| Basic Information | |
|---|---|
| Family ID | F083198 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKTMLGLEKTEKEILAFEVSDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.00 % |
| % of genes near scaffold ends (potentially truncated) | 35.40 % |
| % of genes from short scaffolds (< 2000 bps) | 81.42 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.327 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds (19.469 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.894 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.42% β-sheet: 0.00% Coil/Unstructured: 81.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 7.96 |
| PF13575 | DUF4135 | 2.65 |
| PF04392 | ABC_sub_bind | 2.65 |
| PF13474 | SnoaL_3 | 1.77 |
| PF01408 | GFO_IDH_MocA | 0.88 |
| PF13185 | GAF_2 | 0.88 |
| PF00365 | PFK | 0.88 |
| PF00890 | FAD_binding_2 | 0.88 |
| PF00115 | COX1 | 0.88 |
| PF13396 | PLDc_N | 0.88 |
| PF12895 | ANAPC3 | 0.88 |
| PF02582 | DUF155 | 0.88 |
| PF13493 | DUF4118 | 0.88 |
| PF13561 | adh_short_C2 | 0.88 |
| PF07015 | VirC1 | 0.88 |
| PF05545 | FixQ | 0.88 |
| PF02803 | Thiolase_C | 0.88 |
| PF13531 | SBP_bac_11 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.65 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.88 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.88 |
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.88 |
| COG1723 | Mitochondrial translation protein, Rmd1/RMND1/DUF155 family | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG4736 | Cbb3-type cytochrome oxidase, subunit 3 | Energy production and conversion [C] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.33 % |
| Unclassified | root | N/A | 48.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102I8Q91 | Not Available | 530 | Open in IMG/M |
| 3300000156|NODE_c0575883 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1416 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10004073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3966 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10004575 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
| 3300004633|Ga0066395_10783175 | Not Available | 571 | Open in IMG/M |
| 3300005148|Ga0066819_1000327 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300005205|Ga0068999_10078281 | Not Available | 629 | Open in IMG/M |
| 3300005213|Ga0068998_10159625 | Not Available | 544 | Open in IMG/M |
| 3300005329|Ga0070683_101640565 | Not Available | 618 | Open in IMG/M |
| 3300005332|Ga0066388_100002094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 11918 | Open in IMG/M |
| 3300005332|Ga0066388_100717191 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300005332|Ga0066388_104129047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya → unclassified Starkeya → Starkeya sp. ORNL1 | 740 | Open in IMG/M |
| 3300005332|Ga0066388_104332605 | Not Available | 723 | Open in IMG/M |
| 3300005332|Ga0066388_108789987 | Not Available | 501 | Open in IMG/M |
| 3300005434|Ga0070709_10315961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1145 | Open in IMG/M |
| 3300005435|Ga0070714_100743208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 948 | Open in IMG/M |
| 3300005459|Ga0068867_100195104 | Not Available | 1618 | Open in IMG/M |
