| Basic Information | |
|---|---|
| Family ID | F083173 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRKVLWATLFVVMLLSALPSYAQSPNYDVGPVWRVTYYHIKPGQGE |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.18 % |
| % of genes near scaffold ends (potentially truncated) | 95.58 % |
| % of genes from short scaffolds (< 2000 bps) | 82.30 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.646 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.584 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.319 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.947 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 28.38% β-sheet: 0.00% Coil/Unstructured: 71.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF14520 | HHH_5 | 5.31 |
| PF00069 | Pkinase | 4.42 |
| PF00155 | Aminotran_1_2 | 3.54 |
| PF00266 | Aminotran_5 | 3.54 |
| PF00106 | adh_short | 1.77 |
| PF12728 | HTH_17 | 1.77 |
| PF12826 | HHH_2 | 1.77 |
| PF07883 | Cupin_2 | 1.77 |
| PF12710 | HAD | 1.77 |
| PF00313 | CSD | 0.88 |
| PF02895 | H-kinase_dim | 0.88 |
| PF00930 | DPPIV_N | 0.88 |
| PF03713 | DUF305 | 0.88 |
| PF13229 | Beta_helix | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF10282 | Lactonase | 0.88 |
| PF13683 | rve_3 | 0.88 |
| PF04366 | Ysc84 | 0.88 |
| PF00575 | S1 | 0.88 |
| PF01969 | Ni_insertion | 0.88 |
| PF05724 | TPMT | 0.88 |
| PF00455 | DeoRC | 0.88 |
| PF07969 | Amidohydro_3 | 0.88 |
| PF03992 | ABM | 0.88 |
| PF15919 | HicB_lk_antitox | 0.88 |
| PF02618 | YceG | 0.88 |
| PF01041 | DegT_DnrJ_EryC1 | 0.88 |
| PF00793 | DAHP_synth_1 | 0.88 |
| PF00400 | WD40 | 0.88 |
| PF14417 | MEDS | 0.88 |
| PF03795 | YCII | 0.88 |
| PF00773 | RNB | 0.88 |
| PF16697 | Yop-YscD_cpl | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 17.70 |
| COG0643 | Chemotaxis protein histidine kinase CheA | Signal transduction mechanisms [T] | 1.77 |
| COG1349 | DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family | Transcription [K] | 1.77 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.88 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.88 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.88 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.88 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.88 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG1641 | CTP-dependent cyclometallase, nickel-pincer nucleotide (NPN) cofactor biosynthesis | Coenzyme transport and metabolism [H] | 0.88 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.88 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.88 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.88 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.88 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.88 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.88 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.88 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.53 % |
| Unclassified | root | N/A | 19.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918008|ConsensusfromContig50149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 648 | Open in IMG/M |
| 3300001356|JGI12269J14319_10046287 | Not Available | 2652 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1072572 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300003372|JGI26336J50218_1009356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 671 | Open in IMG/M |
| 3300004080|Ga0062385_10604927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 694 | Open in IMG/M |
| 3300004082|Ga0062384_101210796 | Not Available | 549 | Open in IMG/M |
