| Basic Information | |
|---|---|
| Family ID | F083107 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VTRINRAHVLVAAFAAALCVPAAGVSSGNGLPTTIGKGEGSLNLI |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.46 % |
| % of genes from short scaffolds (< 2000 bps) | 95.58 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (23.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.204 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.133 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 30.14% β-sheet: 0.00% Coil/Unstructured: 69.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF08402 | TOBE_2 | 94.69 |
| PF00202 | Aminotran_3 | 3.54 |
| PF00005 | ABC_tran | 0.88 |
| PF00155 | Aminotran_1_2 | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_68567 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300003321|soilH1_10119127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1480 | Open in IMG/M |
| 3300004091|Ga0062387_100495435 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300004114|Ga0062593_103407023 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300004479|Ga0062595_101919390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300004479|Ga0062595_102661069 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005171|Ga0066677_10754287 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005176|Ga0066679_10734188 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005179|Ga0066684_10409648 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005179|Ga0066684_10477250 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005179|Ga0066684_10513693 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005187|Ga0066675_10233961 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300005187|Ga0066675_10280508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
| 3300005187|Ga0066675_10522629 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300005187|Ga0066675_11263284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300005337|Ga0070682_100554754 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300005355|Ga0070671_101418168 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005435|Ga0070714_100283208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1541 | Open in IMG/M |
| 3300005435|Ga0070714_102062765 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005436|Ga0070713_101850531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300005444|Ga0070694_101450880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300005445|Ga0070708_100806001 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005518|Ga0070699_100737515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300005518|Ga0070699_101214451 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005557|Ga0066704_10893291 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005557|Ga0066704_10973525 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005559|Ga0066700_10562197 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005559|Ga0066700_10889233 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005560|Ga0066670_10748516 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005566|Ga0066693_10101339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300005569|Ga0066705_10820850 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005576|Ga0066708_10469693 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005578|Ga0068854_101215498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300005587|Ga0066654_10321249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides dokdonensis → Nocardioides dokdonensis FR1436 | 836 | Open in IMG/M |
| 3300005598|Ga0066706_10238026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1413 | Open in IMG/M |