| 3300005764|Ga0066903_101960717 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300005764|Ga0066903_104996365 | Not Available | 704 | Open in IMG/M |
| 3300005764|Ga0066903_108176923 | Not Available | 535 | Open in IMG/M |
| 3300005843|Ga0068860_101803783 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006041|Ga0075023_100040203 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300006041|Ga0075023_100052972 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300006041|Ga0075023_100098873 | Not Available | 1006 | Open in IMG/M |
| 3300006041|Ga0075023_100272302 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006047|Ga0075024_100688008 | Not Available | 560 | Open in IMG/M |
| 3300006050|Ga0075028_100007475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4365 | Open in IMG/M |
| 3300006050|Ga0075028_100695206 | Not Available | 612 | Open in IMG/M |
| 3300006050|Ga0075028_100733302 | Not Available | 597 | Open in IMG/M |
| 3300006057|Ga0075026_100013071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3616 | Open in IMG/M |
| 3300006057|Ga0075026_100051479 | Not Available | 1942 | Open in IMG/M |
| 3300006057|Ga0075026_100439237 | Not Available | 741 | Open in IMG/M |
| 3300006057|Ga0075026_100931697 | Not Available | 536 | Open in IMG/M |
| 3300006172|Ga0075018_10233231 | Not Available | 885 | Open in IMG/M |
| 3300006353|Ga0075370_10346539 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 887 | Open in IMG/M |
| 3300006806|Ga0079220_10331400 | Not Available | 957 | Open in IMG/M |
| 3300006904|Ga0075424_101426070 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009101|Ga0105247_10797404 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009792|Ga0126374_10190155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1288 | Open in IMG/M |
| 3300009792|Ga0126374_10778244 | Not Available | 728 | Open in IMG/M |
| 3300010043|Ga0126380_10002177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7719 | Open in IMG/M |
| 3300010358|Ga0126370_11543876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 633 | Open in IMG/M |
| 3300010360|Ga0126372_10813150 | Not Available | 927 | Open in IMG/M |
| 3300010360|Ga0126372_11536624 | Not Available | 703 | Open in IMG/M |
| 3300010361|Ga0126378_11769076 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300010371|Ga0134125_12340969 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010376|Ga0126381_102436263 | Not Available | 750 | Open in IMG/M |
| 3300010376|Ga0126381_104214523 | Not Available | 558 | Open in IMG/M |
| 3300012476|Ga0157344_1001983 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300012957|Ga0164303_10860460 | Not Available | 630 | Open in IMG/M |
| 3300012971|Ga0126369_11529633 | Not Available | 757 | Open in IMG/M |
| 3300012984|Ga0164309_10918656 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300013307|Ga0157372_13083773 | Not Available | 532 | Open in IMG/M |
| 3300014056|Ga0120125_1029621 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300014968|Ga0157379_11427986 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300015373|Ga0132257_101724689 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300016387|Ga0182040_10767031 | Not Available | 793 | Open in IMG/M |
| 3300017939|Ga0187775_10078223 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1070 | Open in IMG/M |