| 3300004092|Ga0062389_100607802 | Not Available | 1258 | Open in IMG/M |
| 3300004092|Ga0062389_102276015 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300004092|Ga0062389_103755681 | Not Available | 570 | Open in IMG/M |
| 3300004267|Ga0066396_10094346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 545 | Open in IMG/M |
| 3300005167|Ga0066672_10386237 | Not Available | 916 | Open in IMG/M |
| 3300005439|Ga0070711_101991075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 511 | Open in IMG/M |
| 3300005602|Ga0070762_10689549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300005610|Ga0070763_10512194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 687 | Open in IMG/M |
| 3300005921|Ga0070766_10852436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 622 | Open in IMG/M |
| 3300005995|Ga0066790_10472058 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006173|Ga0070716_100105282 | Not Available | 1738 | Open in IMG/M |
| 3300006176|Ga0070765_101169590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300006176|Ga0070765_101801299 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006176|Ga0070765_101863906 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_54_9 | 564 | Open in IMG/M |
| 3300006176|Ga0070765_101964446 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006893|Ga0073928_10368353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300009520|Ga0116214_1039844 | Not Available | 1699 | Open in IMG/M |
| 3300009628|Ga0116125_1022272 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300009630|Ga0116114_1084403 | Not Available | 858 | Open in IMG/M |
| 3300009700|Ga0116217_10528400 | Not Available | 739 | Open in IMG/M |
| 3300009792|Ga0126374_10260196 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300010339|Ga0074046_10562837 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300010341|Ga0074045_10880251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 565 | Open in IMG/M |
| 3300010366|Ga0126379_13574354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 521 | Open in IMG/M |
| 3300011271|Ga0137393_10379482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
| 3300013297|Ga0157378_12623933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 556 | Open in IMG/M |
| 3300014638|Ga0181536_10462897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 557 | Open in IMG/M |
| 3300015374|Ga0132255_106211826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 506 | Open in IMG/M |
| 3300016294|Ga0182041_10685804 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300016387|Ga0182040_10391123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1088 | Open in IMG/M |
| 3300016387|Ga0182040_10755514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300016404|Ga0182037_10421629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
| 3300016750|Ga0181505_10385112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
| 3300016750|Ga0181505_11134848 | Not Available | 1507 | Open in IMG/M |
| 3300017959|Ga0187779_10223755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1184 | Open in IMG/M |
| 3300017970|Ga0187783_10130973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1850 | Open in IMG/M |
| 3300017970|Ga0187783_10750470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 704 | Open in IMG/M |
| 3300017995|Ga0187816_10021345 | All Organisms → cellular organisms → Bacteria | 2547 | Open in IMG/M |
