| Basic Information | |
|---|---|
| Family ID | F083182 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTNSLAERFFDFDLWLVGAAHFVILFASFQVPYRLRWTQD |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.10 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 89.38 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.044 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.088 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.867 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13813 | MBOAT_2 | 88.50 |
| PF04134 | DCC1-like | 0.88 |
| PF02911 | Formyl_trans_C | 0.88 |
| PF13302 | Acetyltransf_3 | 0.88 |
| PF01435 | Peptidase_M48 | 0.88 |
| PF13669 | Glyoxalase_4 | 0.88 |
| PF03308 | MeaB | 0.88 |
| PF12867 | DinB_2 | 0.88 |
| PF00892 | EamA | 0.88 |
| PF00753 | Lactamase_B | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001166|JGI12694J13545_1001452 | All Organisms → cellular organisms → Bacteria | 2903 | Open in IMG/M |
| 3300001990|JGI24737J22298_10066216 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300004091|Ga0062387_100404386 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300004479|Ga0062595_100404537 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Schlesneria → Schlesneria paludicola | 980 | Open in IMG/M |
| 3300005354|Ga0070675_100011903 | All Organisms → cellular organisms → Bacteria | 6817 | Open in IMG/M |
| 3300005439|Ga0070711_100495689 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005439|Ga0070711_102044223 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005538|Ga0070731_11133353 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005542|Ga0070732_10165454 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300005542|Ga0070732_10314978 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300005557|Ga0066704_10445046 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005561|Ga0066699_10549492 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300005591|Ga0070761_10791715 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Schlesneria → Schlesneria paludicola | 596 | Open in IMG/M |
| 3300005610|Ga0070763_10218760 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300005712|Ga0070764_10146815 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300005921|Ga0070766_11073919 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005993|Ga0080027_10330435 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006032|Ga0066696_10453774 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300006059|Ga0075017_100684980 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300006172|Ga0075018_10706458 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006903|Ga0075426_10030976 | All Organisms → cellular organisms → Bacteria | 3828 | Open in IMG/M |
| 3300007265|Ga0099794_10793921 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009088|Ga0099830_11283729 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009089|Ga0099828_10380845 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300009143|Ga0099792_10251538 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300009174|Ga0105241_10512660 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300009634|Ga0116124_1172722 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009636|Ga0116112_1015317 | All Organisms → cellular organisms → Bacteria | 2775 | Open in IMG/M |
