| Basic Information | |
|---|---|
| Family ID | F083192 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MQWSYPELRQRLIKAELWPQGRMARLACYLAGMAAVLFALQKLLGLFAA |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 26.55 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 90.27 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.637 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.044 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.354 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.327 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.35% β-sheet: 0.00% Coil/Unstructured: 50.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 13.27 |
| PF11304 | DUF3106 | 0.88 |
| PF01161 | PBP | 0.88 |
| PF03544 | TonB_C | 0.88 |
| PF00521 | DNA_topoisoIV | 0.88 |
| PF03948 | Ribosomal_L9_C | 0.88 |
| PF01408 | GFO_IDH_MocA | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.88 |
| COG0359 | Ribosomal protein L9 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.64 % |
| All Organisms | root | All Organisms | 43.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig6782 | Not Available | 611 | Open in IMG/M |
| 3300001471|JGI12712J15308_10026628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1499 | Open in IMG/M |
| 3300001867|JGI12627J18819_10140516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 986 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101287129 | Not Available | 622 | Open in IMG/M |
| 3300004092|Ga0062389_102373589 | Not Available | 701 | Open in IMG/M |
| 3300004092|Ga0062389_104716316 | Not Available | 513 | Open in IMG/M |
| 3300005179|Ga0066684_10542781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 780 | Open in IMG/M |
| 3300005332|Ga0066388_101638631 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300005436|Ga0070713_100470390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1183 | Open in IMG/M |
| 3300005436|Ga0070713_100504937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1141 | Open in IMG/M |
| 3300005533|Ga0070734_10162152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1295 | Open in IMG/M |
| 3300005541|Ga0070733_10060621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2376 | Open in IMG/M |
| 3300005560|Ga0066670_10047300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2210 | Open in IMG/M |
| 3300005764|Ga0066903_108109742 | Not Available | 538 | Open in IMG/M |
| 3300005887|Ga0075292_1022475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 837 | Open in IMG/M |
| 3300005921|Ga0070766_10005019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6690 | Open in IMG/M |
| 3300006028|Ga0070717_11916318 | Not Available | 535 | Open in IMG/M |
| 3300006032|Ga0066696_10999700 | Not Available | 532 | Open in IMG/M |
| 3300006050|Ga0075028_100792474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300006052|Ga0075029_100404328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300006052|Ga0075029_100652266 | Not Available | 707 | Open in IMG/M |
| 3300006086|Ga0075019_10487519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300006086|Ga0075019_10672676 | Not Available | 653 | Open in IMG/M |
| 3300006102|Ga0075015_100040734 | Not Available | 2159 | Open in IMG/M |