| 3300017995|Ga0187816_10535530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300018006|Ga0187804_10589207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 505 | Open in IMG/M |
| 3300018034|Ga0187863_10066485 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300018040|Ga0187862_10041627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 3391 | Open in IMG/M |
| 3300018042|Ga0187871_10312803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13 | 869 | Open in IMG/M |
| 3300018042|Ga0187871_10424860 | Not Available | 734 | Open in IMG/M |
| 3300018057|Ga0187858_10468159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13 | 774 | Open in IMG/M |
| 3300018062|Ga0187784_11072085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 640 | Open in IMG/M |
| 3300018085|Ga0187772_10542450 | Not Available | 823 | Open in IMG/M |
| 3300018086|Ga0187769_10035954 | All Organisms → cellular organisms → Bacteria | 3389 | Open in IMG/M |
| 3300019787|Ga0182031_1283893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2357 | Open in IMG/M |
| 3300019787|Ga0182031_1516870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2367 | Open in IMG/M |
| 3300020581|Ga0210399_10143699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1970 | Open in IMG/M |
| 3300020581|Ga0210399_11135800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300020583|Ga0210401_10171819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 2022 | Open in IMG/M |
| 3300020583|Ga0210401_10912142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300020583|Ga0210401_11506447 | Not Available | 530 | Open in IMG/M |
| 3300021168|Ga0210406_11158132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300021168|Ga0210406_11186787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 556 | Open in IMG/M |
| 3300021171|Ga0210405_10980299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 638 | Open in IMG/M |
| 3300021178|Ga0210408_11004248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 645 | Open in IMG/M |
| 3300021181|Ga0210388_10224506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1646 | Open in IMG/M |
| 3300021405|Ga0210387_10720729 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300021407|Ga0210383_10707847 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300021433|Ga0210391_11383204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 541 | Open in IMG/M |
| 3300021474|Ga0210390_10724792 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300021559|Ga0210409_11566525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 535 | Open in IMG/M |
| 3300021560|Ga0126371_10834615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300022521|Ga0224541_1004309 | Not Available | 1515 | Open in IMG/M |
| 3300023259|Ga0224551_1058648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300025441|Ga0208456_1044274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300025500|Ga0208686_1103447 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300025944|Ga0207661_11908341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 540 | Open in IMG/M |
| 3300026557|Ga0179587_10663022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 687 | Open in IMG/M |
| 3300027591|Ga0209733_1013957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2143 | Open in IMG/M |
| 3300027676|Ga0209333_1079974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300027812|Ga0209656_10007832 | All Organisms → cellular organisms → Bacteria | 6840 | Open in IMG/M |
| 3300028906|Ga0308309_11810468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 516 | Open in IMG/M |