| 3300009672|Ga0116215_1367837 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010043|Ga0126380_10208393 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300010321|Ga0134067_10480378 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010336|Ga0134071_10217731 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300010343|Ga0074044_10675089 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010371|Ga0134125_10750799 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300010401|Ga0134121_12130708 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012199|Ga0137383_10293614 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300012210|Ga0137378_10589436 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300012359|Ga0137385_11045492 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012362|Ga0137361_10775636 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300012582|Ga0137358_10918651 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012685|Ga0137397_10727432 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012925|Ga0137419_10105756 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300012944|Ga0137410_10529449 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300012984|Ga0164309_11610774 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300015262|Ga0182007_10010878 | All Organisms → cellular organisms → Bacteria | 3570 | Open in IMG/M |
| 3300016371|Ga0182034_12045826 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300017948|Ga0187847_10668307 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300017995|Ga0187816_10243962 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300017995|Ga0187816_10292755 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300018001|Ga0187815_10192865 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300018006|Ga0187804_10557955 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018006|Ga0187804_10585354 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018007|Ga0187805_10353176 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300018037|Ga0187883_10441350 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300018058|Ga0187766_11375115 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300018064|Ga0187773_10812134 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300018088|Ga0187771_10394404 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300019887|Ga0193729_1008529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4716 | Open in IMG/M |
| 3300020580|Ga0210403_11294544 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300020582|Ga0210395_10363446 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300021088|Ga0210404_10077023 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300021181|Ga0210388_11710240 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300021403|Ga0210397_10299757 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300021404|Ga0210389_10106669 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300021404|Ga0210389_10298400 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300021405|Ga0210387_10248550 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1555 | Open in IMG/M |
| 3300021405|Ga0210387_11856468 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021420|Ga0210394_10906094 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300021433|Ga0210391_10351153 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300021433|Ga0210391_11384071 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021433|Ga0210391_11439511 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300021474|Ga0210390_10357449 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300021477|Ga0210398_10811157 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300021478|Ga0210402_10282606 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300021559|Ga0210409_10959390 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300021560|Ga0126371_13103263 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025320|Ga0209171_10352062 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300025432|Ga0208821_1031080 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300025916|Ga0207663_10030277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3191 | Open in IMG/M |