| 3300017939|Ga0187775_10126036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300017944|Ga0187786_10615583 | Not Available | 512 | Open in IMG/M |
| 3300017947|Ga0187785_10198679 | Not Available | 872 | Open in IMG/M |
| 3300017947|Ga0187785_10223818 | Not Available | 830 | Open in IMG/M |
| 3300017959|Ga0187779_10264043 | Not Available | 1093 | Open in IMG/M |
| 3300017959|Ga0187779_10396816 | Not Available | 899 | Open in IMG/M |
| 3300017966|Ga0187776_10318933 | Not Available | 1016 | Open in IMG/M |
| 3300017974|Ga0187777_10005539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7996 | Open in IMG/M |
| 3300017974|Ga0187777_10166058 | Not Available | 1478 | Open in IMG/M |
| 3300018058|Ga0187766_10243737 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300018060|Ga0187765_10010902 | All Organisms → cellular organisms → Bacteria | 4093 | Open in IMG/M |
| 3300018064|Ga0187773_10055621 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300018064|Ga0187773_10180493 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1110 | Open in IMG/M |
| 3300018067|Ga0184611_1166477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300018072|Ga0184635_10014384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2823 | Open in IMG/M |
| 3300018073|Ga0184624_10306775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 711 | Open in IMG/M |
| 3300018089|Ga0187774_10119769 | Not Available | 1332 | Open in IMG/M |
| 3300019356|Ga0173481_10494445 | Not Available | 621 | Open in IMG/M |
| 3300021560|Ga0126371_10008271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9370 | Open in IMG/M |
| 3300021560|Ga0126371_10296989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1741 | Open in IMG/M |
| 3300021560|Ga0126371_10579532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1271 | Open in IMG/M |
| 3300024275|Ga0247674_1044679 | Not Available | 533 | Open in IMG/M |
| 3300025920|Ga0207649_10411352 | Not Available | 1014 | Open in IMG/M |
| 3300026089|Ga0207648_10234286 | Not Available | 1634 | Open in IMG/M |
| 3300026340|Ga0257162_1034884 | Not Available | 624 | Open in IMG/M |
| 3300027894|Ga0209068_10022056 | All Organisms → cellular organisms → Bacteria | 3108 | Open in IMG/M |
| 3300027894|Ga0209068_10044218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2247 | Open in IMG/M |
| 3300027894|Ga0209068_10345484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300027894|Ga0209068_10436810 | Not Available | 750 | Open in IMG/M |
| 3300027910|Ga0209583_10337436 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300027910|Ga0209583_10700616 | Not Available | 528 | Open in IMG/M |
| 3300027915|Ga0209069_10012026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4162 | Open in IMG/M |
| 3300027915|Ga0209069_10178036 | Not Available | 1073 | Open in IMG/M |
| 3300027915|Ga0209069_10309535 | Not Available | 841 | Open in IMG/M |
| 3300028796|Ga0307287_10335962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300031545|Ga0318541_10003894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6071 | Open in IMG/M |
| 3300031546|Ga0318538_10724630 | Not Available | 539 | Open in IMG/M |
| 3300031744|Ga0306918_10455534 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300031798|Ga0318523_10569035 | Not Available | 559 | Open in IMG/M |