| 3300006162|Ga0075030_101212479 | Not Available | 593 | Open in IMG/M |
| 3300006172|Ga0075018_10451490 | Not Available | 662 | Open in IMG/M |
| 3300006174|Ga0075014_100162948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300006174|Ga0075014_101015649 | Not Available | 503 | Open in IMG/M |
| 3300007982|Ga0102924_1210671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300009623|Ga0116133_1217325 | Not Available | 517 | Open in IMG/M |
| 3300009700|Ga0116217_10094732 | Not Available | 2051 | Open in IMG/M |
| 3300009839|Ga0116223_10784477 | Not Available | 545 | Open in IMG/M |
| 3300010339|Ga0074046_10381788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300010373|Ga0134128_12913302 | Not Available | 527 | Open in IMG/M |
| 3300010379|Ga0136449_100553685 | Not Available | 1977 | Open in IMG/M |
| 3300010379|Ga0136449_104012200 | Not Available | 549 | Open in IMG/M |
| 3300012199|Ga0137383_11135009 | Not Available | 564 | Open in IMG/M |
| 3300012208|Ga0137376_11504877 | Not Available | 564 | Open in IMG/M |
| 3300012930|Ga0137407_11115715 | Not Available | 748 | Open in IMG/M |
| 3300014201|Ga0181537_10430314 | Not Available | 905 | Open in IMG/M |
| 3300015372|Ga0132256_100170605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2202 | Open in IMG/M |
| 3300015372|Ga0132256_100459576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1381 | Open in IMG/M |
| 3300017924|Ga0187820_1172564 | Not Available | 662 | Open in IMG/M |
| 3300017930|Ga0187825_10321057 | Not Available | 581 | Open in IMG/M |
| 3300017961|Ga0187778_10060844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2309 | Open in IMG/M |
| 3300017973|Ga0187780_10649032 | Not Available | 759 | Open in IMG/M |
| 3300017995|Ga0187816_10165989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300017995|Ga0187816_10172086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 939 | Open in IMG/M |
| 3300018006|Ga0187804_10460161 | Not Available | 568 | Open in IMG/M |
| 3300018007|Ga0187805_10145784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1077 | Open in IMG/M |
| 3300018022|Ga0187864_10243793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300018038|Ga0187855_10118001 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300018058|Ga0187766_10085871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1892 | Open in IMG/M |
| 3300018085|Ga0187772_10937012 | Not Available | 630 | Open in IMG/M |
| 3300020579|Ga0210407_10254353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1368 | Open in IMG/M |
| 3300020580|Ga0210403_11088265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300020583|Ga0210401_11470884 | Not Available | 538 | Open in IMG/M |
| 3300021088|Ga0210404_10638744 | Not Available | 606 | Open in IMG/M |
| 3300021170|Ga0210400_11067899 | Not Available | 654 | Open in IMG/M |
| 3300021180|Ga0210396_11427665 | Not Available | 571 | Open in IMG/M |
| 3300021402|Ga0210385_11525589 | Not Available | 510 | Open in IMG/M |
| 3300021403|Ga0210397_10488975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300021404|Ga0210389_10916432 | Not Available | 682 | Open in IMG/M |