| 3300005646|Ga0075040_1598616 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005901|Ga0075274_1002140 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300006028|Ga0070717_10952525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → unclassified Achromobacter → Achromobacter sp. | 782 | Open in IMG/M |
| 3300006032|Ga0066696_10421030 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006034|Ga0066656_10957003 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006173|Ga0070716_101816648 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006175|Ga0070712_100698372 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300006903|Ga0075426_11543453 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300009012|Ga0066710_100979135 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300009012|Ga0066710_103230653 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009089|Ga0099828_11887845 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009089|Ga0099828_12031478 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009090|Ga0099827_10674601 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300009143|Ga0099792_11186035 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009147|Ga0114129_12490723 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010326|Ga0134065_10366981 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010337|Ga0134062_10619086 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010371|Ga0134125_11460393 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010373|Ga0134128_11324714 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300010396|Ga0134126_12918698 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012189|Ga0137388_10429346 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300012205|Ga0137362_10777017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 821 | Open in IMG/M |
| 3300012356|Ga0137371_10961066 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012362|Ga0137361_11155227 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012363|Ga0137390_10301633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1584 | Open in IMG/M |
| 3300012582|Ga0137358_10281445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia lata | 1130 | Open in IMG/M |
| 3300012927|Ga0137416_10937999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia lata | 771 | Open in IMG/M |
| 3300012930|Ga0137407_11755177 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012975|Ga0134110_10336566 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012977|Ga0134087_10690410 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012986|Ga0164304_10611452 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300013104|Ga0157370_11942935 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300014058|Ga0120149_1203870 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300015077|Ga0173483_10669926 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300015373|Ga0132257_104414989 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300017937|Ga0187809_10189229 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300017961|Ga0187778_10806624 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300017993|Ga0187823_10323478 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300018021|Ga0187882_1097054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1266 | Open in IMG/M |
| 3300020070|Ga0206356_11100677 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300021479|Ga0210410_10105520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2490 | Open in IMG/M |