| 3300031879|Ga0306919_11162438 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031910|Ga0306923_10451651 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300031996|Ga0308176_12726913 | Not Available | 526 | Open in IMG/M |
| 3300032179|Ga0310889_10001337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6284 | Open in IMG/M |
| 3300032179|Ga0310889_10039840 | Not Available | 1785 | Open in IMG/M |
| 3300032205|Ga0307472_101122993 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 745 | Open in IMG/M |
| 3300032211|Ga0310896_10931098 | Not Available | 504 | Open in IMG/M |
| 3300032421|Ga0310812_10270248 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 751 | Open in IMG/M |
| 3300032782|Ga0335082_10398040 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300033289|Ga0310914_10831719 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300033433|Ga0326726_10132370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2260 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 19.47% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 16.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.65% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_08972060 | 2170459002 | Grass Soil | MKTIGLEKTEKEILAFDVSDAALEIAAGTAKKEKAGFTLGSCTGLSVCDG |
| FG2_06563770 | 2189573004 | Grass Soil | MTNITMGLEETEGDILAFKVSDHVLEIAAGTAKEKANFTLGACTACLSAG |
| NODE_05758833 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGFSVCDG* |
| AF_2010_repII_A1DRAFT_100040737 | 3300000597 | Forest Soil | TEMQILGFEVSDEALESAGDSAKKANFTLGACTGLSVCDG* |
| AF_2010_repII_A001DRAFT_100045752 | 3300000793 | Forest Soil | MKNTTLGLGETEMEILGFEVSDNALESAAGSAKEKANFTLGACTGXXVCDG* |
| Ga0066395_107831751 | 3300004633 | Tropical Forest Soil | MAMQTKIEQTEEIFAFDVSDEALEIAAGAEKANFTLGACTGLSVCEG* |
| Ga0066819_10003272 | 3300005148 | Soil | MKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0068999_100782812 | 3300005205 | Natural And Restored Wetlands | MKSITIAPEQTDGEVLAFEVSDAALEIAAASAKEKANFTLGACSGLSVCPG* |
| Ga0068998_101596251 | 3300005213 | Natural And Restored Wetlands | MKSITVAPEQIDEEVLTFEVSDAALEIAAASAKEKANFTLGACSGLSVCPG* |
| Ga0070683_1016405652 | 3300005329 | Corn Rhizosphere | MQKAKVMLESAAEEIVLAFEISDEALEMAAGAALDKANFTLGACTGLSVCDG* |
| Ga0066388_10000209411 | 3300005332 | Tropical Forest Soil | MKNTTLGLGETEMEILGFEVSDNALESAAGSAKEKANFTLGACTGLSVCDG* |
| Ga0066388_1007171912 | 3300005332 | Tropical Forest Soil | MKNTTLGLGETEIQILGFEVSDEALEGAAGAAKERANFTLGACTGLSVCDG* |
| Ga0066388_1041290472 | 3300005332 | Tropical Forest Soil | MKKTEIEILAFEVSDDALESAAGTAKEKANFTLGACTGLSVCDG* |
| Ga0066388_1043326051 | 3300005332 | Tropical Forest Soil | MQTKIEQTEEIFAFDVSDEALEIAAGAEKANFTLGACTGLSVCEG* |
| Ga0066388_1087899871 | 3300005332 | Tropical Forest Soil | MKTVGFEKTEKEILAFEVSDEVLEIAAGMAKEKAGFTLGSCTGLSVCDG* |
| Ga0070709_103159611 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKAIVMLETSEETVLAFEVSDEALEMAAGAAPEKANFTLGACSGLSVCDG* |
| Ga0070714_1007432083 | 3300005435 | Agricultural Soil | MQKAKVMLEASEETVLAFEVSDEALEMAAGAAPEKANFTLGACSGLSVCDG* |
| Ga0068867_1001951042 | 3300005459 | Miscanthus Rhizosphere | GAAGERKDRAMKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0066903_1019607172 | 3300005764 | Tropical Forest Soil | MKTVRVEKTEKEILAFEVSDEVLEIAAGMAKEKAGFTLGSCTGLSVCDG* |
| Ga0066903_1049963651 | 3300005764 | Tropical Forest Soil | MKKTEIEILAFEVSDDALESAAGTVKERANFTLGACTGLSVCDG* |