| 3300029636|Ga0222749_10097168 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300029951|Ga0311371_11164511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13 | 895 | Open in IMG/M |
| 3300029999|Ga0311339_10098590 | All Organisms → cellular organisms → Bacteria | 3619 | Open in IMG/M |
| 3300030399|Ga0311353_11445532 | Not Available | 559 | Open in IMG/M |
| 3300030646|Ga0302316_10013555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4381 | Open in IMG/M |
| 3300030659|Ga0316363_10233942 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031525|Ga0302326_10220471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 3134 | Open in IMG/M |
| 3300031525|Ga0302326_13004619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 576 | Open in IMG/M |
| 3300031715|Ga0307476_10562015 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031720|Ga0307469_12537690 | Not Available | 501 | Open in IMG/M |
| 3300031744|Ga0306918_10686864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 801 | Open in IMG/M |
| 3300031753|Ga0307477_10003143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12408 | Open in IMG/M |
| 3300031754|Ga0307475_10563537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 913 | Open in IMG/M |
| 3300031796|Ga0318576_10623405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 508 | Open in IMG/M |
| 3300031879|Ga0306919_10589611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300031879|Ga0306919_10942113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 661 | Open in IMG/M |
| 3300031879|Ga0306919_11380528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 532 | Open in IMG/M |
| 3300031912|Ga0306921_10976149 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031941|Ga0310912_10158743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
| 3300031942|Ga0310916_11735420 | Not Available | 504 | Open in IMG/M |
| 3300031947|Ga0310909_10476627 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300031962|Ga0307479_10507146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1190 | Open in IMG/M |
| 3300032160|Ga0311301_10916069 | Not Available | 1177 | Open in IMG/M |
| 3300032180|Ga0307471_103126700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 587 | Open in IMG/M |
| 3300033289|Ga0310914_10085003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2692 | Open in IMG/M |
| 3300033402|Ga0326728_10542873 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300033561|Ga0371490_1003548 | Not Available | 6754 | Open in IMG/M |
| 3300033755|Ga0371489_0070442 | All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Chitinivibrionia → Chitinivibrionales → Chitinivibrionaceae → Chitinivibrio → Chitinivibrio alkaliphilus | 2185 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.19% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.19% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.31% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.77% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.77% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Bog_all_C_00381200 | 2140918008 | Soil | MKKVLWATLFVVTLLTALPAYAQSPNYDSGPVWRVVYYQIKPGQSEPFWKDF |
| JGI12269J14319_100462871 | 3300001356 | Peatlands Soil | MKKVLWATLFVVTLLTTLPALAQSPNYDYGPVWRVTYYEIKPGQGEPF |
| JGIcombinedJ26865_10725722 | 3300002347 | Arctic Peat Soil | MRKVLWITLFIATLLTALPALAQNPNYDSGAVWRVVYF |
| JGI26336J50218_10093563 | 3300003372 | Bog Forest Soil | MKKVLWATLLVLLLLFSLPSYAQNPNYDVGQVWRVTYYHI |
| Ga0062385_106049271 | 3300004080 | Bog Forest Soil | MKKVLWATLLVLLLLFSLPSYAQNPNYDVGQVWRVTYYHIKAGQGE |
