Basic Information | |
---|---|
Family ID | F083154 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 42 residues |
Representative Sequence | DVNSDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDITLEGK |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.83 % |
% of genes near scaffold ends (potentially truncated) | 93.81 % |
% of genes from short scaffolds (< 2000 bps) | 84.96 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.841 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.850 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.239 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.903 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 37.14% Coil/Unstructured: 62.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF01964 | ThiC_Rad_SAM | 10.62 |
PF01734 | Patatin | 7.08 |
PF05649 | Peptidase_M13_N | 5.31 |
PF01850 | PIN | 4.42 |
PF01904 | DUF72 | 3.54 |
PF04014 | MazE_antitoxin | 3.54 |
PF02604 | PhdYeFM_antitox | 2.65 |
PF01431 | Peptidase_M13 | 2.65 |
PF02518 | HATPase_c | 2.65 |
PF13229 | Beta_helix | 1.77 |
PF02687 | FtsX | 1.77 |
PF12704 | MacB_PCD | 1.77 |
PF05016 | ParE_toxin | 1.77 |
PF13205 | Big_5 | 0.88 |
PF00326 | Peptidase_S9 | 0.88 |
PF01987 | AIM24 | 0.88 |
PF13596 | PAS_10 | 0.88 |
PF01914 | MarC | 0.88 |
PF10282 | Lactonase | 0.88 |
PF01726 | LexA_DNA_bind | 0.88 |
PF07731 | Cu-oxidase_2 | 0.88 |
PF08242 | Methyltransf_12 | 0.88 |
PF05163 | DinB | 0.88 |
PF00135 | COesterase | 0.88 |
PF00909 | Ammonium_transp | 0.88 |
PF11937 | DUF3455 | 0.88 |
PF03551 | PadR | 0.88 |
PF13426 | PAS_9 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 10.62 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 7.96 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 7.08 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 7.08 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 7.08 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 3.54 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 2.65 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 2.65 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.88 |
COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.88 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.88 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.88 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.88 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.88 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.88 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.73 % |
Unclassified | root | N/A | 13.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_11962962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300000893|AP72_2010_repI_A001DRAFT_1003190 | All Organisms → cellular organisms → Bacteria | 3361 | Open in IMG/M |
3300001356|JGI12269J14319_10247850 | Not Available | 666 | Open in IMG/M |
3300001593|JGI12635J15846_10076179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2466 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101764338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300004080|Ga0062385_10759338 | Not Available | 631 | Open in IMG/M |
3300004152|Ga0062386_100960304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300004635|Ga0062388_102187364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300005174|Ga0066680_10671355 | Not Available | 640 | Open in IMG/M |
3300005434|Ga0070709_11541109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300005435|Ga0070714_100293413 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
3300005435|Ga0070714_101042394 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300005526|Ga0073909_10687846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300005538|Ga0070731_10736132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300005541|Ga0070733_10300123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1061 | Open in IMG/M |