| 3300024055|Ga0247794_10315987 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025409|Ga0208321_1051815 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025906|Ga0207699_10777233 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300025906|Ga0207699_11180556 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300025912|Ga0207707_11401536 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025913|Ga0207695_10704633 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025922|Ga0207646_10555700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1032 | Open in IMG/M |
| 3300025929|Ga0207664_10922202 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300025949|Ga0207667_11806922 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025981|Ga0207640_11277802 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300025988|Ga0208141_1017378 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300025998|Ga0208651_1015238 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300026041|Ga0207639_11311630 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300026326|Ga0209801_1334498 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300026527|Ga0209059_1250364 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026548|Ga0209161_10394193 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300026550|Ga0209474_10279274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1005 | Open in IMG/M |
| 3300026552|Ga0209577_10062411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3109 | Open in IMG/M |
| 3300026552|Ga0209577_10711073 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026552|Ga0209577_10822500 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027882|Ga0209590_10652347 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300028573|Ga0265334_10327368 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300028800|Ga0265338_10043994 | All Organisms → cellular organisms → Bacteria | 4129 | Open in IMG/M |
| 3300031231|Ga0170824_103204813 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300031235|Ga0265330_10211231 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031240|Ga0265320_10168606 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031242|Ga0265329_10269700 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031942|Ga0310916_11445709 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031954|Ga0306926_12701751 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031996|Ga0308176_12739195 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032180|Ga0307471_102836290 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032205|Ga0307472_102222381 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032805|Ga0335078_10549974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1470 | Open in IMG/M |
| 3300032805|Ga0335078_12102393 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300032954|Ga0335083_11555498 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300033805|Ga0314864_0075173 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01079480 | 2199352024 | Soil | VTRITRAHVLIAVFAVALCVPAAGVSSGNGLPTKIGKGEGSLNLIEWAAYSDPSFAKAFQ |
| soilH1_101191273 | 3300003321 | Sugarcane Root And Bulk Soil | VSKRAYVLLAALAGAMCVPAAGVSSGKALPSAIGKGEGQLNLVAWE |
| Ga0062387_1004954352 | 3300004091 | Bog Forest Soil | VRSIRKVHVLIAAFAVAMCVPAAGVSAGNGLPTTVGKGEGQL |
| Ga0062593_1034070231 | 3300004114 | Soil | VRSIRRKHVLVAIVAVALCVPAAGVGETSADGLPTSIGKGEGTLNL |
| Ga0062595_1019193902 | 3300004479 | Soil | MRRIRRGHVLTAAVAVALCIPASGASTGNSAGALPTKIGKGEGALNLIEWAAYSD |
| Ga0062595_1026610691 | 3300004479 | Soil | MRRIRRAHVLGVALTAALCVPALSVGGESGLPTKIGKGEG |
| Ga0066677_107542871 | 3300005171 | Soil | VKRVIVAVAAVAALAVQAAFAANGLPTSVGKGEGQLNLVAWE |
