NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083182

Metagenome / Metatranscriptome Family F083182

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083182
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 41 residues
Representative Sequence MTNSLAERFFDFDLWLVGAAHFVILFASFQVPYRLRWTQD
Number of Associated Samples 102
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 53.10 %
% of genes near scaffold ends (potentially truncated) 99.12 %
% of genes from short scaffolds (< 2000 bps) 89.38 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.044 % of family members)
Environment Ontology (ENVO) Unclassified
(30.088 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.867 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.53%    β-sheet: 0.00%    Coil/Unstructured: 51.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13813MBOAT_2 88.50
PF04134DCC1-like 0.88
PF02911Formyl_trans_C 0.88
PF13302Acetyltransf_3 0.88
PF01435Peptidase_M48 0.88
PF13669Glyoxalase_4 0.88
PF03308MeaB 0.88
PF12867DinB_2 0.88
PF00892EamA 0.88
PF00753Lactamase_B 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0223Methionyl-tRNA formyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG3011Predicted thiol-disulfide oxidoreductase YuxK, DCC familyGeneral function prediction only [R] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001166|JGI12694J13545_1001452All Organisms → cellular organisms → Bacteria2903Open in IMG/M
3300001990|JGI24737J22298_10066216All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300004091|Ga0062387_100404386All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300004479|Ga0062595_100404537All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Schlesneria → Schlesneria paludicola980Open in IMG/M
3300005354|Ga0070675_100011903All Organisms → cellular organisms → Bacteria6817Open in IMG/M
3300005439|Ga0070711_100495689All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300005439|Ga0070711_102044223All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005538|Ga0070731_11133353All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005542|Ga0070732_10165454All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300005542|Ga0070732_10314978All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300005557|Ga0066704_10445046All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300005561|Ga0066699_10549492All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300005591|Ga0070761_10791715All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Schlesneria → Schlesneria paludicola596Open in IMG/M
3300005610|Ga0070763_10218760All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300005712|Ga0070764_10146815All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300005921|Ga0070766_11073919All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005993|Ga0080027_10330435All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006032|Ga0066696_10453774All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300006059|Ga0075017_100684980All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300006172|Ga0075018_10706458All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006903|Ga0075426_10030976All Organisms → cellular organisms → Bacteria3828Open in IMG/M