3300005542|Ga0070732_10577274 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300005557|Ga0066704_10682420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300005614|Ga0068856_101923059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300005764|Ga0066903_108065530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300005994|Ga0066789_10304586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
3300005994|Ga0066789_10323512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300006028|Ga0070717_10280600 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
3300006052|Ga0075029_100536327 | Not Available | 776 | Open in IMG/M |
3300006102|Ga0075015_100001548 | All Organisms → cellular organisms → Bacteria | 8812 | Open in IMG/M |
3300006162|Ga0075030_100399072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
3300006173|Ga0070716_100446942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
3300006642|Ga0075521_10214690 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300009012|Ga0066710_100351290 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
3300010048|Ga0126373_11158637 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300010048|Ga0126373_12266276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300010159|Ga0099796_10240499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300010321|Ga0134067_10308717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300010361|Ga0126378_11576590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
3300010376|Ga0126381_100806302 | Not Available | 1348 | Open in IMG/M |
3300011270|Ga0137391_11206696 | Not Available | 604 | Open in IMG/M |
3300012189|Ga0137388_10357435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1348 | Open in IMG/M |
3300012212|Ga0150985_117943034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300012363|Ga0137390_10449157 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 1265 | Open in IMG/M |
3300012683|Ga0137398_11156799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300012925|Ga0137419_10634104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
3300012971|Ga0126369_11432099 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300014167|Ga0181528_10093547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 1637 | Open in IMG/M |
3300014168|Ga0181534_10209603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
3300014201|Ga0181537_11226729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300014658|Ga0181519_10155915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1453 | Open in IMG/M |
3300015241|Ga0137418_10279378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1404 | Open in IMG/M |
3300017943|Ga0187819_10677276 | Not Available | 582 | Open in IMG/M |
3300018034|Ga0187863_10145855 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300018034|Ga0187863_10624631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300018038|Ga0187855_10113780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1628 | Open in IMG/M |
3300018086|Ga0187769_10842058 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300018090|Ga0187770_11673362 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300019278|Ga0187800_1670153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 585 | Open in IMG/M |
3300021402|Ga0210385_10201242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1448 | Open in IMG/M |
3300021403|Ga0210397_10876553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300021405|Ga0210387_10166636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1896 | Open in IMG/M |
3300021420|Ga0210394_11301832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300021432|Ga0210384_10384072 | Not Available | 1265 | Open in IMG/M |
3300021474|Ga0210390_10213247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1634 | Open in IMG/M |
3300021478|Ga0210402_11113876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300021479|Ga0210410_10318012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