| Ga0066679_107341882 | 3300005176 | Soil | MRRIRRAHVLAAAAAAALCVPASGVSSGSGAPTLQTKIGKGEGALNLIEWPAYSDPSFANKF |
| Ga0066684_104096482 | 3300005179 | Soil | MSRIRRTHVLVVAIAAALCVPAAGAGSTSSGPGMITKVG* |
| Ga0066684_104772502 | 3300005179 | Soil | VSRFKRAHVLAAALAAALCIPASGVSSGKGMPTSIGKGEGALNVIEWAAYTDPSFAK |
| Ga0066684_105136932 | 3300005179 | Soil | VTRINRAHVLVAAFAAALCVPAAGVSSGNGLPTTIGKGEGSLNLI |
| Ga0066675_102339611 | 3300005187 | Soil | VIRIKRAHVLFAALAVALCVPAAGVSSRNGLPTTIGKGEG |
| Ga0066675_102805082 | 3300005187 | Soil | VTRINRAHVLVAAFAAALCVPAAGVSSGNGLPTTIGKGEGSLNLIEWA |
| Ga0066675_105226292 | 3300005187 | Soil | MRRIRRRHVLFAAFAAAICVPASGIGSSTSASSGLPTKIGK |
| Ga0066675_112632842 | 3300005187 | Soil | MRRIRRVHVLGAAIAVALCVPASGVSSGSASGIQTTIGKGEGRLNVIEWPAY |
| Ga0070682_1005547541 | 3300005337 | Corn Rhizosphere | VIRIKRAHVLLAALAAALCVPAAGVSAGNGLPTTIGKGEGQLNLVA |
| Ga0070671_1014181682 | 3300005355 | Switchgrass Rhizosphere | VIRFKRAHVLLGVVIAALCVPAAGIGAGSGLPTKIGKGEGQ |
| Ga0070714_1002832081 | 3300005435 | Agricultural Soil | VRRRVWIVAAAFAVALSVPAAGIGHGNGLPTSVGKGEGQLN |
| Ga0070714_1020627652 | 3300005435 | Agricultural Soil | VKRNIRGYVLLAALTAALCVPASGVSASKGLPTSVGKGEGQLNLIAWEGY |
| Ga0070713_1018505312 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRFKRAHVLAAAVAAALCVPASGVSSGKGLPTSIGKGEGSLNVIEWAAYT |
| Ga0070694_1014508802 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRIKRAHVLVATFAVALCVPAAGVSSGNGLPTTIGKGEGSLNLIEWAAYSD |
| Ga0070708_1008060011 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRIRRVHVLVAVLAAALCVPALGAGGGSGLPTKIGKGEG |
| Ga0070699_1007375151 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRIKRAHVLVATFAVALCVPAAGVSSGNGLPTTIGKGEGSLNLIEWAAYSDPS |
| Ga0070699_1012144511 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRIRKQYVLLAALAAMLAVPAAGIGKGNGMPTSIGKGEGKLVVIEWPAYTDPSFAKPFE |
| Ga0070699_1017363431 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRIRRVHVLVAVLAAALCVPALGAGGGSGLPTKIGKGEGSLNVIEWPAYA |
| Ga0066704_108932912 | 3300005557 | Soil | MRRIRKVHVLLAAMTAALCVPASGVSGGSGLPTKIGKGEGSLN |
| Ga0066704_109735251 | 3300005557 | Soil | MRRIRRVHVLGAAIAVALCVPASGVSSGSASGIQTTIGKGEGRLNVIEWPAYSDPSFAKKFEQQ |
| Ga0066700_105621971 | 3300005559 | Soil | MRRIRRMHVLVAAVTAALCLPASGVSGGSGLPTKIGKGEGA |
| Ga0066700_108892332 | 3300005559 | Soil | MRRIRRVHVLVAVFAAALCVPALGAGGGSGLPTKIGKGEGALNVIEWPAYADKSF |
| Ga0066670_107485162 | 3300005560 | Soil | VIRIKRAYVLAAVVAAALCVPAAGVSAGHGVPTKIGKGEG |
| Ga0066693_101013392 | 3300005566 | Soil | VRGIRRTRVLAAAVTAALCVPAAGVGSGQGLPTSIGKGEGQLNLIAWEG |
| Ga0066705_108208502 | 3300005569 | Soil | VRGIRRTRVLAAAVTAALCVPAAGVGSGQGLPTSIGKGEGQL |
| Ga0066708_104696932 | 3300005576 | Soil | MSRIRRTHVLVVAIAAALCVPAAGAGSTSSGPGMITKVGKAE |
| Ga0068854_1012154982 | 3300005578 | Corn Rhizosphere | VIRIKRAHVLIAALAAALCVPAAGVGAGNGVPSKIGRGEGQLNLVAWVGY |
| Ga0066654_103212492 | 3300005587 | Soil | VNRIKRAHVLFAALAAAMCVPAAGVSSTSAVPTTIGKGEG |
| Ga0066706_102380263 | 3300005598 | Soil | VIRINRAQVLVAAFAAALCVPAAGVSAGNGLPTTIGKGEGSLNLIEWA |
| Ga0075040_15986161 | 3300005646 | Permafrost Soil | LRGIRKAHVFAVVVAAALCVPAAGVSKSNGLPTSVG |
| Ga0075274_10021401 | 3300005901 | Rice Paddy Soil | MSRIRRSHVLVAALAAALCVPASGIAAGSGLPTKIGK |
| Ga0070717_109525251 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRRVWIVAAAFAVALSVPAAGIGHGNGLPTSVGKGEG |
| Ga0066696_104210301 | 3300006032 | Soil | VTRIRRVHVLVAAAAAALCVPAAGISSGNGLPTSVGKGEGQLNLI |
| Ga0066656_109570031 | 3300006034 | Soil | VTRIKRGHVLLAAMAAALCVPAAGISSGSGLPTSIGKGEGQLN |
| Ga0070716_1018166482 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRIKRAHVLVATFAVALCVPAAGVSSSNGLPTTIGKGEGSLNLIEWA |
| Ga0070712_1006983722 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRRVWIVAAAIAAALSVPAAGVGHGNGLPTSIGKGEGQLNLIAWDGYTYKQW |
