300027862Vadose Zone SoilRVGLDKSEGAVKDKNILGSAVAPLALPERLRTKALEISR
Ga0209579_1011796923300027869Surface SoilPLDKSEGGVKDKDILCSAVAPLFSPEGLRTKTLEISR
Ga0302266_1001902513300028779BogVALDKREGSVKDKDILGSAEAPLALPERLRTKALE
Ga0302279_1003202963300028783BogADAPWRVALDKREGSVKDKDILGSAEAPLALPERLRTKALEISR
Ga0302279_1003270413300028783BogVALDKREGSVKDKDILGSAEAPLALPERLRTKALEISR
Ga0307504_1001682713300028792SoilSGVPLDKSEGGVKDKSILPVFWAPLFCQRGLRTKTLEISR
Ga0302157_1035526623300028813BogAIKQRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR
Ga0302268_100200213300028854BogCSTAIADAPWRVALDKREGSVKDKDILGSAEAPLALPERLRTKALEISR
Ga0311341_1069727423300029908BogRRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR
Ga0311361_1045105423300029911BogRVPKTMRVPLDKREGSVKGKLVLGDAEAPLFSPERLRTKTLEISR
Ga0311343_1027675923300029953BogPFPQRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR
Ga0302283_104605053300029994FenPLDKREGSVKDKDILGSAEAPLALPERLRTKALEISR
Ga0302324_10245566213300031236PalsaSLHMAGCRVRLDKTEGAVKDKDILGSAEASLALPERLRTKALEIPR
Ga0302320_1002920713300031524BogMPLDKNEGAVKDKDILSSAGHRFFSPEGLRTKTLEMKISRSS
Ga0302320_1077873123300031524BogVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR
Ga0310686_10427749573300031708SoilRVALDKSEGAVKDKLSLSVFFPPLVSPERLRTKTLEISR
Ga0307475_1017383213300031754Hardwood Forest SoilVSLDKSEAGVKDKNMLAGVFGTAFLPERLRTKTLEISR
Ga0311301_1066495413300032160Peatlands SoilMRVALDKSEGSVKGKNIRCRAEAPLVLPERLRTKALE
Ga0335085_1043969313300032770SoilWGVPLDKSEGSVKDKDILGSAKHRFCSPERLRTKTLEISR
Ga0335080_1062421623300032828SoilDKSEGFVKGIVVLGGAQAPPVLPERLRTKTLEISR
Ga0335080_1064349913300032828SoilLVADWRVALDKSEGSVKDKDILGGALAPLSSPQRLRTKTLEISR
Ga0335080_1121008913300032828SoilVALDKSEGSVKDKDILGGALAPLSSPQRLRTKTLE
Ga0335072_1024240433300032898SoilTAIGQVALDKSEVSVKGTDILGGAQAPPAFSDQRRLRTKTLEISR
Ga0335083_1027595413300032954SoilMIQLHRRVKCRVPLDKREGAVKDKDILGSVEAPLALPERLRTKTLEI
Ga0335076_1084106823300032955SoilRSRVALDKSEGFVKGIVVLGGAQAPPVLPERLRTKTLEISR
Ga0326728_1031044313300033402Peat SoilMAAASLRVPLDKSEGGVKDKVILCHAEAPLAVPERLRTKTLEISRES
Ga0326728_1050187313300033402Peat SoilVALDKSEGGVKDKVILCHAEAPLAVPERLRTKTLEIS
Ga0326727_1000198913300033405Peat SoilVPLDKSEGSVKGKNILGSAEAPLALPERLRTKALEISRGIT
Ga0326727_1034965913300033405Peat SoilMAAASLRVPLDKSEGGVKDKVILCHAEAPLAVPERLRTK
Ga0326727_1048758913300033405Peat SoilLRLSIDKSEGSVKGKNILGSAEAPLALPERLRTKALEISRGITYRW
Ga0326726_1010000613300033433Peat SoilLSLDLRQLGVRLDKSEGAVKGKDVLGSAEAPLVSPERLRTKTLEISR
Ga0334850_017015_1243_13593300033828SoilVPLDKSEGGVKDKNILSVFSAPLFCQRGLRTKTLEISR
Ga0370514_021320_1447_15723300034199Untreated Peat SoilSSRVPLDKSEGGVKDKSIPSVFFPPLMSPERLRTKTLEISR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.