3300022504|Ga0242642_1030395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
3300024271|Ga0224564_1007012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1816 | Open in IMG/M |
3300025414|Ga0208935_1028676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300025434|Ga0208690_1018562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
3300025906|Ga0207699_10132534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1627 | Open in IMG/M |
3300025915|Ga0207693_10393998 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300025929|Ga0207664_10074140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2748 | Open in IMG/M |
3300025939|Ga0207665_10090334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2122 | Open in IMG/M |
3300025939|Ga0207665_11552867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300026330|Ga0209473_1097749 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
3300026532|Ga0209160_1111753 | Not Available | 1361 | Open in IMG/M |
3300027610|Ga0209528_1128520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300027869|Ga0209579_10644924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300027895|Ga0209624_10094242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1950 | Open in IMG/M |
3300028023|Ga0265357_1022898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
3300028536|Ga0137415_10548722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
3300028666|Ga0265336_10228066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300028747|Ga0302219_10025048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2227 | Open in IMG/M |
3300028800|Ga0265338_10425574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
3300028906|Ga0308309_10041756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3242 | Open in IMG/M |
3300028906|Ga0308309_11576481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300029903|Ga0247271_100279 | All Organisms → cellular organisms → Bacteria | 14626 | Open in IMG/M |
3300029999|Ga0311339_11599180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300030503|Ga0311370_10326283 | Not Available | 1970 | Open in IMG/M |
3300030509|Ga0302183_10032458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2109 | Open in IMG/M |
3300030760|Ga0265762_1004583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2472 | Open in IMG/M |
3300031122|Ga0170822_11111990 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300031233|Ga0302307_10255458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
3300031234|Ga0302325_12420298 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300031234|Ga0302325_12639363 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300031241|Ga0265325_10480176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300031525|Ga0302326_10270671 | All Organisms → cellular organisms → Bacteria | 2745 | Open in IMG/M |
3300031525|Ga0302326_12163126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300031708|Ga0310686_100834628 | Not Available | 1033 | Open in IMG/M |
3300031708|Ga0310686_109550339 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300031715|Ga0307476_10437582 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300031720|Ga0307469_10607597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 978 | Open in IMG/M |
3300031753|Ga0307477_10612895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
3300031823|Ga0307478_10936422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
3300031823|Ga0307478_11139897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300031912|Ga0306921_10221088 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
3300031996|Ga0308176_10364085 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300032059|Ga0318533_10500884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
3300032174|Ga0307470_10106640 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
3300032205|Ga0307472_100566703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