| 3300021407|Ga0210383_10580395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 967 | Open in IMG/M |
| 3300021420|Ga0210394_11044202 | Not Available | 706 | Open in IMG/M |
| 3300021420|Ga0210394_11597190 | Not Available | 549 | Open in IMG/M |
| 3300021432|Ga0210384_11733238 | Not Available | 530 | Open in IMG/M |
| 3300021474|Ga0210390_10931070 | Not Available | 713 | Open in IMG/M |
| 3300021477|Ga0210398_11297151 | Not Available | 572 | Open in IMG/M |
| 3300021478|Ga0210402_10320177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1437 | Open in IMG/M |
| 3300021479|Ga0210410_10881773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300022557|Ga0212123_10542286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 746 | Open in IMG/M |
| 3300025134|Ga0207416_1176602 | Not Available | 686 | Open in IMG/M |
| 3300025916|Ga0207663_11198896 | Not Available | 611 | Open in IMG/M |
| 3300025916|Ga0207663_11208312 | Not Available | 609 | Open in IMG/M |
| 3300026142|Ga0207698_12733967 | Not Available | 502 | Open in IMG/M |
| 3300026308|Ga0209265_1109059 | Not Available | 706 | Open in IMG/M |
| 3300026869|Ga0207821_1022689 | Not Available | 617 | Open in IMG/M |
| 3300027063|Ga0207762_1029572 | Not Available | 841 | Open in IMG/M |
| 3300027521|Ga0209524_1069413 | Not Available | 741 | Open in IMG/M |
| 3300027591|Ga0209733_1043618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1195 | Open in IMG/M |
| 3300027824|Ga0209040_10432664 | Not Available | 603 | Open in IMG/M |
| 3300027842|Ga0209580_10051018 | Not Available | 1928 | Open in IMG/M |
| 3300027842|Ga0209580_10473395 | Not Available | 624 | Open in IMG/M |
| 3300027842|Ga0209580_10567330 | Not Available | 564 | Open in IMG/M |
| 3300027857|Ga0209166_10194890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1091 | Open in IMG/M |
| 3300027869|Ga0209579_10140310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1286 | Open in IMG/M |
| 3300027884|Ga0209275_10036756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2290 | Open in IMG/M |
| 3300027905|Ga0209415_10846588 | Not Available | 630 | Open in IMG/M |
| 3300027911|Ga0209698_10355204 | Not Available | 1151 | Open in IMG/M |
| 3300027911|Ga0209698_11279482 | Not Available | 538 | Open in IMG/M |
| 3300028747|Ga0302219_10445509 | Not Available | 508 | Open in IMG/M |
| 3300028789|Ga0302232_10649207 | Not Available | 518 | Open in IMG/M |
| 3300028800|Ga0265338_10956146 | Not Available | 581 | Open in IMG/M |
| 3300029999|Ga0311339_10076464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4277 | Open in IMG/M |
| 3300030813|Ga0265750_1086126 | Not Available | 530 | Open in IMG/M |
| 3300031231|Ga0170824_114686314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1507 | Open in IMG/M |
| 3300031469|Ga0170819_10462657 | Not Available | 674 | Open in IMG/M |
| 3300031715|Ga0307476_10546917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300031718|Ga0307474_10613547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300031753|Ga0307477_10586853 | Not Available | 752 | Open in IMG/M |
| 3300031754|Ga0307475_11128392 | Not Available | 613 | Open in IMG/M |
| 3300031910|Ga0306923_11841018 | Not Available | 620 | Open in IMG/M |