| 3300025929|Ga0207664_10879129 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300025934|Ga0207686_10463884 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300026326|Ga0209801_1201057 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300026331|Ga0209267_1100646 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300026332|Ga0209803_1143789 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300027030|Ga0208240_1006167 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300027063|Ga0207762_1039416 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027591|Ga0209733_1084856 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300027603|Ga0209331_1088047 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300027648|Ga0209420_1141439 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300027737|Ga0209038_10011427 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
| 3300027853|Ga0209274_10532441 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300027884|Ga0209275_10427745 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300027884|Ga0209275_10617654 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027884|Ga0209275_10881021 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027889|Ga0209380_10675209 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027895|Ga0209624_10367880 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300028773|Ga0302234_10407624 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300029911|Ga0311361_11446220 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300029918|Ga0302143_1049545 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300030399|Ga0311353_11306353 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300030760|Ga0265762_1002204 | All Organisms → cellular organisms → Bacteria | 3527 | Open in IMG/M |
| 3300030878|Ga0265770_1049781 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300031718|Ga0307474_10137315 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300031753|Ga0307477_10871503 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031754|Ga0307475_10632307 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031820|Ga0307473_11118455 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032174|Ga0307470_10026499 | All Organisms → cellular organisms → Bacteria | 2698 | Open in IMG/M |
| 3300032205|Ga0307472_101633657 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032261|Ga0306920_104372066 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032783|Ga0335079_10777113 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300032783|Ga0335079_12205171 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032805|Ga0335078_10381083 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300033829|Ga0334854_008067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2580 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.77% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.77% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12694J13545_10014526 | 3300001166 | Forest Soil | MTNALVQRLFDIDLWFVGAAHFLILFASFQVPYRLA |