3300032805|Ga0335078_10361206 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
3300032828|Ga0335080_12295771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300032893|Ga0335069_11451018 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.85% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.08% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.42% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.42% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.54% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.54% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.65% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.65% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.77% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_119629622 | 3300000789 | Soil | DVNSDGYGETRGWLGKTLKYRGGGKYELRAHVGVGDIKLEEK* |
AP72_2010_repI_A001DRAFT_10031903 | 3300000893 | Forest Soil | TSYGQTSGWLGKTLKYHGDGKYELRAHVGVGDIKVDGD* |
JGI12269J14319_102478502 | 3300001356 | Peatlands Soil | GDGYGETSGWLGKSLKYRGEGKYELRAHVGVGDINLEGK* |
JGI12635J15846_100761791 | 3300001593 | Forest Soil | ASTGIGDVNSDGYGETSGWLGKTLKYHGEGKYELRAHVGVGDIRLEGN* |
JGIcombinedJ26739_1017643382 | 3300002245 | Forest Soil | GDVNSDGYGETSGWLGKTLKYHGEGKYELRAHVGVGDIRLGGN* |
Ga0062385_107593383 | 3300004080 | Bog Forest Soil | VNSSTGDVSEGFLGKTLKYYGDGKYELRAHVSVGDITLEGK* |
Ga0062386_1009603042 | 3300004152 | Bog Forest Soil | RASTGIGDVNGSGYGETSGWLGKTLNYHGDGKYELRAHVGVGDITLE* |
Ga0062388_1021873641 | 3300004635 | Bog Forest Soil | TSTGDVSAGLLGKTLEYRGDGKYQLRAHVSVGDITLDEK* |
Ga0066680_106713552 | 3300005174 | Soil | IGDVNSNGYGETSGWLGKTLKYHGDGKYELRAHVSVGDITLEGR* |
Ga0070709_115411092 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GDGYGETSGWLGKTLKYRGEGKYELRARVGVGDISLEGK* |
Ga0070714_1002934131 | 3300005435 | Agricultural Soil | NASSGIGDVHGAHYGETSGWLGKTLKYHGDGKYELRAHVGVGDINLEGR* |
Ga0070714_1010423942 | 3300005435 | Agricultural Soil | GIGDVNGDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDINLEGK* |
Ga0073909_106878461 | 3300005526 | Surface Soil | YGETSGWLGKKLKYHGEGKYELRAHVGVGDIHLDGK* |
Ga0070731_107361321 | 3300005538 | Surface Soil | DGYGSTSGWLGKTLKYHGDGKYELRAHVGVGDIKLEGQ* |
Ga0070733_103001231 | 3300005541 | Surface Soil | NGDGYGETSGWLGKTLKYHGEGKYELRAHVGVGDINLEGK* |
Ga0070732_105772742 | 3300005542 | Surface Soil | YGETSGWLGKSLKYHGEGKYELRAHVGIGDIKLGRK* |
Ga0066704_106824201 | 3300005557 | Soil | DVNGNSYGETSGWLGKTLKYHGDGKYELRAHVSVGDITLEGK* |
Ga0068856_1019230591 | 3300005614 | Corn Rhizosphere | SYGQTSGWLGKTLKYHGNGKYELRAHVGVGDIRVEGD* |
Ga0066903_1080655302 | 3300005764 | Tropical Forest Soil | GDVHSDGYGSTSGWLGKTLKYHGEGKYELRAHVGVGDIKLGGQ* |
Ga0066789_103045862 | 3300005994 | Soil | GIGDVHGDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDIHLDGK* |
Ga0066789_103235121 | 3300005994 | Soil | ETSGWLGKTLKYRGEGKYELRAHVGVGDINLEGK* |
Ga0070717_102806002 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SAGIGDVNGDGYGETSGWLGKTLKFHGDGKYELRAHVGVGDINLEGK* |
Ga0075029_1005363271 | 3300006052 | Watersheds | VDGDGYGETSGWLGKSLKYHGDGKYELRAHVGVGDIHLEGK* |
Ga0075015_1000015489 | 3300006102 | Watersheds | NGDGFGETSGWLGKTLKYRGEGKYELRAHVGVGDISLEGK* |
Ga0075030_1003990721 | 3300006162 | Watersheds | GDVNSDGYGETRGWLGKTLKYHGDGKYELRAHVGVGDIKLEGR* |
Ga0070716_1004469422 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QTSGWLGKTLKYRGDGKYELHAHVGVGDIRVEGD* |
Ga0075521_102146902 | 3300006642 | Arctic Peat Soil | SGEGYGETSGWLGKTLKYHGDGKYELRAHVGVGDIHLEGK* |
Ga0066710_1003512903 | 3300009012 | Grasslands Soil | HASTSIGDVNSNGYGETSGWLGKTLKYHGDGKYELRAHVSVGDITLEGR |
Ga0126373_111586371 | 3300010048 | Tropical Forest Soil | ASTGVGDVSSDGYGETHGWLGKTLKYHGDGKYELRAHVGVGDIRLEGN* |
Ga0126373_122662761 | 3300010048 | Tropical Forest Soil | DGYGSTSGWLGKTLKYHGDGKYELRAHVGVGDIKLGGQ* |
Ga0099796_102404991 | 3300010159 | Vadose Zone Soil | DVNGNGYGETSGWLGKTLKYHGDGKYELRAHVSVGDITLERK* |