3300007265|Ga0099794_10793921All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009088|Ga0099830_11283729All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009089|Ga0099828_10380845All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300009143|Ga0099792_10251538All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300009174|Ga0105241_10512660All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300009634|Ga0116124_1172722All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300009636|Ga0116112_1015317All Organisms → cellular organisms → Bacteria2775Open in IMG/M
3300009672|Ga0116215_1367837All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300010043|Ga0126380_10208393All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300010321|Ga0134067_10480378All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300010336|Ga0134071_10217731All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300010343|Ga0074044_10675089All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300010371|Ga0134125_10750799All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300010401|Ga0134121_12130708All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300012199|Ga0137383_10293614All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300012210|Ga0137378_10589436All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300012359|Ga0137385_11045492All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300012362|Ga0137361_10775636All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300012582|Ga0137358_10918651All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300012685|Ga0137397_10727432All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300012925|Ga0137419_10105756All Organisms → cellular organisms → Bacteria1957Open in IMG/M
3300012944|Ga0137410_10529449All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300012984|Ga0164309_11610774All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300015262|Ga0182007_10010878All Organisms → cellular organisms → Bacteria3570Open in IMG/M
3300016371|Ga0182034_12045826All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300017948|Ga0187847_10668307All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300017995|Ga0187816_10243962All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300017995|Ga0187816_10292755All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300018001|Ga0187815_10192865All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300018006|Ga0187804_10557955All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300018006|Ga0187804_10585354All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300018007|Ga0187805_10353176All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300018037|Ga0187883_10441350All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300018058|Ga0187766_11375115All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300018064|Ga0187773_10812134All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300018088|Ga0187771_10394404All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300019887|Ga0193729_1008529All Organisms → cellular organisms → Bacteria → Acidobacteria4716Open in IMG/M
3300020580|Ga0210403_11294544All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300020582|Ga0210395_10363446All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300021088|Ga0210404_10077023All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300021181|Ga0210388_11710240All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300021403|Ga0210397_10299757All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300021404|Ga0210389_10106669All Organisms → cellular organisms → Bacteria2160Open in IMG/M
3300021404|Ga0210389_10298400All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300021405|Ga0210387_10248550All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1555Open in IMG/M