| JGI24737J22298_100662162 | 3300001990 | Corn Rhizosphere | MRYERRMVERFFNIDLWLVGAAHFVILIASAQVPSRLRWREDLKS |
| Ga0062387_1004043862 | 3300004091 | Bog Forest Soil | MTQTLAERCFDLVLWLAGAGHFVILIASAQVPSRLRWKQD |
| Ga0062595_1004045371 | 3300004479 | Soil | MTNSLAQRLFDLDLWLVGAGHFAILFASFQVPFRLNWKQDLKLLM |
| Ga0070675_1000119038 | 3300005354 | Miscanthus Rhizosphere | MRYERRMVERFFNIDLWLVGAAHFVILIASAQVPSRLRWRE |
| Ga0070711_1004956891 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNSLAQRFFDIDLWLVGAAHFVILLASFQVPYRLGWKQDLRQL |
| Ga0070711_1020442232 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNTLANRCFDLILWLAGTGHFMILVASFQVPSRLRWKEDLAQL |
| Ga0070731_111333531 | 3300005538 | Surface Soil | MTKSFFDLDMWIAGLAHFVILCASFQVPYRLRWKEDL |
| Ga0070732_101654542 | 3300005542 | Surface Soil | MTQLERFFDLTLWLAGAGHFVILFASFQVPSRLRWKQDL |
| Ga0070732_103149781 | 3300005542 | Surface Soil | MTNYSAEHFFDLALWLAGLGHFVILIASFQVPSRLRWKEDL |
| Ga0066704_104450461 | 3300005557 | Soil | MTNSLAERFFDFDLWLVGGAHFVILFASFQVPYRLRW |
| Ga0066699_105494921 | 3300005561 | Soil | MTNSLAERFFDFDLWLVGAAHFVILFASFQVPYRLRWTQD |
| Ga0070761_107917151 | 3300005591 | Soil | MTHLSAERLFDFILWLAGAGHFVILFASAQVPARLRWKEDLAQLM |
| Ga0070763_102187602 | 3300005610 | Soil | MSNSFLQQCFNLDLWLAGAGHFVILIASSQVPSRLRWKQDLA |
| Ga0070764_101468153 | 3300005712 | Soil | MTHALVERLFDIDLWFVGAAHFVILFASFQVPYRL |
| Ga0070766_110739192 | 3300005921 | Soil | MTNALVLRLFDIDLWFVGAAHFLILLASFQVPSRLGWKRDLQQ |
| Ga0080027_103304352 | 3300005993 | Prmafrost Soil | MNNFSAERFFDLILWLAGAGHFVILAASFQVPARLRWKEDLAQ |
| Ga0066696_104537741 | 3300006032 | Soil | MTNSLAERFFDFELWLVGGAHFVILFASFQVPYRLGWKQDL |
| Ga0075017_1006849802 | 3300006059 | Watersheds | MTQLDRFFDITLWLAGAGHFVILFASFQVPSRLRWKQD |
| Ga0075018_107064582 | 3300006172 | Watersheds | MNNSIAERLFDFAMWAAGAGHFVILVASFQVPFRLRWKEDLAQL |
| Ga0075426_100309764 | 3300006903 | Populus Rhizosphere | MTGSLAWRFFDLDLWLVGAAHFVILCVSFQVPYRLRWKQ |
| Ga0099794_107939211 | 3300007265 | Vadose Zone Soil | MSNPLMSNAVVERFFDLDIWLAGAGHFLILFASFQVPSRLKWRQDLAQ |
| Ga0099830_112837292 | 3300009088 | Vadose Zone Soil | MSNALAQRFFDIDLWLVGAAHFVILIASFQVPYRLGWKQDLRQLMP |
| Ga0099828_103808451 | 3300009089 | Vadose Zone Soil | MTNSLAERFFDFDLWLVGAAHFVILFASFQVPYRL |
| Ga0099792_102515382 | 3300009143 | Vadose Zone Soil | MTNSLAQRFFDIDLWLVGAAHFVILIASFQVPYRLGWKQ |
| Ga0105241_105126602 | 3300009174 | Corn Rhizosphere | MRYERRMVERFFNIDLWVVGAAHFVILIASAQVPSRLRWREDLKSLMPFNR |
| Ga0116124_11727222 | 3300009634 | Peatland | MTNALVQRLFDIDLWLVGAAHFVILFASFQVPYRLDWKQD |
| Ga0116112_10153171 | 3300009636 | Peatland | MTNSLTERFFDIDLWLVGAAHFVILFASFQVPYRLGW |
| Ga0116215_13678372 | 3300009672 | Peatlands Soil | MTNSLALRCFDLILWLAGAGHFVILFASFQVPSRLRWKQDLAQLMPF |
| Ga0126380_102083931 | 3300010043 | Tropical Forest Soil | MNHPVVQKLFALDLWLAGAAHFVILFASFQVPHRLSWKRDL |
| Ga0134067_104803781 | 3300010321 | Grasslands Soil | MTNSLAERFFDFELWLVGGAHFVILFASFQVPYRMRWKQDLQQLM |
| Ga0134071_102177312 | 3300010336 | Grasslands Soil | MTDSLIERFFDMDLWLVGYGHFAILFASFQVPYRLNWKQDL |
| Ga0074044_106750892 | 3300010343 | Bog Forest Soil | MTQSLAYRFFDVALWLAGVGHFVILFASFQVPLRLNWKQ |
| Ga0134125_107507991 | 3300010371 | Terrestrial Soil | MNNAIAELFFDYDLWFAGAAHFAILFASLQVPYRLA |
| Ga0134121_121307081 | 3300010401 | Terrestrial Soil | MTSTGAERLFDYVLWFCGAAHFVILFASFQVPYRLGWREDLKKLMP |
| Ga0137383_102936142 | 3300012199 | Vadose Zone Soil | MTRPLVQRLFDIDLWLVGAAHFVILFASFQVPYRLSWK |
| Ga0137378_105894362 | 3300012210 | Vadose Zone Soil | MNNALVERLFDIDLWLAGAGHFIILIASSQVPGRLRW |
| Ga0137385_110454921 | 3300012359 | Vadose Zone Soil | MTSSLVKQFFDIDLWLVGAGHFAILIASFQVPSRLQWKQDLQSL |