| Ga0062384_1012107961 | 3300004082 | Bog Forest Soil | MRRVLWTCLLVVMLLSAFPSYAQSPNYDVGQVWRVTYYHIKPGQS |
| Ga0062389_1006078023 | 3300004092 | Bog Forest Soil | MRTVLRTTLLLAMLASALPCYAQSPNYDVGQVWRVTYYHIK |
| Ga0062389_1022760151 | 3300004092 | Bog Forest Soil | MRKVLWASLFVAILLSALPAHAQNPNYDVGPVWRVSYYHIK |
| Ga0062389_1037556812 | 3300004092 | Bog Forest Soil | MKKVLWAILLVLLLLFSLPGYAQNPNYDVGQVWRVTYYHIKAGQGEAFWKDLRE |
| Ga0066396_100943461 | 3300004267 | Tropical Forest Soil | MRKTLRATLFVVTLLTALPLYAQSPNYDVGPVWRVTYYHIKPGQNEAFWKDIR |
| Ga0066672_103862371 | 3300005167 | Soil | MRKVLWASLFVVTLLTALPTYAQNPNYDVGPVWRVVYYQIKPGQGEAF |
| Ga0070711_1019910751 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKVLLTMLSALTLLSALPAYSQNPNYDVGPVWRVTYYHLKSGQG |
| Ga0070761_103975592 | 3300005591 | Soil | MRKTLYATLFAVTLLAAFPVYAQNPNYDNGPIWRVTYYHIKPGQ |
| Ga0070762_106895492 | 3300005602 | Soil | MRKVLWAPLFVVMSFVVIVLSALPSYAQSPNFDVGPVWRVTYYHIKPGQGEAYWK |
| Ga0070763_105121941 | 3300005610 | Soil | MRKVLWVTLFVATLLAALPARAQNPNYDVGPVWRVTYYHIIPGQGEAFWKDF |
| Ga0070766_108524361 | 3300005921 | Soil | MRKLLWASLFITMLLSALPTFAQNPNYEVGPVWRVTYYHIKPGMGEAFWKD |
| Ga0066790_104720582 | 3300005995 | Soil | MRRVLWITLFIATLLTALPALAQNPNYDSGAVWRVVYFHV |
| Ga0070716_1001052822 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKALWAILFVATLLSALPSRAQNPNYDVGPVWRVTYFH |
| Ga0070765_1011695902 | 3300006176 | Soil | MKKSLLATLFVVMLLSALPTYAQNPNYDVGPVWRVTYYQLKPGQGEA |
| Ga0070765_1018012991 | 3300006176 | Soil | MRNVLWVSLLVAMLLSALPCRAQSPNYDVGQVWRVTYYRIKPGQGEAFWKDF |
| Ga0070765_1018639061 | 3300006176 | Soil | MRKALWATLFVAMLLTALPIYAQSPNYDVGPVWRVVY |
| Ga0070765_1019644461 | 3300006176 | Soil | MRIVLRTTLLLAMLASALPCFAQSPNYDVGQVWRVTYYHI |
| Ga0073928_103683532 | 3300006893 | Iron-Sulfur Acid Spring | MRNALWAPLLVAMLLSAIPSHAQSPNYDVGQVWRVTYYHIK |
| Ga0116214_10398444 | 3300009520 | Peatlands Soil | MRKVLWATLLVVTLLTALPAVAQSPNYDYGPVWRVTYYQ |
| Ga0116125_10222721 | 3300009628 | Peatland | MKKTLCATLFVVTLLCALPALAQNPNYDQGPIWRV |
| Ga0116114_10844032 | 3300009630 | Peatland | MRKVLWATLLVATLLTALPALAQNPNYDYGPVWRVTYYELKPGQ |
| Ga0116217_105284001 | 3300009700 | Peatlands Soil | MRKVLWTSLFVVMLLSALPSYAQNPNYDVGPVWRVTYYH |
| Ga0126374_102601962 | 3300009792 | Tropical Forest Soil | MRKILLAIPFAVILLTALPASAQNPNFDTGPVWRVTYYHL |
| Ga0074046_105628372 | 3300010339 | Bog Forest Soil | MRKVLWASLFVVMLLSALPSYAQSPNYNVGPVWRVTYYHLKPGQG |
| Ga0074045_108802511 | 3300010341 | Bog Forest Soil | MRKVLWATLFGLILLTALPISAQNPNYDVGPVWRVTYYHVKPGMGDAFWK |
| Ga0126378_121272601 | 3300010361 | Tropical Forest Soil | MRKALCVTLFLVTLFAAIPSFAQNPNYDNGPIWRVVYYHIKPGQAEPFWK |
| Ga0126379_135743541 | 3300010366 | Tropical Forest Soil | MSKVLRATLFVAMLLTAVPAFAQNPNYEVGPVWRVTYYYVKPGQS |
| Ga0137393_103794821 | 3300011271 | Vadose Zone Soil | MRKVLWASLFVVTLLTALPTYAQNPNYDVGPVWRV |
| Ga0157378_126239332 | 3300013297 | Miscanthus Rhizosphere | MRKVLLTMLSVLTSLTALPAYSQNPNYDVGPVWRVTYYHLKPGQGEAFW |
| Ga0181536_104628972 | 3300014638 | Bog | MRKVLWTTLLVVTLLTALPALAQSPNYDYGPVWRVTYYELKPG |
| Ga0132255_1062118261 | 3300015374 | Arabidopsis Rhizosphere | MRKILLAIPFAVILLTALPASSQNPNYDVGPVWRVTYYHLKPGQGEPFWKDF |
| Ga0182041_106858042 | 3300016294 | Soil | MKRLLWAFLLVLALSVALPTRAQNPNYDVGPVWRVTYYHIKPGQGEAF |
| Ga0182040_103911232 | 3300016387 | Soil | MKRLLWAFLLVLALSMALPTRAQNPNYDVGPVWRVTYYHIKPGQGEAFWK |
| Ga0182040_107555142 | 3300016387 | Soil | MKRLLSAALFVLTLSTAIPAYAQNPNYDVGPVWRVTYYHIKAGQGEAF |
| Ga0182037_104216292 | 3300016404 | Soil | MRKILWTSLFVAMFLTLLPAQAQNPNYDVGQVWRVNCYHIKPG |