| 3300032001|Ga0306922_11277051 | Not Available | 744 | Open in IMG/M |
| 3300032174|Ga0307470_10086233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1751 | Open in IMG/M |
| 3300032782|Ga0335082_10023312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6636 | Open in IMG/M |
| 3300032783|Ga0335079_10166706 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300032898|Ga0335072_10506152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1249 | Open in IMG/M |
| 3300032954|Ga0335083_10195344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1858 | Open in IMG/M |
| 3300032955|Ga0335076_10607830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300032955|Ga0335076_11374592 | Not Available | 592 | Open in IMG/M |
| 3300033158|Ga0335077_10913810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300033545|Ga0316214_1020987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 913 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.04% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 10.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.31% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.65% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_01425380 | 2124908044 | Soil | MQWSYPELRFRLIKAGLWPEGRLARLACYLAGMAGVLFGLQKLLGLFAKSWGEHLGG |
| JGI12712J15308_100266281 | 3300001471 | Forest Soil | MQWSYAEIRQALIRAELWPQGRVARIAWYQVALAGILFVF |
| JGI12627J18819_101405161 | 3300001867 | Forest Soil | MQWSYPELRHRLSQAGLWPQGRMARLACYLAAMAAGLFALQKLLDLFARSWG |
| JGIcombinedJ26739_1012871292 | 3300002245 | Forest Soil | MQWSYPEFRHRLIKTGLWPQGRVARLACYLAAMAGVLFALQKLLAVLV |
| Ga0062389_1023735891 | 3300004092 | Bog Forest Soil | MQWSYPELRQRLIEAELWPQGRMARLACYLAGMALALFALKELLGLFAPAW |
| Ga0062389_1047163161 | 3300004092 | Bog Forest Soil | MQWSYPELRVRLIEAELWPQGRMARLACYLAGMSGVLFALQKLLGLIAPTWGAHLGGWV |
| Ga0066684_105427811 | 3300005179 | Soil | MPAKRMQWSYLELRRRLIEAELWPRGRMSRLACYLAGSAIVLYALRILLGLFAPSWGAHLGG |
| Ga0066388_1016386314 | 3300005332 | Tropical Forest Soil | MQWSYQELRRTLIGANLWPHGRMSRLACYLAGLAIALFALEKLLGLFSLS |
| Ga0070713_1004703901 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MQWSYPEVRRKLIEADLWPKGRMAYLACYLAGLAIILFVLQELLGLFAATWGA |
| Ga0070713_1005049373 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAKRMQGSYLELRRRLIEAELWPRGRMSRLACYLAGSAIVLYALRILLGLFAPSWGAHL |
| Ga0070734_101621521 | 3300005533 | Surface Soil | MEWSYSELKSRLLQAELWPQGRMARLACYLAALAVGLLGLENLLG |
| Ga0070733_100606214 | 3300005541 | Surface Soil | MQWSYPEIRQKLIQVELWPQGRMARLACYLAALAALLFA |
| Ga0066670_100473001 | 3300005560 | Soil | MPAKRMQWSYLELRRRLIEAELWPRGRMSRLACYLAGSAIVLY |
| Ga0066903_1081097422 | 3300005764 | Tropical Forest Soil | MQWSYPELRSRLIRAGLWPQGKMSLLACYLAVLAAVLYILEKLLGLFAR |
| Ga0075292_10224751 | 3300005887 | Rice Paddy Soil | MKWSYLELRRSLIQTELWPQGRMARLACYLAGSAVVLYALEKLLGLFAPTWG |
| Ga0070766_100050199 | 3300005921 | Soil | MQRSYPEVRLRLIKAGLWPEGRMARLACYLAAMAAVLFAL |
| Ga0070717_119163182 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MQWSYPELRRRLIQAELWPQGRMARVACYLAGLALALFALQELLGLFAPSWGQHL |
| Ga0066696_109997001 | 3300006032 | Soil | MPAKRMQWSYLELRRRLIEAELWPRGRMSRLACYLAGSAIVLYALRILLGLFAPSWGA |
| Ga0075028_1007924742 | 3300006050 | Watersheds | MQWSYPELRRRLVEAELWPQGKMARLACYLAGMAVGLYGLQKLLGMFAASWG* |