3300021405|Ga0210387_11856468All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300021420|Ga0210394_10906094All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300021433|Ga0210391_10351153All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300021433|Ga0210391_11384071All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300021433|Ga0210391_11439511All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300021474|Ga0210390_10357449All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300021477|Ga0210398_10811157All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300021478|Ga0210402_10282606All Organisms → cellular organisms → Bacteria1535Open in IMG/M
3300021559|Ga0210409_10959390All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300021560|Ga0126371_13103263All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300025320|Ga0209171_10352062All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300025432|Ga0208821_1031080All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300025916|Ga0207663_10030277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3191Open in IMG/M
3300025929|Ga0207664_10879129All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300025934|Ga0207686_10463884All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300026326|Ga0209801_1201057All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300026331|Ga0209267_1100646All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300026332|Ga0209803_1143789All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300027030|Ga0208240_1006167All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300027063|Ga0207762_1039416All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300027591|Ga0209733_1084856All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300027603|Ga0209331_1088047All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300027648|Ga0209420_1141439All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300027737|Ga0209038_10011427All Organisms → cellular organisms → Bacteria2610Open in IMG/M
3300027853|Ga0209274_10532441All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300027884|Ga0209275_10427745All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300027884|Ga0209275_10617654All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300027884|Ga0209275_10881021All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300027889|Ga0209380_10675209All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300027895|Ga0209624_10367880All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300028773|Ga0302234_10407624All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300029911|Ga0311361_11446220All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300029918|Ga0302143_1049545All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300030399|Ga0311353_11306353All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300030760|Ga0265762_1002204All Organisms → cellular organisms → Bacteria3527Open in IMG/M
3300030878|Ga0265770_1049781All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300031718|Ga0307474_10137315All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300031753|Ga0307477_10871503All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300031754|Ga0307475_10632307All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300031820|Ga0307473_11118455All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300032174|Ga0307470_10026499All Organisms → cellular organisms → Bacteria2698Open in IMG/M