| Ga0181505_103851122 | 3300016750 | Peatland | MRKVLWATLFVVMLLSALPSSAQNPNYDVGPVWRVTYYHIKPGQS |
| Ga0181505_111348482 | 3300016750 | Peatland | MRKVLWATLFVATLLTALPVYAQNPNYDYGPVWRVTY |
| Ga0187779_102237552 | 3300017959 | Tropical Peatland | MRKVLWVALLVAMLVTVLPSYAQSPNYDLGPVWRVTYYHIKP |
| Ga0187783_101309731 | 3300017970 | Tropical Peatland | MKKVLWITLFFAMLLTAFPAHAQNPNYDLGGVWIVNYYHLKSGQAD |
| Ga0187783_107504702 | 3300017970 | Tropical Peatland | MRRSLWAILFVVTLLTALPAKAQNPNYDVGPVWRVTYY |
| Ga0187816_100213457 | 3300017995 | Freshwater Sediment | MRKVLWATLFVVSLLTAVSSYAQNPNYSVGPVWRVTYYHI |
| Ga0187816_105355302 | 3300017995 | Freshwater Sediment | MRKSLWATLFVVMLLTALPTYAQNPNYDVGPVWRVVYYQIKPGQGEAFW |
| Ga0187804_105892072 | 3300018006 | Freshwater Sediment | MRKVLWATLFVVTLLTALPTYAQNPNYDVGTVWRVVYYQIKPGQGEAFWK |
| Ga0187863_100664851 | 3300018034 | Peatland | MKKTLWATLFVATLLTALPAYSQNPNYDYGPVWRVTYYELKPGQ |
| Ga0187862_100416275 | 3300018040 | Peatland | MRKVLWATLFVVMLLSALPSYAQSPNYDVGPVWRVTYYHIKPGQGE |
| Ga0187871_103128031 | 3300018042 | Peatland | MRKTLWATLFVATLLTTLPAYSQNPNYDNGPVWRVTYYELKPG |
| Ga0187871_104248601 | 3300018042 | Peatland | MRKILWACLPVVLLLSARAGYAQSPNYDVGQVWRVT |
| Ga0187858_104681592 | 3300018057 | Peatland | MRKTLCAVLFAVALLTALPVYAQNPNYDLGPVWRVTYYHLNPGQSEPGKIFVSM |
| Ga0187784_110720852 | 3300018062 | Tropical Peatland | MRRSLWAILFVVTLLTALPAKAQNPNYDVGPVWRVTYYHIKPGQG |
| Ga0187772_105424502 | 3300018085 | Tropical Peatland | MRKVLWATLFVVTLLTALPALAQSPNYDYGPVWRVTYYEIKPGQGEPFLK |
| Ga0187769_100359544 | 3300018086 | Tropical Peatland | MRKALWVTLFVATFLTALPAFAQNPNFDLGPVWRVTY |
| Ga0182031_12838932 | 3300019787 | Bog | MRKTLCAVLFAVALLTALPVYAQNPNYDLGPVWRVTYYHLNPGQSEPFWKDFVSM |
| Ga0182031_15168706 | 3300019787 | Bog | GNMRKTLCAVLFAVALLTALPVYAQNPNYDLGPVWRVTYYHLNPGQSDRSGKIFVSM |
| Ga0210399_101436991 | 3300020581 | Soil | MKKALSMFLFAATLLTAGAVFAQSPNYDVGPVWRV |
| Ga0210399_111358002 | 3300020581 | Soil | MRKVLWATLFVVMLLSALPSYAQSPNFDVGPVWRVT |
| Ga0210401_101718191 | 3300020583 | Soil | MRKLLWASLFVTMLLSALPTFAQNPNYEVGPVWRVTYYHIKPGMGEAFWK |
| Ga0210401_109121421 | 3300020583 | Soil | MKKVLWATLFVVMLLSALPAYAQSPNYDVGPVWRVSYYHIKPGQGEAYW |
| Ga0210401_115064471 | 3300020583 | Soil | MRNVLRTTLLLAMLVSALPCYAQSPNYDVGQVWRVTYYHV |
| Ga0210406_111581322 | 3300021168 | Soil | MRKVLWATLFVVMLLSALPCFAQNPNFDVGPVWRVS |
| Ga0210406_111867872 | 3300021168 | Soil | MRKLLWASLFVTMLLSALPTFAQNPNYEVGPVWRVTYYHIKPSMRRPVS |
| Ga0210405_109802991 | 3300021171 | Soil | MRKVLWATLFVVILLSALPSYAQNPNYDVGPVWRVSYYHIKPGQG |
| Ga0210408_110042481 | 3300021178 | Soil | MRNVLRTTLLLAMLVSALPCYAQSPNYDVGQVWRVTYYHVKPGQGEAFWKDI |
| Ga0210388_102245063 | 3300021181 | Soil | MRKLFWASLFAVMLLTALPMYAQSPNYDVGPVWRV |
| Ga0210387_107207292 | 3300021405 | Soil | MRIVLRTTLLLAMLASALPCFAQSPNYDVGQVWRVTYYHIKPGQA |
| Ga0210383_107078471 | 3300021407 | Soil | MRNALRTTLLLAMFVSALPCYAQSPNYDVGQVWRVTYYR |
| Ga0210391_113832041 | 3300021433 | Soil | MRNVLRTTLLLAMFVSALPCYAQSPNYDVGQVWRVTYYHIKPGQGEAFWKDVREN |
| Ga0210390_107247921 | 3300021474 | Soil | MRIVLRTTLLLAMFVSALPCYAQSPNYDVGQVWRVTYYHIKPGQ |
| Ga0210409_115665251 | 3300021559 | Soil | MKKVLCATLFVIMLLSALPTYAQSPNYDVGPVWRVSYYHIKPGQGEAY |
| Ga0126371_108346152 | 3300021560 | Tropical Forest Soil | MRRALWVILFVATLLTAFSTYAQSPNYEVGPVWRVTYVHIKPG |
| Ga0224541_10043092 | 3300022521 | Soil | MKRALCATLFAITLLAALPIYAQNPNYDNGPVWRVVYYSIKPGQAEPFWKD |
| Ga0224551_10586481 | 3300023259 | Soil | MRKVLWAILFAVTLLTALPAYSQNPNYDLGPVWRVTYYHIKPGQGDAFW |