| Ga0066903_1081769231 | 3300005764 | Tropical Forest Soil | MKTVRLEKTEKEILAFEVSDEVLEIAAGMAKEKAGFTLGSCTGLSVCDG* |
| Ga0068860_1018037833 | 3300005843 | Switchgrass Rhizosphere | AAGERKDRAMKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0075023_1000402033 | 3300006041 | Watersheds | MRNITKQTEEETVTFEVTDEALELAAGAAKEKANFTLGACTGLSVCDG* |
| Ga0075023_1000529722 | 3300006041 | Watersheds | MKTMFKTEEEILAFEVSDEALETAAGMKEKADFTLGACTGLSVCDG* |
| Ga0075023_1000988733 | 3300006041 | Watersheds | MKNITIGLEQADEDILAFEVSDETLEIAAGSAKEKANFTLGACSGLSVCPG* |
| Ga0075023_1002723022 | 3300006041 | Watersheds | MKTMLGLENTEKEILAFEVSDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0075024_1006880082 | 3300006047 | Watersheds | VRNIAKQTEEETVTFEVTDEALELAAGAAKETANFTLGACTGLSVCDG* |
| Ga0075028_1000074755 | 3300006050 | Watersheds | MKNITIGLEQTDEESLAFEVSDEAIELAASSAEEKANFTLGACSGLSVCPG* |
| Ga0075028_1006952062 | 3300006050 | Watersheds | MRNIAKQTEEENVTFEVTDEALELAAGAAKEKANFTLGACTGLSVCDG* |
| Ga0075028_1007333022 | 3300006050 | Watersheds | MMNITIGLEQSDEELLAFEVSDAALEIAGGTAKDKANFTLGA |
| Ga0075026_1000130711 | 3300006057 | Watersheds | MKNITIGLEQTDEDILAFEVSDETLEIAAGSAKEKANFTLGACSGLSVCPG* |
| Ga0075026_1000514792 | 3300006057 | Watersheds | MKRITIELEQTEEDILAFEISDETLEVAACSAKEKANFTLGACSGLTVCPG* |
| Ga0075026_1004392372 | 3300006057 | Watersheds | VRNIAKQTEEETVTFEVTDEALELAAGAAKERANFTLGACTGLSVCDG* |
| Ga0075026_1009316971 | 3300006057 | Watersheds | MKNITIGLEQTDEESLAFEVSDEAIEIAASSAEEKANFTLGACSGLSVCPG* |
| Ga0075018_102332313 | 3300006172 | Watersheds | MKTMLGLEKTEKEILAFEVSDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0075370_103465391 | 3300006353 | Populus Endosphere | MKTMLIEKTEKEILAFEISDEALEIAAAKEKACFTLGACTGLSVCDG* |
| Ga0079220_103314001 | 3300006806 | Agricultural Soil | QIEQEILAFEVSDEALETAAGSEKANFTLGACTGLSVCDG* |
| Ga0075424_1014260703 | 3300006904 | Populus Rhizosphere | MKTMLIEKTEKEILDFEISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0105247_107974041 | 3300009101 | Switchgrass Rhizosphere | AGERKDRAMKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0126374_101901552 | 3300009792 | Tropical Forest Soil | LGLGETEMEILGFEVSDNALESAAGSAKEKANFTLGACTGLSVCDG* |
| Ga0126374_107782441 | 3300009792 | Tropical Forest Soil | MKKATLGLGETEIEILGFEVSDAALESAAGTAKENANFTLGACTGLSV |
| Ga0126380_100021773 | 3300010043 | Tropical Forest Soil | MKKATLGLGETEIEILGFEVSDAALESAAGTAKENANFTLGACTGLSVCGG* |
| Ga0126370_115438762 | 3300010358 | Tropical Forest Soil | MKNTTLGLGETEIQILGFEVSDEALEGAAGAAKERANFTLG |
| Ga0126372_108131502 | 3300010360 | Tropical Forest Soil | MKNTTLGLGETEMEILGFEVSDNALESAAGSAKEKA |
| Ga0126372_115366242 | 3300010360 | Tropical Forest Soil | MKNATLGLGETEKENFGFEVSDEALESAAGTREKANFTLGACTGLSVCGA* |
| Ga0126378_117690762 | 3300010361 | Tropical Forest Soil | MKTVGLEKTEKEIVAFEVSDEALEIAAGMAKEKAGFTLGAYTGLSVCEG* |
| Ga0134125_123409692 | 3300010371 | Terrestrial Soil | ENTEKEILAFEVSDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0126381_1024362631 | 3300010376 | Tropical Forest Soil | ETEMQILGFEVSDEALESAGDSAKKANFTLGACTGLSVCDG* |
| Ga0126381_1042145231 | 3300010376 | Tropical Forest Soil | MKTVRLEKTEKEILAFEVSDEVLEIAAGMAKEKACFTLGSCTGLSVCDG* |