3300032205|Ga0307472_101633657All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300032261|Ga0306920_104372066All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300032783|Ga0335079_10777113All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300032783|Ga0335079_12205171All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300032805|Ga0335078_10381083All Organisms → cellular organisms → Bacteria1860Open in IMG/M
3300033829|Ga0334854_008067All Organisms → cellular organisms → Bacteria → Acidobacteria2580Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.04%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.31%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.31%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.54%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.77%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.77%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001166Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2EnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027030Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12694J13545_100145263300001166Forest SoilMTNALVQRLFDIDLWFVGAAHFLILFASFQVPYRLA
JGI24737J22298_1006621623300001990Corn RhizosphereMRYERRMVERFFNIDLWLVGAAHFVILIASAQVPSRLRWREDLKS
Ga0062387_10040438623300004091Bog Forest SoilMTQTLAERCFDLVLWLAGAGHFVILIASAQVPSRLRWKQD
Ga0062595_10040453713300004479SoilMTNSLAQRLFDLDLWLVGAGHFAILFASFQVPFRLNWKQDLKLLM
Ga0070675_10001190383300005354Miscanthus RhizosphereMRYERRMVERFFNIDLWLVGAAHFVILIASAQVPSRLRWRE
Ga0070711_10049568913300005439Corn, Switchgrass And Miscanthus RhizosphereMTNSLAQRFFDIDLWLVGAAHFVILLASFQVPYRLGWKQDLRQL
Ga0070711_10204422323300005439Corn, Switchgrass And Miscanthus RhizosphereMTNTLANRCFDLILWLAGTGHFMILVASFQVPSRLRWKEDLAQL
Ga0070731_1113335313300005538Surface SoilMTKSFFDLDMWIAGLAHFVILCASFQVPYRLRWKEDL
Ga0070732_1016545423300005542Surface SoilMTQLERFFDLTLWLAGAGHFVILFASFQVPSRLRWKQDL
Ga0070732_1031497813300005542Surface SoilMTNYSAEHFFDLALWLAGLGHFVILIASFQVPSRLRWKEDL
Ga0066704_1044504613300005557SoilMTNSLAERFFDFDLWLVGGAHFVILFASFQVPYRLRW
Ga0066699_1054949213300005561SoilMTNSLAERFFDFDLWLVGAAHFVILFASFQVPYRLRWTQD
Ga0070761_1079171513300005591SoilMTHLSAERLFDFILWLAGAGHFVILFASAQVPARLRWKEDLAQLM
Ga0070763_1021876023300005610SoilMSNSFLQQCFNLDLWLAGAGHFVILIASSQVPSRLRWKQDLA
Ga0070764_1014681533300005712SoilMTHALVERLFDIDLWFVGAAHFVILFASFQVPYRL
Ga0070766_1107391923300005921SoilMTNALVLRLFDIDLWFVGAAHFLILLASFQVPSRLGWKRDLQQ
Ga0080027_1033043523300005993Prmafrost SoilMNNFSAERFFDLILWLAGAGHFVILAASFQVPARLRWKEDLAQ
Ga0066696_1045377413300006032SoilMTNSLAERFFDFELWLVGGAHFVILFASFQVPYRLGWKQDL
Ga0075017_10068498023300006059WatershedsMTQLDRFFDITLWLAGAGHFVILFASFQVPSRLRWKQD
Ga0075018_1070645823300006172WatershedsMNNSIAERLFDFAMWAAGAGHFVILVASFQVPFRLRWKEDLAQL
Ga0075426_1003097643300006903Populus RhizosphereMTGSLAWRFFDLDLWLVGAAHFVILCVSFQVPYRLRWKQ
Ga0099794_1079392113300007265Vadose Zone SoilMSNPLMSNAVVERFFDLDIWLAGAGHFLILFASFQVPSRLKWRQDLAQ
Ga0099830_1128372923300009088Vadose Zone SoilMSNALAQRFFDIDLWLVGAAHFVILIASFQVPYRLGWKQDLRQLMP
Ga0099828_1038084513300009089Vadose Zone SoilMTNSLAERFFDFDLWLVGAAHFVILFASFQVPYRL
Ga0099792_1025153823300009143Vadose Zone SoilMTNSLAQRFFDIDLWLVGAAHFVILIASFQVPYRLGWKQ
Ga0105241_1051266023300009174Corn RhizosphereMRYERRMVERFFNIDLWVVGAAHFVILIASAQVPSRLRWREDLKSLMPFNR
Ga0116124_117272223300009634PeatlandMTNALVQRLFDIDLWLVGAAHFVILFASFQVPYRLDWKQD
Ga0116112_101531713300009636PeatlandMTNSLTERFFDIDLWLVGAAHFVILFASFQVPYRLGW