| Ga0075426_115434531 | 3300006903 | Populus Rhizosphere | VKRIRRGHVLVAALAVALCVPAAGIGGGKALPTAIGKGEGSLNVIEWAAYTDPSFAKPFE |
| Ga0066710_1009791351 | 3300009012 | Grasslands Soil | MSRIRRIHVLAAALTAALCVPAAGAGSGSGMITNAGKTEGQLNL |
| Ga0066710_1032306532 | 3300009012 | Grasslands Soil | VNRIKRAHVLFAALAAAMCVPAAGVSSTSAVPTTIGKGAGPLNRIHWGAYSE |
| Ga0099828_118878451 | 3300009089 | Vadose Zone Soil | MRRIRKQYVLLAALAAMLAVPAASVGKGNGMLTSIGKGEGKLVVIEWPAYTDPSFAKPFE |
| Ga0099828_120314781 | 3300009089 | Vadose Zone Soil | MRRIRKLHVFAAVFTAALCVPALGAGGGSGLPTKIGKGE |
| Ga0099827_106746012 | 3300009090 | Vadose Zone Soil | VIRIKRAHVLVAAFAAALCVPAAGVSSTNGLPTTIGKGEGSL |
| Ga0099792_111860352 | 3300009143 | Vadose Zone Soil | VLVVALAAALCVPATGISSSNGLPTSIGKGEGQLNL |
| Ga0114129_124907231 | 3300009147 | Populus Rhizosphere | VIRIKRAHVLLVALAAALCVPAAGVGSTDGLPGAIG |
| Ga0134065_103669812 | 3300010326 | Grasslands Soil | MKRIRKLHVAVAALAVALCVPASGVSKGNAAGSLPTKIGKGEGSLNLIEWPAYSDP |
| Ga0134062_106190862 | 3300010337 | Grasslands Soil | MKRIRKVHVAVAALAVALCVPASGVSKGNAANSLPTKIDKGEGSLNLIEW |
| Ga0134125_114603932 | 3300010371 | Terrestrial Soil | VLLAALAVALCVPAAGISGGNGLPTSIGKGEGSLNVIEWAAYTDPSFANKF |
| Ga0134128_113247142 | 3300010373 | Terrestrial Soil | VLIAVFAVALCVPAAGVSSGNGLPTKIGKGEGSLNLIEWAAYSDPSFAKAFQRQ |
| Ga0134126_129186982 | 3300010396 | Terrestrial Soil | VIRIKRAHVLVATFAVALCVPAAGVSSGNGLPTTIGKGEGSLNLIEWAAYSDPSFA |
| Ga0137388_104293461 | 3300012189 | Vadose Zone Soil | MRRIRRVHVLVALFAAALCVPALGAGGGSGLPTKIGKGEGSLN |
| Ga0137362_107770172 | 3300012205 | Vadose Zone Soil | VLVAALAVALCVPAAGISSSNGLPTSIGKGEGQLNLIAW |
| Ga0137371_109610662 | 3300012356 | Vadose Zone Soil | MKIRRTHVLVAALAAALCVPAAGVGSQAGSPSTLTKIGKGEGALNLIEWVGYSDKSFASTFA* |
| Ga0137361_111552271 | 3300012362 | Vadose Zone Soil | VLAAAFAVALCIPAAGIGSGSGLPTTIGKGEGVLNV |
| Ga0137390_103016333 | 3300012363 | Vadose Zone Soil | VIRIRRAHVLVAALAVALCVPASGISSGNGLPTSIGKGEGQLNL |
| Ga0137358_102814451 | 3300012582 | Vadose Zone Soil | VIRIKRAHVLVAAFAVALSVPAAGVSSSNGLPTTIGKGEGSLN |
| Ga0137416_109379991 | 3300012927 | Vadose Zone Soil | LTGIKRVHLLIAAAAVALCVPAAGVSSGNGLPTKIGKGEGVL |
| Ga0137407_117551772 | 3300012930 | Vadose Zone Soil | VIRIKRAHVLLAAFAAALCVPAAGVSSGNGLPTTIGKGEGSLNLVAWEGY |
| Ga0134110_103365662 | 3300012975 | Grasslands Soil | VRSIRRKHVLVAAVAAALCVPAAGVGKTQSGGLPTS |
| Ga0134087_106904101 | 3300012977 | Grasslands Soil | VNRIKRAHVLFAALAAAMCVPAAGVSSTSAVPTTI |
| Ga0164304_106114522 | 3300012986 | Soil | VIRIKRAHVLLAALAAALCVPAAGVSAGNGLPTTIGKGE |
| Ga0157370_119429352 | 3300013104 | Corn Rhizosphere | VLIAVFAVALCVPAAGVSSGNGLPTKIGKGEGSLNLIEWAAYSDPSFAKAFQR |
| Ga0120149_12038701 | 3300014058 | Permafrost | VIRINRAHVLVAAFAAALCVPAAGVSAGNGLPTTIGKGEGSLNLIEWAA |
| Ga0173483_106699262 | 3300015077 | Soil | VIRIKRAHVLVAAFAAALCVPAAAVSSGNGLPTTIGKGE |
| Ga0132257_1044149892 | 3300015373 | Arabidopsis Rhizosphere | MRIRIRRKHVLLAVAAAALCVPASGVSESGQNGMLTKIGKSEGTLTLIEWPAYSDPSFAKKFEQQTGCKI |
| Ga0187809_101892291 | 3300017937 | Freshwater Sediment | VTRIKRAHVLVAAMAAALCVPAAGVSSNSGLPTSIGKG |
| Ga0187778_108066242 | 3300017961 | Tropical Peatland | VTRIKRAHVLVAAVAAALCIPAAGSGSGNGLPTKIGKGEGVLNVIEWAAYTDPS |
| Ga0187823_103234781 | 3300017993 | Freshwater Sediment | VSRFKRAHVLAAAVAAALCVPASGVSSGKGLPTSIGKGEGSLNVIEWAAYTDPSFAK |
| Ga0187882_10970541 | 3300018021 | Peatland | VTRIKRTHVLVAAVAAALCIPAAGSSSGNGLPTKIGK |
| Ga0206356_111006772 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRIRRVHVLAAAVAAALCVPAAGISSGKGLPTSIGKGEGQLNLIAWAGY |
| Ga0210410_101055201 | 3300021479 | Soil | VTRITRAHVLAAAFAVALCIPAAGIGSRSGLPTTIGKGEGVLNVIEWAAYTDPSFAKA |