| Ga0075029_1004043283 | 3300006052 | Watersheds | MQWSYPKLRGRLIEAGLWPESRMARLACYLAGMAAVLFGLQKLLGLFAASWG |
| Ga0075029_1006522661 | 3300006052 | Watersheds | MQWSYPELRQRLIKAELWPQGRMARLACYLGGMAAVLF |
| Ga0075019_104875192 | 3300006086 | Watersheds | MEWSHPELRHRLIKAGLWPESRMARLACYLAAMAGVLFVVQKLLGLFAR |
| Ga0075019_106726763 | 3300006086 | Watersheds | MEWSYPELRRRLIEAELWPEGRLARLACYLAGLAAVLYGLQKLLGLFA |
| Ga0075015_1000407344 | 3300006102 | Watersheds | MQWSHPELRRSLIKAGFWPEGRMARLACYLAALAAA |
| Ga0075030_1012124792 | 3300006162 | Watersheds | MQWSYPELRQRLIEAELWPQGRMARLACYLATMAAVLF |
| Ga0075018_104514901 | 3300006172 | Watersheds | MPLFYSELRSRLSRAGLWPEGRMARIACYLMGLAAALFALQKLLGLFALAWGDHLG |
| Ga0075014_1001629481 | 3300006174 | Watersheds | MQWSYPELRRKLIEAGLWPQGRMARLSCYLAALAIALFVLEKLLGFFSLSWG |
| Ga0075014_1010156492 | 3300006174 | Watersheds | MQWSYPEIRQRLIDAELWPQRRMARLACYLAGLAVGLFALEELLGLFAASW |
| Ga0102924_12106713 | 3300007982 | Iron-Sulfur Acid Spring | MRWSYPELRLRLIHAGLWPEGRMARLACYLAAMAGALFALQKLLELLTQAW |
| Ga0116133_12173251 | 3300009623 | Peatland | MQWSYPEVRQRLITAGLWPQGRMASLACYLAGMAGVLFALQRLLGMFARSW |
| Ga0116217_100947321 | 3300009700 | Peatlands Soil | MQRSYPELRRRLTEAGLWPEGRMARLACYLAGMAAVLFGLQKLLGLFAASWGDHLGGWV |
| Ga0116223_107844771 | 3300009839 | Peatlands Soil | MQWSYPEMRGRLIQAGLWPEGRMARLACYLAGMAGVLYALQKLLGLFA |
| Ga0074046_103817883 | 3300010339 | Bog Forest Soil | MQWSYPELRLRLIKAGLWPEGRMARLACYLAGMAAVLFALQKLLGM |
| Ga0134128_129133022 | 3300010373 | Terrestrial Soil | MQWSYPELRRRLIQAEMWPQGRMARVACYLAALALALFALQELLG |
| Ga0136449_1005536851 | 3300010379 | Peatlands Soil | MQLPYPKLRLHLLKAGLWPETRMARLACYLAGMAA |
| Ga0136449_1040122001 | 3300010379 | Peatlands Soil | MQWSYPELRRRLIQAELWPEGRMARLACYLAGMAALLFAVQKLLGLFAK |
| Ga0137383_111350091 | 3300012199 | Vadose Zone Soil | MQWSYPELRHRLIQAELWPEGRMARIAWYLCGLGAALFILQKVLGMFGSPWGQ* |
| Ga0137376_115048771 | 3300012208 | Vadose Zone Soil | MQWSYPELRRKLTEVGLWPQGRMSRLACYLAALAIA |
| Ga0137407_111157151 | 3300012930 | Vadose Zone Soil | MQWSYPELRRRLVEAELWPRGKMARLACYLTGMAVGLFALQRLLSLIAA |
| Ga0181537_104303143 | 3300014201 | Bog | MEWSYPELRRRLTEAGLWPRSRMARLACYLAGLAVALYA |
| Ga0132256_1001706051 | 3300015372 | Arabidopsis Rhizosphere | MQWSYPELRHRLMQAGLWPEGRMARLACYLAGLAALLF |
| Ga0132256_1004595761 | 3300015372 | Arabidopsis Rhizosphere | MQWSYSELRHRLTKAGLWPEGRMARLACYLVGMSAA |
| Ga0187820_11725642 | 3300017924 | Freshwater Sediment | MQWSYPELRRRLIKAGLWPEGRMARLACYLAAMGVALFALQRLLD |
| Ga0187825_103210572 | 3300017930 | Freshwater Sediment | MQWSYPELRRRLSKAGLWPEGRMARLACYLAGMAVVLFALQKLLDLFAASWGNHLGGWVE |
| Ga0187778_100608441 | 3300017961 | Tropical Peatland | MQWSYPELRQRLIKAGLWPEGRMARLACYLAGMAAVLFGLQKLLGLLS |
| Ga0187780_106490323 | 3300017973 | Tropical Peatland | MHWSYSEVRSRLVRAGLWPEGRMARLACYLAGLAAVLFALQKVLAMFAPSWGE |
| Ga0187816_101659893 | 3300017995 | Freshwater Sediment | MQWSYPELRQRLMKAELWPQGRMARLACYLASLAIVLFALQKLLGLFAAS |
| Ga0187816_101720861 | 3300017995 | Freshwater Sediment | MQWSYPEIRSRLVRAELWPRGRMAKVACYLGALAIALFA |
| Ga0187804_104601611 | 3300018006 | Freshwater Sediment | MQWSYPELRGRLIRAELWPQGRMARLACYLAALAALLYALEKLLGVFARSWGDS |