Ga0116215_136783723300009672Peatlands SoilMTNSLALRCFDLILWLAGAGHFVILFASFQVPSRLRWKQDLAQLMPF
Ga0126380_1020839313300010043Tropical Forest SoilMNHPVVQKLFALDLWLAGAAHFVILFASFQVPHRLSWKRDL
Ga0134067_1048037813300010321Grasslands SoilMTNSLAERFFDFELWLVGGAHFVILFASFQVPYRMRWKQDLQQLM
Ga0134071_1021773123300010336Grasslands SoilMTDSLIERFFDMDLWLVGYGHFAILFASFQVPYRLNWKQDL
Ga0074044_1067508923300010343Bog Forest SoilMTQSLAYRFFDVALWLAGVGHFVILFASFQVPLRLNWKQ
Ga0134125_1075079913300010371Terrestrial SoilMNNAIAELFFDYDLWFAGAAHFAILFASLQVPYRLA
Ga0134121_1213070813300010401Terrestrial SoilMTSTGAERLFDYVLWFCGAAHFVILFASFQVPYRLGWREDLKKLMP
Ga0137383_1029361423300012199Vadose Zone SoilMTRPLVQRLFDIDLWLVGAAHFVILFASFQVPYRLSWK
Ga0137378_1058943623300012210Vadose Zone SoilMNNALVERLFDIDLWLAGAGHFIILIASSQVPGRLRW
Ga0137385_1104549213300012359Vadose Zone SoilMTSSLVKQFFDIDLWLVGAGHFAILIASFQVPSRLQWKQDLQSL
Ga0137361_1077563613300012362Vadose Zone SoilMTNSLVQRLFDIDLWFVGAAHFVILFASFQVPYRLGWKQDLQQLLPFNRKL
Ga0137358_1091865113300012582Vadose Zone SoilMTSSLAQRFLDLDLWLVGAGHFVILFASFQVPYRLHWKQDLQSL
Ga0137397_1072743223300012685Vadose Zone SoilMTDSFAQRLFGIDLWLVGAAHFVILFASFQVPYRLGWKQ
Ga0137419_1010575613300012925Vadose Zone SoilMTNSLVQQLFDIDLWLVGAAHLVILFASFQVPYRL
Ga0137410_1052944913300012944Vadose Zone SoilMTNALAERCFDLFLWLAGAGHFVILAASFQVPSRLRWKQD
Ga0164309_1161077423300012984SoilMMTAEWHRFFDLDLWLAGAGHFIILFASFQVPYRLGWK
Ga0182007_1001087813300015262RhizosphereMTSWERFFDLDLWFAGLTHFVILVASFQVPYRLRWKED
Ga0182034_1204582613300016371SoilMTNSLAERFFNIDLWVVGAAHFVILCASFQVPYRLRWKADLQQLL
Ga0187847_1066830713300017948PeatlandMVERLFNLDLWLAGAGHFVILIASSQVPSRLRWKQDLA
Ga0187816_1024396223300017995Freshwater SedimentMTNTLLQRLFDIDLWFAGAAHFVILFASFQVPYRLGWKQDLRQL
Ga0187816_1029275513300017995Freshwater SedimentMTDSLAQRFFDIDLWFVGAAHFVILFASFQVPYRLR
Ga0187815_1019286513300018001Freshwater SedimentMTSQFIREFFDLDLWFVGVGHFLILFASFQVPYHLRWKQDLQSLIPLN
Ga0187804_1055795513300018006Freshwater SedimentMTNSLAQRLFNIDLWFVGAAHFVILVASFQVPYRLGWKHD
Ga0187804_1058535413300018006Freshwater SedimentMTISLAERSFDLILWLAGAAHFVILAASFQVPSRLRW
Ga0187805_1035317613300018007Freshwater SedimentMTNSLTERFFDFDLWLVGAVHFVILFASFQVPYRLGWKQDLKQLMSFN
Ga0187883_1044135013300018037PeatlandMTGGFIERFFDCDLWVAGIGHFVILIASFQLPSRLR
Ga0187766_1137511523300018058Tropical PeatlandMTVSLVTRFFDFDLWIMGVAHFVILIASFQVPFQLKWKTDLQLL
Ga0187773_1081213423300018064Tropical PeatlandMTHAFAQRFFDLGLWLAGAGHFVVLIASFQVPFRLGWKQDLA
Ga0187771_1039440433300018088Tropical PeatlandMRSPLAERLFDLDLWAAGAGHFLILFASFQVPSRLRW
Ga0193729_100852963300019887SoilMTSASIERLFGLDLWLAGIGHFVILIASFQVPYRLN
Ga0210403_1129454423300020580SoilMTNSLAERFFDYDLWLVGAAHFVILFASFQVPYRLNWKMDLQQLMPF
Ga0210395_1036344623300020582SoilMTNSLVERFFDLDLWLAGAGHFVILIASSQVPSRLRW
Ga0210404_1007702333300021088SoilMNNSLTERVFDLALWLAGAGHFVILIASSQVPLRLQWKKDLA
Ga0210388_1171024013300021181SoilMNAAVAERLFDYDLWFAGAAHFVILFASFQVPYRLEWKKDLSQ
Ga0210397_1029975713300021403SoilMTHTLAQRCFNMILWVAGAGHFVILFASAQVPSRLRWKQDLAQVMPFNRK
Ga0210389_1010666913300021404SoilMTNAVVQRLFDIDLWLVGAAHFVILIASFQVPYRLGWKQDL
Ga0210389_1029840013300021404SoilMTQTLAERCFDFILWLAGAGHFVILFASAQVPSRLRWK
Ga0210387_1024855033300021405SoilMTHTLAFRFFDLALWVAGFGHFMILFASFQVPYRLEWARDLAQ
Ga0210387_1185646823300021405SoilMTKSFFDLDMWIAGLAHFVILCASFQVPYRLRWKED
Ga0210394_1090609423300021420SoilMITPFAQRLFDIDLWLVGLGHFAILIASFQVPSKLNWREDLRLLKP
Ga0210391_1035115323300021433SoilMTNALVQWLFDVDLWIVGVAHFLILFASFQVPYRLG
Ga0210391_1138407113300021433SoilMTPALVQLFDIDLWLVGAAHFVILFASFQVPYRLRWKQDL
Ga0210391_1143951123300021433SoilMNNSLVERTFGLALWLAGAGHFVILIASFQVPHRLQWKKDL