| Ga0137361_107756361 | 3300012362 | Vadose Zone Soil | MTNSLVQRLFDIDLWFVGAAHFVILFASFQVPYRLGWKQDLQQLLPFNRKL |
| Ga0137358_109186511 | 3300012582 | Vadose Zone Soil | MTSSLAQRFLDLDLWLVGAGHFVILFASFQVPYRLHWKQDLQSL |
| Ga0137397_107274322 | 3300012685 | Vadose Zone Soil | MTDSFAQRLFGIDLWLVGAAHFVILFASFQVPYRLGWKQ |
| Ga0137419_101057561 | 3300012925 | Vadose Zone Soil | MTNSLVQQLFDIDLWLVGAAHLVILFASFQVPYRL |
| Ga0137410_105294491 | 3300012944 | Vadose Zone Soil | MTNALAERCFDLFLWLAGAGHFVILAASFQVPSRLRWKQD |
| Ga0164309_116107742 | 3300012984 | Soil | MMTAEWHRFFDLDLWLAGAGHFIILFASFQVPYRLGWK |
| Ga0182007_100108781 | 3300015262 | Rhizosphere | MTSWERFFDLDLWFAGLTHFVILVASFQVPYRLRWKED |
| Ga0182034_120458261 | 3300016371 | Soil | MTNSLAERFFNIDLWVVGAAHFVILCASFQVPYRLRWKADLQQLL |
| Ga0187847_106683071 | 3300017948 | Peatland | MVERLFNLDLWLAGAGHFVILIASSQVPSRLRWKQDLA |
| Ga0187816_102439622 | 3300017995 | Freshwater Sediment | MTNTLLQRLFDIDLWFAGAAHFVILFASFQVPYRLGWKQDLRQL |
| Ga0187816_102927551 | 3300017995 | Freshwater Sediment | MTDSLAQRFFDIDLWFVGAAHFVILFASFQVPYRLR |
| Ga0187815_101928651 | 3300018001 | Freshwater Sediment | MTSQFIREFFDLDLWFVGVGHFLILFASFQVPYHLRWKQDLQSLIPLN |
| Ga0187804_105579551 | 3300018006 | Freshwater Sediment | MTNSLAQRLFNIDLWFVGAAHFVILVASFQVPYRLGWKHD |
| Ga0187804_105853541 | 3300018006 | Freshwater Sediment | MTISLAERSFDLILWLAGAAHFVILAASFQVPSRLRW |
| Ga0187805_103531761 | 3300018007 | Freshwater Sediment | MTNSLTERFFDFDLWLVGAVHFVILFASFQVPYRLGWKQDLKQLMSFN |
| Ga0187883_104413501 | 3300018037 | Peatland | MTGGFIERFFDCDLWVAGIGHFVILIASFQLPSRLR |
| Ga0187766_113751152 | 3300018058 | Tropical Peatland | MTVSLVTRFFDFDLWIMGVAHFVILIASFQVPFQLKWKTDLQLL |
| Ga0187773_108121342 | 3300018064 | Tropical Peatland | MTHAFAQRFFDLGLWLAGAGHFVVLIASFQVPFRLGWKQDLA |
| Ga0187771_103944043 | 3300018088 | Tropical Peatland | MRSPLAERLFDLDLWAAGAGHFLILFASFQVPSRLRW |
| Ga0193729_10085296 | 3300019887 | Soil | MTSASIERLFGLDLWLAGIGHFVILIASFQVPYRLN |
| Ga0210403_112945442 | 3300020580 | Soil | MTNSLAERFFDYDLWLVGAAHFVILFASFQVPYRLNWKMDLQQLMPF |
| Ga0210395_103634462 | 3300020582 | Soil | MTNSLVERFFDLDLWLAGAGHFVILIASSQVPSRLRW |
| Ga0210404_100770233 | 3300021088 | Soil | MNNSLTERVFDLALWLAGAGHFVILIASSQVPLRLQWKKDLA |
| Ga0210388_117102401 | 3300021181 | Soil | MNAAVAERLFDYDLWFAGAAHFVILFASFQVPYRLEWKKDLSQ |
| Ga0210397_102997571 | 3300021403 | Soil | MTHTLAQRCFNMILWVAGAGHFVILFASAQVPSRLRWKQDLAQVMPFNRK |
| Ga0210389_101066691 | 3300021404 | Soil | MTNAVVQRLFDIDLWLVGAAHFVILIASFQVPYRLGWKQDL |
| Ga0210389_102984001 | 3300021404 | Soil | MTQTLAERCFDFILWLAGAGHFVILFASAQVPSRLRWK |
| Ga0210387_102485503 | 3300021405 | Soil | MTHTLAFRFFDLALWVAGFGHFMILFASFQVPYRLEWARDLAQ |
| Ga0210387_118564682 | 3300021405 | Soil | MTKSFFDLDMWIAGLAHFVILCASFQVPYRLRWKED |
| Ga0210394_109060942 | 3300021420 | Soil | MITPFAQRLFDIDLWLVGLGHFAILIASFQVPSKLNWREDLRLLKP |
| Ga0210391_103511532 | 3300021433 | Soil | MTNALVQWLFDVDLWIVGVAHFLILFASFQVPYRLG |
| Ga0210391_113840711 | 3300021433 | Soil | MTPALVQLFDIDLWLVGAAHFVILFASFQVPYRLRWKQDL |
| Ga0210391_114395112 | 3300021433 | Soil | MNNSLVERTFGLALWLAGAGHFVILIASFQVPHRLQWKKDL |
| Ga0210390_103574493 | 3300021474 | Soil | MNSAMVLRVFDTDLWLAGAAHFVILFASFQVPYRLGWKQDLK |
| Ga0210398_108111572 | 3300021477 | Soil | MTHLSAERLFDLVLWLAGAGHFAILFASFQVPSRLH |
| Ga0210402_102826063 | 3300021478 | Soil | MTNFSAERWFDLVLWLAGAGHFVILAASFQVPSRLRWKRDLAQLM |
| Ga0210409_109593901 | 3300021559 | Soil | MTNSLASRFFDLDLWLAGAAHFVILIASFQVPARLRWK |
| Ga0126371_131032631 | 3300021560 | Tropical Forest Soil | MYESGARTMTNSLVERFFDVDLWLVGIGHFLALCASFQVPSRLGWKEDL |