Ga0134067_103087172 | 3300010321 | Grasslands Soil | ASTGIGDVNSDGYGETSGWLGKTLKYHGDGKYEMRAHVGVGDIKLEGQ* |
Ga0074045_100177361 | 3300010341 | Bog Forest Soil | RASTSIGDVNASGDYGEAGGWLGKTLKYSGDGKYELRAHVSIGDINLDQK* |
Ga0126378_115765902 | 3300010361 | Tropical Forest Soil | TGIGDVNSDGYGETHGWLGKTLKYQGDGKYELRAHVGVGDIKLEGR* |
Ga0126381_1008063021 | 3300010376 | Tropical Forest Soil | NSGGYGQTRGWLGKTLKYRGDGKYELRAHVGVGDIRLEGK* |
Ga0137391_112066962 | 3300011270 | Vadose Zone Soil | GYGETSGWLGKTLKYHGDGKYELRAHVSVGDITLEEK* |
Ga0137388_103574351 | 3300012189 | Vadose Zone Soil | GIGDVNSDGYGETSGWLGKTLNYHGDGKYELHAHVGVGDITLEGK* |
Ga0150985_1179430341 | 3300012212 | Avena Fatua Rhizosphere | ASAGIGDVSGAGYGETSGWLGKTLKYHGDGKYELRAHVGVGDINLEGR* |
Ga0137390_104491572 | 3300012363 | Vadose Zone Soil | ETSGWLGKTLKYHGDGKYELRAHVSVGDITLEEK* |
Ga0150984_1009719852 | 3300012469 | Avena Fatua Rhizosphere | VHASAGIGDVSGAGYGETSGWLGKTLKYHGDGKYELRAHVGVGDINLEGR* |
Ga0137398_111567991 | 3300012683 | Vadose Zone Soil | IGDVNGDGYGETSGWLGKTLKSSGDGKYELRAHVGVGDITLEGK* |
Ga0137419_106341041 | 3300012925 | Vadose Zone Soil | DVNGNGYGETSGFLGKTLKYHGDGKYELRAHVGVGDITLEDK* |
Ga0126369_114320992 | 3300012971 | Tropical Forest Soil | YGSTSGWLGKTLKYHGDGKYELRAHVGVGDIKLGGQ* |
Ga0181528_100935474 | 3300014167 | Bog | GDTSGWLGKTLKYRGDGKYELRAHVGVGDISLEGK* |
Ga0181534_102096033 | 3300014168 | Bog | VSASTGIGDVDGDGYGETSGWLGKTLKYHGEGKYELRAHVGVGDVHLE* |
Ga0181537_112267291 | 3300014201 | Bog | ASTSIGDVNGDGYGEVSGWLGKTLKYHGDGKYELHAHVGVGDINLEGK* |
Ga0181519_101559152 | 3300014658 | Bog | DVHGGDYGESSGWLGKSLKYRGDGKYELRAHVGVGDIRLDGD* |
Ga0137418_102793783 | 3300015241 | Vadose Zone Soil | STSIGDVNGNGYGETSGWLGKTLKYHGEGKYELRAHVSVGDITLEEK* |
Ga0187819_106772762 | 3300017943 | Freshwater Sediment | DVNSDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDITLEGK |
Ga0187863_101458551 | 3300018034 | Peatland | GYGETSGWLGKSLKYRGDGRYELRAHVGVGDIHLDGD |
Ga0187863_106246312 | 3300018034 | Peatland | GYGETSGWLGKTLKYRGEGKYELRAHVGVGDIHLEGK |
Ga0187855_101137804 | 3300018038 | Peatland | VNSDGYDGETKGWLGKTLKYHGDGKYELRAHVGVGDIRLEGK |
Ga0187769_108420581 | 3300018086 | Tropical Peatland | DVNSDGYGETSGWLGKTLRYRGEGKYELRAHVGVGDITLEGK |
Ga0187770_116733622 | 3300018090 | Tropical Peatland | DSDGYGETSGWLGKTLRYHGDGKYELRAHVGVGDITLEGK |
Ga0187800_16701531 | 3300019278 | Peatland | GDVNSDGYGETSGWLGKTLRYHGDGKYELRAHVGVGDITLEGK |
Ga0210385_102012422 | 3300021402 | Soil | VNADVTGEVSGWLGKTLKYRGDGKYELRAHVGVGDITLEGK |
Ga0210397_108765531 | 3300021403 | Soil | STGIGDVHGPGYGETKGWLGKTVKYKGDGKYELRAHVGVGDIHLDN |
Ga0210387_101666361 | 3300021405 | Soil | GYGETSGWLGKTLKYHGDDGKYELRAHVGIGDIRLEGK |
Ga0210394_113018322 | 3300021420 | Soil | VHGEGYGETSGWLGKTLKYHGDGKYELRAHVGVGDIHLERK |
Ga0210384_103840721 | 3300021432 | Soil | NGDGYGETSGWLGKTLKYHGDGKYELHAHVGVGDITLEGK |
Ga0210390_102132473 | 3300021474 | Soil | TGIGDVHGDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDIHLDGK |
Ga0210402_111138761 | 3300021478 | Soil | STSIGDVSGGDGYGETSGWLGKTLKYHGDGKYELHAHVGVGDISLEGK |
Ga0210410_103180123 | 3300021479 | Soil | IGDVNSDGYGETRGWLGKTLKYRGEGKYELRAHVGVGDIRVEGK |
Ga0242642_10303951 | 3300022504 | Soil | SDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDIKLEGQ |
Ga0224564_10070123 | 3300024271 | Soil | GDVNGDGYGETSGWLGKTLKYRGDGKYELRAHVGVGDIHLEGK |
Ga0208935_10286761 | 3300025414 | Peatland | GIGDVDGDGYGETSGWLGKTLKYHGEGKYELRAHVGVGDVHLE |
Ga0208690_10185621 | 3300025434 | Peatland | GDVSAGFLGKTLKYQGDGKYELHAHVSIGDISLEGK |
Ga0207699_101325341 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | STGIGDVHGEGYGETSGWLGKKLKYHGEGKYELRAHVGVGDIHLDGK |
Ga0207693_103939982 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GETSGWLGKTLKYHGDGKYELRAHVGVGDINLEGK |
Ga0207664_100741401 | 3300025929 | Agricultural Soil | GDVNGDGYGETSGWLGKTLKFHGDGKYELRAHVGVGDINLEGK |
Ga0207665_100903342 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DVHTGYGQTSGWLGKTLKYRGDGKYELHAHVGVGDIRVEGD |