Ga0210390_1035744933300021474SoilMNSAMVLRVFDTDLWLAGAAHFVILFASFQVPYRLGWKQDLK
Ga0210398_1081115723300021477SoilMTHLSAERLFDLVLWLAGAGHFAILFASFQVPSRLH
Ga0210402_1028260633300021478SoilMTNFSAERWFDLVLWLAGAGHFVILAASFQVPSRLRWKRDLAQLM
Ga0210409_1095939013300021559SoilMTNSLASRFFDLDLWLAGAAHFVILIASFQVPARLRWK
Ga0126371_1310326313300021560Tropical Forest SoilMYESGARTMTNSLVERFFDVDLWLVGIGHFLALCASFQVPSRLGWKEDL
Ga0209171_1035206223300025320Iron-Sulfur Acid SpringMTNSFVERFFDLDLWLAGAGHFVILIASSQVPSRLR
Ga0208821_103108023300025432PeatlandMTNSLAERFFDFDLWLVGAAHFVILFASFQVPYRLGW
Ga0207663_1003027713300025916Corn, Switchgrass And Miscanthus RhizosphereMTNSLAERCFDLILWLAGGGHFVILLASAQVPSRLRWKQD
Ga0207664_1087912923300025929Agricultural SoilMTKSFFDLDIWIAGLAHFVILCASFQVPYRLRWKEDLKSLMPLNR
Ga0207686_1046388413300025934Miscanthus RhizosphereMRYERRMVERFFNIDLWLVGAAHFVILIASAQVPSRLRWREDLKSLMPFNR
Ga0209801_120105713300026326SoilMTNSLAERFFDFDLWLVGGAHFVILFASFQVPYRLRWKQDLQQLMPF
Ga0209267_110064613300026331SoilMNNSLAQRFFDLDLWLIGGAHFVILFASSQVPYRLGWKKDL
Ga0209803_114378913300026332SoilMTNSLAERFFDFDLWLVGGAHFVILFASFQVPYRLRWKQDLQQ
Ga0208240_100616723300027030Forest SoilMTHLPAERLFDLVLWLAGAGHFAILFASFQVPSRLHWK
Ga0207762_103941623300027063Tropical Forest SoilMTTSLALRSFDWILWLAGAGHFVILLASAQVPSRLHWKQ
Ga0209733_108485623300027591Forest SoilMTNALMQRLFDIDLWFVGAAHFLILFASFQVPYRLAWKRDLQQLMPFNRKL
Ga0209331_108804723300027603Forest SoilMTDSLTQRLFGIDLWLVGAAHFVILFASFQVPYRLGWK
Ga0209420_114143923300027648Forest SoilMTNSLAARFFDYDLWLVGAAHFVILIASFQVPYRLNWKM
Ga0209038_1001142733300027737Bog Forest SoilMTGSLIYRLFDLALWLAGAGHFVILFASFQVPGRLDWRG
Ga0209274_1053244113300027853SoilMTHLSAERLFDFILWLAGAGHFVILFASAQVPARLRWKEDLAQLMPFNR
Ga0209275_1042774513300027884SoilMTTSLALRLFDLDLWFVGAAHFLILFASFQVPYRLRWKEDLQQLMPF
Ga0209275_1061765423300027884SoilMTKSFFDLDMWIAGLAHFVILCASFQVPYRLRWKEDLK
Ga0209275_1088102113300027884SoilMTNALWQRLFDIDLWFAGAAHFVILFASFQVPYRLRWK
Ga0209380_1067520913300027889SoilMTNALVLRLFDIDLWFVGAAHFLILLASFQVPSRLGWKRDLQQLMPF
Ga0209624_1036788023300027895Forest SoilMTNALVERLFDIDLWFVGAAHFVILFASFQVPYRLRWKQDLEQLMPFN
Ga0302234_1040762423300028773PalsaMTNSLAERCFNLILWLAGAGHFAILFASFQVPSRLRWKEDLAQ
Ga0311361_1144622013300029911BogMTNALVQRLFDIDLWLVGAAHFVILFASFQVPYRLDWKQDLQQL
Ga0302143_104954523300029918BogMTNALVQRLFDIDLWFVGAAHFLILFASFQVPYRLAWKRDLQQ
Ga0311353_1130635323300030399PalsaMTHTLAERFFDLDLWLAGTAHFVVLIASFQVPSRLRWKQDL
Ga0265762_100220453300030760SoilMTDSLVQWLFGSDLWLAGAAHFVILFASFQVPYRLRWKQDLRQLMP
Ga0265770_104978123300030878SoilMTSSFAERFFDYDLWLVGAAHFVILFASFQVPYRLNWKTDLQQLM
Ga0307474_1013731533300031718Hardwood Forest SoilMTNSLAERCFTLVLWLTGAGHFAILAASFQVPARLRWKQDLAQL
Ga0307477_1087150323300031753Hardwood Forest SoilMTNALVERLFDVDLWLAGAGHFVVLVASFQVPYRLAWKQDLQQLMP
Ga0307475_1063230713300031754Hardwood Forest SoilMTNSLVQQLFDIDLWLVGAAHFVILLASFQVPYRLGW
Ga0307473_1111845513300031820Hardwood Forest SoilMTKSLFDLDMWLAGLAHFVILCASFQVPYRLRWKEDL
Ga0307470_1002649913300032174Hardwood Forest SoilMPLTYRLFSLDLWLAGAGHFLILIASAQVPARLGWKE
Ga0307472_10163365723300032205Hardwood Forest SoilMTNSLVQQLFDIDLWLVGAAHFVILFASFQVPYRLRWKQDLRQLMPFNR
Ga0306920_10437206623300032261SoilMTNSLAERFFNIDLWVVGAAHFVILCASFQVPYRLRWKADLQQLLPFNR
Ga0335079_1077711313300032783SoilMTNSIAERFFDLDLWLAGTGHFVILAASFQLPYRLRW
Ga0335079_1220517123300032783SoilMTGSLAERFFDFDLWLVGAAHFVILCASFQVPYRLHWK
Ga0335078_1038108333300032805SoilMTNSLAERFFNIDLWVVGAAHFVILCASFQVPYRLRWKADLQQLMP
Ga0334854_008067_2473_25803300033829SoilMVERLFGVDLWLAGAGHFVILIASSQVPSRLRWKQD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.