| Ga0209171_103520622 | 3300025320 | Iron-Sulfur Acid Spring | MTNSFVERFFDLDLWLAGAGHFVILIASSQVPSRLR |
| Ga0208821_10310802 | 3300025432 | Peatland | MTNSLAERFFDFDLWLVGAAHFVILFASFQVPYRLGW |
| Ga0207663_100302771 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNSLAERCFDLILWLAGGGHFVILLASAQVPSRLRWKQD |
| Ga0207664_108791292 | 3300025929 | Agricultural Soil | MTKSFFDLDIWIAGLAHFVILCASFQVPYRLRWKEDLKSLMPLNR |
| Ga0207686_104638841 | 3300025934 | Miscanthus Rhizosphere | MRYERRMVERFFNIDLWLVGAAHFVILIASAQVPSRLRWREDLKSLMPFNR |
| Ga0209801_12010571 | 3300026326 | Soil | MTNSLAERFFDFDLWLVGGAHFVILFASFQVPYRLRWKQDLQQLMPF |
| Ga0209267_11006461 | 3300026331 | Soil | MNNSLAQRFFDLDLWLIGGAHFVILFASSQVPYRLGWKKDL |
| Ga0209803_11437891 | 3300026332 | Soil | MTNSLAERFFDFDLWLVGGAHFVILFASFQVPYRLRWKQDLQQ |
| Ga0208240_10061672 | 3300027030 | Forest Soil | MTHLPAERLFDLVLWLAGAGHFAILFASFQVPSRLHWK |
| Ga0207762_10394162 | 3300027063 | Tropical Forest Soil | MTTSLALRSFDWILWLAGAGHFVILLASAQVPSRLHWKQ |
| Ga0209733_10848562 | 3300027591 | Forest Soil | MTNALMQRLFDIDLWFVGAAHFLILFASFQVPYRLAWKRDLQQLMPFNRKL |
| Ga0209331_10880472 | 3300027603 | Forest Soil | MTDSLTQRLFGIDLWLVGAAHFVILFASFQVPYRLGWK |
| Ga0209420_11414392 | 3300027648 | Forest Soil | MTNSLAARFFDYDLWLVGAAHFVILIASFQVPYRLNWKM |
| Ga0209038_100114273 | 3300027737 | Bog Forest Soil | MTGSLIYRLFDLALWLAGAGHFVILFASFQVPGRLDWRG |
| Ga0209274_105324411 | 3300027853 | Soil | MTHLSAERLFDFILWLAGAGHFVILFASAQVPARLRWKEDLAQLMPFNR |
| Ga0209275_104277451 | 3300027884 | Soil | MTTSLALRLFDLDLWFVGAAHFLILFASFQVPYRLRWKEDLQQLMPF |
| Ga0209275_106176542 | 3300027884 | Soil | MTKSFFDLDMWIAGLAHFVILCASFQVPYRLRWKEDLK |
| Ga0209275_108810211 | 3300027884 | Soil | MTNALWQRLFDIDLWFAGAAHFVILFASFQVPYRLRWK |
| Ga0209380_106752091 | 3300027889 | Soil | MTNALVLRLFDIDLWFVGAAHFLILLASFQVPSRLGWKRDLQQLMPF |
| Ga0209624_103678802 | 3300027895 | Forest Soil | MTNALVERLFDIDLWFVGAAHFVILFASFQVPYRLRWKQDLEQLMPFN |
| Ga0302234_104076242 | 3300028773 | Palsa | MTNSLAERCFNLILWLAGAGHFAILFASFQVPSRLRWKEDLAQ |
| Ga0311361_114462201 | 3300029911 | Bog | MTNALVQRLFDIDLWLVGAAHFVILFASFQVPYRLDWKQDLQQL |
| Ga0302143_10495452 | 3300029918 | Bog | MTNALVQRLFDIDLWFVGAAHFLILFASFQVPYRLAWKRDLQQ |
| Ga0311353_113063532 | 3300030399 | Palsa | MTHTLAERFFDLDLWLAGTAHFVVLIASFQVPSRLRWKQDL |
| Ga0265762_10022045 | 3300030760 | Soil | MTDSLVQWLFGSDLWLAGAAHFVILFASFQVPYRLRWKQDLRQLMP |
| Ga0265770_10497812 | 3300030878 | Soil | MTSSFAERFFDYDLWLVGAAHFVILFASFQVPYRLNWKTDLQQLM |
| Ga0307474_101373153 | 3300031718 | Hardwood Forest Soil | MTNSLAERCFTLVLWLTGAGHFAILAASFQVPARLRWKQDLAQL |
| Ga0307477_108715032 | 3300031753 | Hardwood Forest Soil | MTNALVERLFDVDLWLAGAGHFVVLVASFQVPYRLAWKQDLQQLMP |
| Ga0307475_106323071 | 3300031754 | Hardwood Forest Soil | MTNSLVQQLFDIDLWLVGAAHFVILLASFQVPYRLGW |
| Ga0307473_111184551 | 3300031820 | Hardwood Forest Soil | MTKSLFDLDMWLAGLAHFVILCASFQVPYRLRWKEDL |
| Ga0307470_100264991 | 3300032174 | Hardwood Forest Soil | MPLTYRLFSLDLWLAGAGHFLILIASAQVPARLGWKE |
| Ga0307472_1016336572 | 3300032205 | Hardwood Forest Soil | MTNSLVQQLFDIDLWLVGAAHFVILFASFQVPYRLRWKQDLRQLMPFNR |
| Ga0306920_1043720662 | 3300032261 | Soil | MTNSLAERFFNIDLWVVGAAHFVILCASFQVPYRLRWKADLQQLLPFNR |
| Ga0335079_107771131 | 3300032783 | Soil | MTNSIAERFFDLDLWLAGTGHFVILAASFQLPYRLRW |
| Ga0335079_122051712 | 3300032783 | Soil | MTGSLAERFFDFDLWLVGAAHFVILCASFQVPYRLHWK |
| Ga0335078_103810833 | 3300032805 | Soil | MTNSLAERFFNIDLWVVGAAHFVILCASFQVPYRLRWKADLQQLMP |
| Ga0334854_008067_2473_2580 | 3300033829 | Soil | MVERLFGVDLWLAGAGHFVILIASSQVPSRLRWKQD |
| ⦗Top⦘ |