| Ga0247794_103159872 | 3300024055 | Soil | VRKHIRRYVLLAALAAALCVPASGVSASSSLPTKIGKGEGQLNLVAWE |
| Ga0208321_10518151 | 3300025409 | Peatland | VTRIKRTHVLVAAVAAALCIPAAGSSSGNGLPTKIGKGEGVLNVIEWAA |
| Ga0207699_107772332 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRIKRGHVLLAAMAAALCVPAAGISSGSGLPTSVGKGE |
| Ga0207699_111805562 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRIRRGHVLLAALAVALCVPAAGISGGNGLPTSIGKGEGSLNVIEWAAYTD |
| Ga0207707_114015362 | 3300025912 | Corn Rhizosphere | VSRKWVVAAAVAAALCVPAAGISHGNGLPTKIGKGEGQLNLIAWEG |
| Ga0207695_107046332 | 3300025913 | Corn Rhizosphere | MRIRRVHVLAAAVAAALCVPAAGISSGKGLPTSIGKGEGQLNLIAWE |
| Ga0207646_105557001 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFRIRKTHVLVAAFAVALCVPAAGTSSGHGLPTSIGKSEGSLNVIEWAAYTDPSFANAFTK |
| Ga0207664_109222021 | 3300025929 | Agricultural Soil | VIRIKRAHVLVAAIAVALCVPAAGIGSGKGLPTKIGKG |
| Ga0207667_118069222 | 3300025949 | Corn Rhizosphere | VKRGWVVSAVVAAALCVPAAGISHGNGLPTTIGKGEGQLNLVA |
| Ga0207640_112778021 | 3300025981 | Corn Rhizosphere | VIRIKRAHVLAAAVAAALCVPAAGVGSGNGLPAKIGKGEGALNVIEWAAYTDPSFAKAFEKQ |
| Ga0208141_10173781 | 3300025988 | Rice Paddy Soil | MSRIRRSHVLVAALAAALCVPVSGVAAGSGLPTTIGKGEGQLNLIAWV |
| Ga0208651_10152381 | 3300025998 | Rice Paddy Soil | MKGIRRSYVLVAALVAALCVPAAGISAGNGLPTKIGAGEGQLNLIAWE |
| Ga0207639_113116302 | 3300026041 | Corn Rhizosphere | VSRKWVVAAAVAAALCVPAAGISHGNGLPTKIGKGEGQL |
| Ga0209801_13344981 | 3300026326 | Soil | MRRIRKSHVLVAALAAALCVPASGVSKGSATGGLPTKIGKGEGSLNLIEWPAY |
| Ga0209059_12503641 | 3300026527 | Soil | VNRIKRAHVLFAALAVAMCVPAAGVSSTSALPTTIGKG |
| Ga0209161_103941931 | 3300026548 | Soil | MSRIRRTHVLVVAIAAALCVPAAGAGSTSSGPGMITKVGKAEGQLNLIAWEG |
| Ga0209474_102792742 | 3300026550 | Soil | VTRIRRVHVLVAAAAAALCVPAAGISSGNGLPTSVGKGEGQ |
| Ga0209577_100624111 | 3300026552 | Soil | VNRIKRAHVLFAALAVAMCVPAAGVSSTSALPTTIGK |
| Ga0209577_107110731 | 3300026552 | Soil | MRRIRRAHVLAAATAAALCVPASGVSSGSGPTLQTKIGKGEGALNLIEWPAYSDPS |
| Ga0209577_108225002 | 3300026552 | Soil | VTRIRRVHVLVAAAAAALCVPAAGISSGNGLPTSVGKG |
| Ga0209590_106523471 | 3300027882 | Vadose Zone Soil | MRRIRKVHVFAAVFTAALCVPASGVGGGSGLPTKIGKGEGALNVIEW |
| Ga0265334_103273681 | 3300028573 | Rhizosphere | VSRIRRAHVFVAVVAADLCVPAAGISSGNGLPTSIGKGEGQ |
| Ga0265338_100439946 | 3300028800 | Rhizosphere | VRSIRRVHVLVAAFAVAMCVPAAGVSAGNGLPTTVGKGEGSLNLIAWEGY |
| Ga0170824_1032048131 | 3300031231 | Forest Soil | VKRITRGHVLLAALAAALCVPAAGTSGGTGLPTSIGKGEGSLNVIEWAAYTDPSFAKA |
| Ga0265330_102112312 | 3300031235 | Rhizosphere | VRRITRAHVLAAAFAVALCVPAAGISSGSGLPTTIGK |
| Ga0265320_101686061 | 3300031240 | Rhizosphere | VRRIRRTHVLVAALAVALCVPAAGVSAGKGLPTSIGKGEGELNLIAWEG |
| Ga0265329_102697002 | 3300031242 | Rhizosphere | VSRIKRAHVFVAVVAAALCVPAAGISSGNGLPTSIGKGE |
| Ga0310916_114457091 | 3300031942 | Soil | VRAMHIRIRRKHVLLAVVAAALCVPASGVSESQGDALPTSIGKGEGSLNLI |
| Ga0306926_127017511 | 3300031954 | Soil | VRKRFRIWHVVFAGLVAVLVVPAGGVSKSGYTLPTKIGPGEGALNLIEWPAYSDPSFANKFVA |
| Ga0308176_127391952 | 3300031996 | Soil | VIRIKRAHVLIAALAAALCVPAAGVGAGNGVPSKIGKGEGQLNLVA |
| Ga0307471_1028362901 | 3300032180 | Hardwood Forest Soil | VRRISRGHVLVVAIAAALCVPAAGTSRSNGLPTSIGKGEGSLNLIEWAAYSD |
| Ga0307472_1022223811 | 3300032205 | Hardwood Forest Soil | MRRIRRVHVLGAAVAAALCVPASGVSSGSTSGLQTKIGKGEGRLNLIEWPAYSDPSFAKK |
| Ga0335078_105499743 | 3300032805 | Soil | VRRIRRVHVLAAAFTAALCVPAAGVSSGNGLPTSVGKGEGQLNLIAWEG |
| Ga0335078_121023932 | 3300032805 | Soil | VTRIRRVHVLVAAVAAALCVPAAGVSAGNGLPTTVGPGEGQLNLIAWEGYTQPQ |
| Ga0335083_115554982 | 3300032954 | Soil | VRSNTRRYVLLAAVTAALCVPAAGISAGNGLPTTIGPGEGQLNLIAWE |
| Ga0314864_0075173_3_128 | 3300033805 | Peatland | MRRIRKGHVFAAALAVALCVPAAGASSGNNGMINSVGKTEGQ |
| ⦗Top⦘ |