| Ga0157344_10019832 | 3300012476 | Arabidopsis Rhizosphere | MKTMLIEKTEKEILAFVISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0164303_108604602 | 3300012957 | Soil | GLEKSEREILAFEVSDAALEIAAGNTKEKVNFTLGAWTGLSA* |
| Ga0126369_115296332 | 3300012971 | Tropical Forest Soil | EIQILGFEVSDEALEGAAGAAKERANFTLGACTGLSVCDG* |
| Ga0164309_109186562 | 3300012984 | Soil | TEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0157372_130837731 | 3300013307 | Corn Rhizosphere | RAMKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0120125_10296212 | 3300014056 | Permafrost | MKTMIEQIEEEILAYDVSEEALEVAAGGKEKAGSFTLGACTGLSVCPG* |
| Ga0157379_114279863 | 3300014968 | Switchgrass Rhizosphere | EKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG* |
| Ga0132257_1017246891 | 3300015373 | Arabidopsis Rhizosphere | MKTVGFEKTEKEILALEVSDEALEIAAGMAKEKAGFPLGSCTGLSVCDG* |
| Ga0182040_107670311 | 3300016387 | Soil | AMKKTEIEILAFEVSDDALESAAGTVKERANFTLGACTGLSVCDG |
| Ga0187775_100782232 | 3300017939 | Tropical Peatland | MKNTTTGLAKLEEEILAFEVTDEALEIAASTKEKANFTLGACTGLSVCDG |
| Ga0187775_101260361 | 3300017939 | Tropical Peatland | NLTIGLERTEEEIFAFEVSDEAIENAAGSAKEKANFTLGACTGLSVCDG |
| Ga0187786_102946621 | 3300017944 | Tropical Peatland | MKNTTTGLAKLEEEIVGFEVTDEALEIAASTKEKANFTLGA |
| Ga0187786_106155832 | 3300017944 | Tropical Peatland | MKNLTIGLERTEEEIFAFEVSDEAIENAAGSAKEKANFTLGACTG |
| Ga0187785_101986791 | 3300017947 | Tropical Peatland | MKTVGFEKTEKEILAFEVSDEVLEIAAGMAKEKAGFTLGSCTGLSVCDG |
| Ga0187785_102238183 | 3300017947 | Tropical Peatland | MKNLTIGLERTEEEIFAFEVSDEAIENAAGSAKEKANFTLGAC |
| Ga0187779_102640433 | 3300017959 | Tropical Peatland | MKNTTTGLDQTDDVFAFEVSDEALESAAGTAKEKANFTLGACTG |
| Ga0187779_103968162 | 3300017959 | Tropical Peatland | MKYQIEQEVTEILAFEVSDEALEIAAGSEKANFTLGACTGLSVCDG |
| Ga0187776_103189331 | 3300017966 | Tropical Peatland | MKNLTIGLERTEEEIFAFEVSDEAIENAAGSAKEKANFTLGACTGLSVCDG |
| Ga0187777_100055394 | 3300017974 | Tropical Peatland | MKNTTTGLDQTDDVFAFEVSDEALESAAGTAKEKANFTLGACTGLSVCDG |
| Ga0187777_101660581 | 3300017974 | Tropical Peatland | MKTVGLEKTEKEILAFEVSDEVLEIAAGMAKEKAGFTLGSCTGLSVCDG |
| Ga0187787_101823881 | 3300018029 | Tropical Peatland | MKNTTMGLAKLEEEVLAFEVTDEALEIAAGVKEKANFTLGACTGLSVCDG |
| Ga0187766_102437372 | 3300018058 | Tropical Peatland | MKTVGIEKTEKEILAFEVSDEVLEIAAGMAKEKAGFTLGSCTGLSVCDG |
| Ga0187765_100109022 | 3300018060 | Tropical Peatland | MKYQIEQEITEILAFEVSDEALEIAAGSEKANFTLGACTGLSVCDG |
| Ga0187773_100556212 | 3300018064 | Tropical Peatland | MNDTKGLEQVEQDILAFEIADEALEIAGGKEKAGSFTLGACTGLSVCDG |
| Ga0187773_101804932 | 3300018064 | Tropical Peatland | MKNTTTGLAKLEEEILVFEVTDEALEIAASTKEKANFTLGACTGLSVCDG |
| Ga0187773_107674821 | 3300018064 | Tropical Peatland | MKTTTMGLAKLEEEILAFEVTDEALEIAAGAKEKANFTLGACTGLSVCDG |
| Ga0184611_11664772 | 3300018067 | Groundwater Sediment | PVNKGWMKVMRNIANQIKEETLAFEVTDEALELAAGVAKEKASFTLGACTGLSVCDG |
| Ga0184635_100143842 | 3300018072 | Groundwater Sediment | MRNIANQIKEETLAFEVTDEALELAAGVAKEKASFTLGACTGLSVCDG |
| Ga0184624_103067751 | 3300018073 | Groundwater Sediment | KEETLAFEVTDEALELAAGVAKEKASFTLGACTGLSVCDG |
| Ga0187774_101197691 | 3300018089 | Tropical Peatland | RTNAMNDTMGLEQLEQDILAFDVADEALEIAGGKEKAGSFTLGACTGLSVCDG |
| Ga0187774_106228462 | 3300018089 | Tropical Peatland | MKNITIGLEHTEEELILAFEASDETLEIAAGSAKEKANFTLGACTGLVECPA |