| Ga0208456_10442742 | 3300025441 | Peatland | MRKVLWATLFVVMLLSALPSYAQSPNYDVGPVWRV |
| Ga0208686_11034473 | 3300025500 | Peatland | MRKVLFATLLVVTLLTALPALAQSPNYDYGPVWRVTYYELKP |
| Ga0207661_119083411 | 3300025944 | Corn Rhizosphere | MRKILLAIPIAAILLTGLPSSAQNPNYDVGPVWRVTYYHLKPGQGEPFWKD |
| Ga0179587_106630221 | 3300026557 | Vadose Zone Soil | MRKVLCAILFTATLLTALPARAQNPNYDVGQVWRVTYYHVKPGQGEAFW |
| Ga0209733_10139571 | 3300027591 | Forest Soil | MRKALWAALFVVMLLSALPSYAQSPNYDVGPVWRVTYYHI |
| Ga0209333_10799741 | 3300027676 | Forest Soil | MRNVLRATLFAVMFLAAVPNYAQNPNYDNGPIWRVTYYRIKPGQIESFWK |
| Ga0209656_1000783210 | 3300027812 | Bog Forest Soil | MRKVSWTTLFVVMLLTALPIHAQSPNYDVGPVWRVT |
| Ga0308309_118104681 | 3300028906 | Soil | MRTVLRTILLLAMLVPALPCHAQNPNYDVGPVWRVTYYHIKAGQ |
| Ga0222749_100971681 | 3300029636 | Soil | MRNVLRTTLLLAMLVSALPCYAQSPNYDVGQVWRVTYYHIKPGQGE |
| Ga0311340_104537081 | 3300029943 | Palsa | MKRALCATLFAVTLLAALPTFAQNPNYDTGPVWRVTD |
| Ga0311371_111645111 | 3300029951 | Palsa | MRKALWVTLFVATLLTALPAFAQSPNYDIGPVWRVIY |
| Ga0311339_100985904 | 3300029999 | Palsa | MRKALWATLFVVTLLTALPALAQNPNYDFGPVWRVTYYQLK |
| Ga0311353_114455321 | 3300030399 | Palsa | MREFLWACLSVVMLLSALPSYAQSPNYDVGQVWRVT |
| Ga0302316_100135555 | 3300030646 | Palsa | MKRILWATLFVVTLLTAVPAHAQSPNYDPGPVWRVTYYHIKPGQGEP |
| Ga0316363_102339422 | 3300030659 | Peatlands Soil | MRKALCATLFAITLLTALPVLAQNPNYDLGPVWRVTYYKLKPG |
| Ga0302326_102204713 | 3300031525 | Palsa | MRKALWATLFVVTLLTALPALAQNPNYDFGPVWRVTYYQLKPGQSEP |
| Ga0302326_130046191 | 3300031525 | Palsa | MRKTLGATLSVVTLLTALSTYAQSPNYDVGAVWRVTYYRIKPGQSEA |
| Ga0307476_105620152 | 3300031715 | Hardwood Forest Soil | MRIVLRTTLLLAMLASALPCFAQSPNYDVGQVWRVTYYHIKPGQAEAFWK |
| Ga0307469_125376901 | 3300031720 | Hardwood Forest Soil | MRKVLWAPLFPVMLFVVMLLSALPSYAQNPNYDVGP |
| Ga0306918_106868641 | 3300031744 | Soil | MRRALWVILFVATLLTAFSTFAQSPNYEVGPVWRVTYVHIKP |
| Ga0307477_100031438 | 3300031753 | Hardwood Forest Soil | MRKALWATLFVVMLLAALPIYSQSPNYDVGPVWRVTYYHIK |
| Ga0307475_105635372 | 3300031754 | Hardwood Forest Soil | MRKALWAILFVATLVSTLPSRAQNPNYDSGPVWRVTYYHLKPGQGESFWKDFR |
| Ga0318576_106234052 | 3300031796 | Soil | MRTTLWVTLFVVTLLTAASTYAQSPNYDVGPVWRVTYLH |
| Ga0306919_105896112 | 3300031879 | Soil | MRKALWAILFVATLLTALPSRAQNPNYDVGPVWRVTYFHLKPGQG |
| Ga0306919_109421131 | 3300031879 | Soil | MRRALWVILFVASLLTAFSTYAQSPNYEVGPVWRVTYVHIKPGQSEGFWKD |
| Ga0306919_113805282 | 3300031879 | Soil | MKRLLWAFLLVLALSVALPTRAQNPNYDVGPVWRVTYYHIKPGQGEAFW |
| Ga0306921_109761492 | 3300031912 | Soil | MRKVLLAIPLAVILLTALPASSQNPNFDVGPVWRVTYYHLKP |
| Ga0310912_101587431 | 3300031941 | Soil | MRRALWVILFVASLLTAFSTYAQSPNYEVGPVWRVT |
| Ga0310916_117354201 | 3300031942 | Soil | MRRALWVILFVASLLTAFSTYAQSPNYDVGPVWRVTY |
| Ga0310909_104766272 | 3300031947 | Soil | MKRLLWAFLLVLALSVALPTRAQNPNYDVGPVWRVTYYHIKPGQG |
| Ga0307479_105071461 | 3300031962 | Hardwood Forest Soil | MRKVLLGILFVVMLFCALPSYAQSPNYDVGPVWRVTYYHIKPGQGEAF |
| Ga0311301_109160692 | 3300032160 | Peatlands Soil | MRKALWATLFVATLLTALPVLAQSPNYDYGPVWRVTYFHIKP |
| Ga0307471_1031267002 | 3300032180 | Hardwood Forest Soil | MRKVLFGALFVVMLLSALPSYAQNPNYDVGPVWRVSYYHIKPGQGEA |
| Ga0310914_100850031 | 3300033289 | Soil | MRRALWVILFVASLLTAFSTYAQSPNYEVGPVWRVTYVHIKPGQSE |
| Ga0326728_105428731 | 3300033402 | Peat Soil | MRKVLWASLFVVMLLSALPMFAQSPNYDVGPVWRVTYYHIKSGQGEAFW |
| Ga0371490_10035487 | 3300033561 | Peat Soil | MRKVLWATLFVVMLLSALPMFAQSPNYDVGPVWRVTYYHIK |
| Ga0371489_0070442_2076_2183 | 3300033755 | Peat Soil | MRKVLWASLFVVMLFSALPSFAQNPNYDVGPVWRVT |
| ⦗Top⦘ |