Ga0207665_115528672 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YGETSGWLGKKLKYHGEGKYELRAHVGVGDIHLDGN |
Ga0209238_11140011 | 3300026301 | Grasslands Soil | VQASAGIGDVNGDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDINLEGK |
Ga0209473_10977492 | 3300026330 | Soil | GYGETSGWLGKTLKYHGDGKYELRAHVGVGDINLEGK |
Ga0209160_11117531 | 3300026532 | Soil | TSIGDVNSNGYGETSGWLGKTLKYHGDGKYELRAHVSVGDITLEGR |
Ga0209529_10663371 | 3300027334 | Forest Soil | LVNASAGIGDVNGDGYGETSGWLGKSLKYHGEGKYEMRAHVGVGDIRLEGK |
Ga0209528_11285202 | 3300027610 | Forest Soil | RNFAAGWLGKTLKYHGDGKYELRAQVSVGDINLEGK |
Ga0209579_106449241 | 3300027869 | Surface Soil | VNSDGYGSTSGWLGKTLKYHGDGKYELRAHVGVGDIKLEGQ |
Ga0209624_100942421 | 3300027895 | Forest Soil | LVRANTRIGDVDGEGYDETKGWLGKTLKYTGDGKYELHAHVGIGDIRLDRN |
Ga0265357_10228981 | 3300028023 | Rhizosphere | IGDVNSAGYGETSGWLGKTLKYRGEGKYELRARVGVGDITLNRK |
Ga0137415_105487221 | 3300028536 | Vadose Zone Soil | STSIGDVNGNGYGETSGWLGKTLKYHGEGKYELRAHVSVGDITLEEK |
Ga0265336_102280662 | 3300028666 | Rhizosphere | GETSGWLGKSLKYHGEGKYELRAHVGVGDIHLDGK |
Ga0302219_100250487 | 3300028747 | Palsa | GDGYGETSGWLGKTLKYHGEGKYELRAHVGVGDVHLE |
Ga0265338_104255741 | 3300028800 | Rhizosphere | DVNGDGYGETSGWLGKSLKYHGEGKYELRAHVGVGDIHLDGK |
Ga0308309_100417561 | 3300028906 | Soil | IGDVNGEGYGETSGWLGKTLKYHGDGKYELRAHVSVGDINLEEK |
Ga0308309_115764812 | 3300028906 | Soil | YGETSGWLGKTLKYHGEGKYELRAHVGVGDIRLEGK |
Ga0247271_1002797 | 3300029903 | Soil | VSASTGIGDVNADGYGDTSGWLGKTLKYRGDGKYELRAHVGVGDISLEGK |
Ga0311339_115991801 | 3300029999 | Palsa | GETSGWLGKTLKYHGDGKYELRAHVGVGDIKLEGK |
Ga0311370_103262831 | 3300030503 | Palsa | TGDVSAGLLGKTLKYHGDGKYELRAHVSIGDITLEGK |
Ga0302183_100324581 | 3300030509 | Palsa | AGIGDVNSDGYGETSGWLGKTLKYHGEGKYELRAHVGVGDVHLE |
Ga0265762_10045833 | 3300030760 | Soil | GETSGWLGKTLKYRGDGKYELRAHVGVGDIHLEGK |
Ga0170822_111119901 | 3300031122 | Forest Soil | GYGETSGWLGKTLKYHGEGKYELRAHVGVGDIHLEGK |
Ga0302307_102554582 | 3300031233 | Palsa | GDVNGDGYGETSGWLGKTLKYRGDGKYELRAHVGIGDIHLEGK |
Ga0302325_124202981 | 3300031234 | Palsa | DGYGETSGWLGKTLKYRGDGKYELRARVGVGDINLEGK |
Ga0302325_126393631 | 3300031234 | Palsa | NTRIGDVNGEGYGETSGWLGKTLKYDGPGKYGLRAQVVVGDITVEGK |
Ga0265325_104801761 | 3300031241 | Rhizosphere | GNVQSDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDIRLDGK |
Ga0302326_102706711 | 3300031525 | Palsa | IGDVDGDGYGETSGWLGKTLKYHGDGKYELRAHVGVGDINLEGK |
Ga0302326_121631261 | 3300031525 | Palsa | ASYGEADGWLGKSLHYHGDGKYEMRAHVTVGDIKLEGK |
Ga0310686_1008346284 | 3300031708 | Soil | VNTSTGDVSAGFLGKTLKYQGDGKYELHAHVGIGDISLEGK |
Ga0310686_1095503393 | 3300031708 | Soil | VNSDGYGDTSGWLGKTLKYNGGGKYELRAHVSIGDVTLEGK |
Ga0307476_104375822 | 3300031715 | Hardwood Forest Soil | MRASTGIGDVNGNGYGETSGWLGKTLKYQGDGKYELRAHVGVGDIRLEGK |
Ga0307469_106075971 | 3300031720 | Hardwood Forest Soil | SSGIGDVNGEGYGETSGWLGKTLNYRGDGKYELHAHVSIGDINLEGK |
Ga0307477_106128952 | 3300031753 | Hardwood Forest Soil | ASAGIGDVNGAGYGETSGWLGKTLKYHGEGKYVLRAHVGVGDIHLDGK |
Ga0307478_109364222 | 3300031823 | Hardwood Forest Soil | GETSGWLGKTLKYHGDGQYELRAHVGVGDITLEAK |
Ga0307478_111398972 | 3300031823 | Hardwood Forest Soil | NADVTGEVSGWLGKTLKYRGDGKYELRAHVGVGDITLEGK |
Ga0306921_102210883 | 3300031912 | Soil | DVNSDGYGETHGWLGKTLKYQGDGKYELRAHVGVGDIKLEGR |
Ga0308176_103640851 | 3300031996 | Soil | IGDVNGDGYGETSGWLGKTLKYHGDGKYELRAHVSVGDINLEGK |
Ga0318533_105008842 | 3300032059 | Soil | GDVNSDGYGETHGWLGKTLKYQGDGKYELRAHVGVGDIKLEGR |
Ga0307470_101066401 | 3300032174 | Hardwood Forest Soil | VNGDGYGETSGWLGKTLKYHGEGKYELRAHVGVGDIHLEGK |
Ga0307472_1005667031 | 3300032205 | Hardwood Forest Soil | DGYGETHGWLGKTLKYHGDGKYELRAHVGVGDIKLEGQ |
Ga0335078_103612062 | 3300032805 | Soil | GYGETSGWLGKSLKYRGEGKYELRAHVGVGDIHLDGK |
Ga0335080_122957711 | 3300032828 | Soil | YGETSGWIGKTLKYRGDGKYQLRAHVGVGDIKFEDR |
Ga0335069_114510182 | 3300032893 | Soil | GIGDLNSDGYGESRGWLGKTLKYHGNGKYELRAHVGVGDIKLESH |
⦗Top⦘ |