| Ga0187805_101457841 | 3300018007 | Freshwater Sediment | MRLFYSEWRQRLIRAELWPQGRMARLACYLAGMAIVLFGLRKLLA |
| Ga0187864_102437931 | 3300018022 | Peatland | MNMEWSYPESRRRLIAAELWPQGRMARLACYLAGMAAVLFG |
| Ga0187855_101180014 | 3300018038 | Peatland | MQWSYPELRRKLIEAELWPQGRMARLACYLTALAAVL |
| Ga0187766_100858711 | 3300018058 | Tropical Peatland | MHWSYSEVRSRLVRAGLWPEGRMARLACYLAGLAAVLFAL |
| Ga0187772_109370121 | 3300018085 | Tropical Peatland | MQWSYAELRRRLIKAGLWPEGRMARLACYLAGMAAAL |
| Ga0210407_102543533 | 3300020579 | Soil | MQRSYPEVRLRLIKAGLWPEGRMARLACYLAAMAAVL |
| Ga0210403_110882651 | 3300020580 | Soil | MQWSYPELRRRLIEAELWPQGRMARITCYILALGAGLFAL |
| Ga0210401_114708842 | 3300020583 | Soil | MPWSYPELRLRLIKADLWPEGRMARLACYLAAMAGLLYA |
| Ga0210404_106387441 | 3300021088 | Soil | MEWSYPELKRKLTQAGLWPQGRLARLACYLTALAATL |
| Ga0210400_110678991 | 3300021170 | Soil | MQWSYPEVRRRLIEAELWPQGRMARLACYLAAMAAVLFALQEFLGLFSSWGE |
| Ga0210396_114276651 | 3300021180 | Soil | MPWSYPELRLRLIKADLWPEGRMARLACYLAAMAG |
| Ga0210385_115255892 | 3300021402 | Soil | MQWSYPDLRQRLVEAELWPQGRMARLACYLTAMAAFLFGLQRLLGLFARSWGDHL |
| Ga0210397_104889753 | 3300021403 | Soil | MEWSYPELKRKLTQAGLWPQGRLARLACYLTALAATLFVLQKLLGLFRL |
| Ga0210389_109164321 | 3300021404 | Soil | MQWSYPELRLRLIKADLWPEGRMARLACYLAAMAGLLYAVEKLLGLLAPTWGDHLGGWV |
| Ga0210383_105803951 | 3300021407 | Soil | MEWSYPELKRKLTQAGLWPQGRLARLACYLTALAATLFVLQKLLGLFRLSWGEHL |
| Ga0210394_110442023 | 3300021420 | Soil | MQRSYPEVRLRLIKAGLWPEGRMARLACYLAAMAAVLFALQKLMGLFARSW |
| Ga0210394_115971902 | 3300021420 | Soil | MQWSYSELRQRLIKADLWPQGRMARLASYLAGMAAVLF |
| Ga0210384_117332381 | 3300021432 | Soil | MQRSYPEVRLRLIKAGLWPEGRMARLACYLAAMAAVLF |
| Ga0210390_109310703 | 3300021474 | Soil | MQWSYPELRRKLIEADLWPQGRMARLACYLAALAVVLF |
| Ga0210398_112971512 | 3300021477 | Soil | MQWSYSELRQRLIKADLWPQGRMARLACYLAGMAAVLFALQMLL |
| Ga0210402_103201771 | 3300021478 | Soil | MNVKWSHPELRYRLRQAGLWPESRMARIAWYLLGLGGFLF |
| Ga0210410_108817731 | 3300021479 | Soil | MQWSYPELRLRLAKAELWPQGRMARIAWYLFGMSAVLFVLRKVLGLFGS |
| Ga0212123_105422863 | 3300022557 | Iron-Sulfur Acid Spring | MRWSYPEFRLRLIKAGLWPEGRMARLACYLAAMAVVLFGLQ |
| Ga0207416_11766021 | 3300025134 | Iron-Sulfur Acid Spring | MRWSYPELRLRLIHAGLWPEGRMARLACYLAAMAGALFALQKLLELLTQ |
| Ga0207663_111988961 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MQWSYLELRRRLIEAELWPRARMSRLACYLAGSAIGLYAL |
| Ga0207663_112083121 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MQWSYPELRVRLIEAELWPQGRMARLACYLAGMAVVLFGMEKLLGLFSRSWGQY |
| Ga0207698_127339671 | 3300026142 | Corn Rhizosphere | MPAKRMQWSYLELRRKLIEAELWPRGRMARLACYLAGSALVLYALRKLLG |
| Ga0209265_11090593 | 3300026308 | Soil | MPAKRMQWSYLELRRRLIEAELWPRGRMSRLACYLAGSAIVLYALRILLGLFAPSWGAHL |
| Ga0207821_10226893 | 3300026869 | Tropical Forest Soil | MQWTYPELRHRLIQAGLWPEGRMARLACYLAGMAAVLFGLQELLGLFAASW |
| Ga0207762_10295721 | 3300027063 | Tropical Forest Soil | MQWTYPELRHRLIQAGLWPEGRMARLACYLAGMAAVLFGLQELLGLFAA |
| Ga0209524_10694131 | 3300027521 | Forest Soil | MQRSYPEVRLRLIKAGLWPEGRMARLACYLAAMAAVLFAWRLSPRAA |
| Ga0209733_10436181 | 3300027591 | Forest Soil | MQWSYPEMRHRLSQAGLWPQGRMARLACYLAAMAAGLFALQKLLDLFARSWGDHLG |