| Ga0173481_104944452 | 3300019356 | Soil | MKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Ga0126371_100082715 | 3300021560 | Tropical Forest Soil | MKKATLGLGETEIEILGFEVSDAALESAAGTAKENANFTLGACTGLSVCGG |
| Ga0126371_102969892 | 3300021560 | Tropical Forest Soil | MKNTTLGLGETEMEILGFEVSDNALESAAGSAKEKANFTLGACTGLSVCDG |
| Ga0126371_105795322 | 3300021560 | Tropical Forest Soil | MQTKIEQTEEIFAFDVSDEALEIAAGAEKANFTLGACTGLSVCEG |
| Ga0247674_10446791 | 3300024275 | Soil | MKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLS |
| Ga0207649_104113523 | 3300025920 | Corn Rhizosphere | TEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Ga0207648_102342862 | 3300026089 | Miscanthus Rhizosphere | KTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Ga0257162_10348841 | 3300026340 | Soil | MKTIGLEKTEKEILAFEVSDETLEIAAGRAKEKAGFTLGSCTGLSVCDG |
| Ga0209068_100220561 | 3300027894 | Watersheds | MKTMFKTEEEILAFEVSDEALETAAGMKEKADFTLGACTGLSVCDG |
| Ga0209068_100442183 | 3300027894 | Watersheds | MRNITKQTEEETVTFEVTDEALELAAGAAKEKANFTLGACTGLSVCDG |
| Ga0209068_103454841 | 3300027894 | Watersheds | MKNITIGLEQTDEESLAFEVSDEAIELAASSAEEKANFTLGACSGLS |
| Ga0209068_104368101 | 3300027894 | Watersheds | MKNITIGLEQADEDILAFEVSDETLEIAAGSAKEKANFTLGACSGLSVCPG |
| Ga0209583_103374361 | 3300027910 | Watersheds | MKTMLGLENTEKEILAFEVSDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Ga0209583_107006161 | 3300027910 | Watersheds | VRNIAKQTEEETVTFEVTDEALELAAGAAKERANFTLGACTGLSVCDG |
| Ga0209069_100120262 | 3300027915 | Watersheds | VRNIAKQTEEETVTFEVTDEALELAAGAAKETANFTLGACTGLSVCDG |
| Ga0209069_101780362 | 3300027915 | Watersheds | MRNITKQTEEETVTFEVTDEALELAAGAAKEKANFTLGACTGLS |
| Ga0209069_103095351 | 3300027915 | Watersheds | MKRITIGLEQTEEDILAFEISDETLEVAACSAKEKANFTLGACSGLTVCPG |
| Ga0307287_103359621 | 3300028796 | Soil | RNWGPVNKGWMKVMRNIANQIKEETLAFEVTDEALELAAGVAKEKASFTLGACTGLSVCD |
| Ga0318541_100038942 | 3300031545 | Soil | MKTMLGLEKTEKEILAFEVSDDSLEIAAGMAKEKAGFTLGACTGLSVCEG |
| Ga0318538_107246302 | 3300031546 | Soil | MKTVRLEKTEKEILAFEVSDEVVEIAAGMAKEKAGFTLGSCTGLSVCDG |
| Ga0306918_104555341 | 3300031744 | Soil | MKKTEIEILAFEVSDDALESAAGTVKERANFTLGACTGLSVCDG |
| Ga0318523_105690351 | 3300031798 | Soil | MKTMLGLEKTEKEILAFEVSDEVVEIAAGMAKEKAGFTLGSCTGLSVCDG |
| Ga0306919_111624381 | 3300031879 | Soil | MKTVRLEKTEKEILAFEVSDEVVEIAAGMAKEKAGFTLGSCTGLS |
| Ga0306923_104516511 | 3300031910 | Soil | MKTVRLEKTEKEILAFEVSDEVVEIAAGMAKEKAGFTLGSC |
| Ga0308176_127269131 | 3300031996 | Soil | MKNASVMLEKAEEAVLAFEVSDEALEMAAGGALEKANFTLGACSGLSVCDG |
| Ga0310889_100013376 | 3300032179 | Soil | MKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSV |
| Ga0310889_100398402 | 3300032179 | Soil | RKDRAMNTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Ga0307472_1011229932 | 3300032205 | Hardwood Forest Soil | RKDRAMKTMLIEKTEKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Ga0310896_109310982 | 3300032211 | Soil | EKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Ga0310812_102702481 | 3300032421 | Soil | GAAGERKDRAMKTMLIEKTVKEILAFEISDEALEIAAAKEKAGFTLGACTGLSVCDG |
| Ga0335082_103980402 | 3300032782 | Soil | MKMNELEQDLLAFEVSDEVLEIAAGTKEKAASFTLGACTGLSVCDG |
| Ga0310914_108317193 | 3300033289 | Soil | TEKEILAFEVSDEVVEIAAGMAKEKAGFTLGSCTGLSVCDG |
| Ga0326726_101323702 | 3300033433 | Peat Soil | MKSITIAPEQTDGEVLAFEVSDAALEIAAASAKEKANFTLGACSGLSVCPG |
| ⦗Top⦘ |