| Ga0209040_104326641 | 3300027824 | Bog Forest Soil | MNMEWSYPELRRRLIAAELWPEGRMARLACYLAGMAAVLVGLQKLLGL |
| Ga0209580_100510184 | 3300027842 | Surface Soil | MQWSYPELRRKLIEADLWPQGRMARLACYLAALAVVLFALEKLLGL |
| Ga0209580_104733951 | 3300027842 | Surface Soil | MRWSYPELRLRLVDAGLWPEGRMARLACYLAAMAGVLFGLQKL |
| Ga0209580_105673302 | 3300027842 | Surface Soil | MQWSYPELRRRLTKAELWPQGRMARLACYLAAMAVVLFALQELLRVFAASWGNHLGGW |
| Ga0209166_101948903 | 3300027857 | Surface Soil | MQWSYPEIRQKLIQVELWPQGRMARLACYLAGLAALLFALEKFV |
| Ga0209579_101403101 | 3300027869 | Surface Soil | MQWSYPEIRQKLIQVELWPQGRMARLACYLAGLAALLFALEKFVGLFAAAWGEHLGGWV |
| Ga0209275_100367561 | 3300027884 | Soil | MQWSYQDVRRRLIKAGLWPEGRLARLACYLAGMAA |
| Ga0209415_108465881 | 3300027905 | Peatlands Soil | MQWSYPEMRGRLIRAGLWPEGRMARLACYLAGMAGVLYALQKLLGLLAPSWGDHLGGW |
| Ga0209698_103552041 | 3300027911 | Watersheds | NRMQWSYPKLRQRLIEAELWPQGRMARLACYLGGMAAVLFGPL |
| Ga0209698_112794821 | 3300027911 | Watersheds | MQWSYPELRQRLIKAELWPQGRMARLACYLAGMAAVLFALQKLLGLFAA |
| Ga0302219_104455092 | 3300028747 | Palsa | MEWSYPELRRRLTEAGLWPKSRMARLACYLAGLAVALYALKEVLGLFAPT |
| Ga0302232_106492072 | 3300028789 | Palsa | MQWSYPKLRRRLITAGLWPEGRVARLACYLAGMAVVLFGLQKL |
| Ga0265338_109561461 | 3300028800 | Rhizosphere | MQWSYPELRQRLIKADLWPQGRMARLACYLAGMGAVLFAL |
| Ga0311339_100764641 | 3300029999 | Palsa | MEWSYPELRRRLTEAGLWPKSRMARLACYLAGLAVALYALKEVLGLFAPTWGEH |
| Ga0265750_10861261 | 3300030813 | Soil | MQWSYPELRRRLITAGLWPEGRVARLACYLAGMAVV |
| Ga0170824_1146863143 | 3300031231 | Forest Soil | MQWSYPEVRRRLIQAELWPEGRLARLACYLAGMAGVLFALQRLLGLFAKSWGE |
| Ga0170819_104626571 | 3300031469 | Forest Soil | MQWSYPEVRRRLIQAELWPEGRLARLACYLAGMAGVLFALQR |
| Ga0307476_105469171 | 3300031715 | Hardwood Forest Soil | MQWSYPELRLRLLKAELWPQGRMARIAWYLFGMAAVLFVLRKVLALFGSSWGQY |
| Ga0307474_106135471 | 3300031718 | Hardwood Forest Soil | MRWSYQEVRLWLIKAGLWPEGRLARLACYLASMAAVLFA |
| Ga0307477_105868533 | 3300031753 | Hardwood Forest Soil | MELSYPELRRRLIKAELWPEGRMARIAWYFFGLAAVLFVLQKMFGLLGISWGQYLSGW |
| Ga0307475_111283921 | 3300031754 | Hardwood Forest Soil | MQWSYPELRQRLIEAELWPQGRMARLACYLAGMAAGLFGLQKLLGLFAASWGQYLV |
| Ga0306923_118410181 | 3300031910 | Soil | MQWSYPELRGKLIKADLWPRGRMARLACYLAGLAIVLFGLEKLLSVFSLAWGEHLGGW |
| Ga0306922_112770512 | 3300032001 | Soil | MTPNMQWSYQQLRRRLTGVGLWPQGRMSRLACYLAGLAVALFALEKLLGLFSLSWGGHLG |
| Ga0307470_100862334 | 3300032174 | Hardwood Forest Soil | MQWSYPELRRKLTEVGLWPQGRMARLACYLAALAIALFALEKLLGLFSLSWGE |
| Ga0335082_100233129 | 3300032782 | Soil | MPSSYRDLRHNLIRAGLWPEGRIARLACYLAGLAAVLFALE |
| Ga0335079_101667061 | 3300032783 | Soil | MEWSYPETRRRLIGADLWPQSRMARLACYLSALAVGLFALEKLLNLFS |
| Ga0335072_105061521 | 3300032898 | Soil | MEWSYPELRSRLVRAELWPQGRLARLACYLAGLAVVLYALEKLLGLFSVGQHLS |
| Ga0335083_101953441 | 3300032954 | Soil | MQWSYPELRQRLIDAELWPQGRMARLACYLTGLAAVLFALEKLLGLFA |
| Ga0335076_106078303 | 3300032955 | Soil | MEWSYPKLRERLIRAELWPQGRMARLACYLAGLAVAL |
| Ga0335076_113745921 | 3300032955 | Soil | MQWSYPELRQKLIQADLWPQGRMARLACYLGGMAVGLFILEKLLDLFSPAWGEHLGGW |
| Ga0335077_109138101 | 3300033158 | Soil | MQWSYSQLRERLIQAELWPQGRIARLACYLAALAAGLF |
| Ga0316214_10209873 | 3300033545 | Roots | MQWSYREIRQQMIDADLWPKGRLARLACYLAASAGLLYILKK |
| ⦗Top⦘ |