| Basic Information | |
|---|---|
| Family ID | F083100 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLNELLTPSATEEARTELKSYNVTIPMGSLAIGVDNIHHDVFL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 56.64 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 90.27 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (42.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.708 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.788 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 0.00% Coil/Unstructured: 95.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF02367 | TsaE | 69.91 |
| PF01256 | Carb_kinase | 12.39 |
| PF03853 | YjeF_N | 2.65 |
| PF13561 | adh_short_C2 | 1.77 |
| PF00106 | adh_short | 0.88 |
| PF13620 | CarboxypepD_reg | 0.88 |
| PF13906 | AA_permease_C | 0.88 |
| PF07228 | SpoIIE | 0.88 |
| PF13520 | AA_permease_2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 69.91 |
| COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 12.39 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 12.39 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 2.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10349575 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005187|Ga0066675_10848104 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005293|Ga0065715_10787522 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005434|Ga0070709_11141906 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005445|Ga0070708_101103290 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005468|Ga0070707_100461803 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300005541|Ga0070733_11096783 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005547|Ga0070693_100749495 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005560|Ga0066670_10053028 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300005574|Ga0066694_10095731 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300005591|Ga0070761_10200836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1181 | Open in IMG/M |
| 3300005591|Ga0070761_10453390 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005944|Ga0066788_10194289 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005993|Ga0080027_10289327 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300006031|Ga0066651_10017442 | All Organisms → cellular organisms → Bacteria | 3035 | Open in IMG/M |
| 3300006041|Ga0075023_100309121 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006041|Ga0075023_100490798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300006174|Ga0075014_100151101 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300006794|Ga0066658_10642094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300006796|Ga0066665_11036889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300006804|Ga0079221_11156190 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300007258|Ga0099793_10156570 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300007265|Ga0099794_10110440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1377 | Open in IMG/M |
| 3300007265|Ga0099794_10200743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1021 | Open in IMG/M |
| 3300007265|Ga0099794_10588097 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300007265|Ga0099794_10763626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300007265|Ga0099794_10801866 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009038|Ga0099829_10724782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300009038|Ga0099829_10872064 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300009088|Ga0099830_10119434 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300009089|Ga0099828_11395040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300009089|Ga0099828_11851107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300009090|Ga0099827_10205707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1639 | Open in IMG/M |
| 3300010043|Ga0126380_11608180 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300010321|Ga0134067_10001488 | All Organisms → cellular organisms → Bacteria | 5382 | Open in IMG/M |
| 3300010339|Ga0074046_10544469 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010359|Ga0126376_13135991 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010361|Ga0126378_10939380 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300010373|Ga0134128_10527027 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300010376|Ga0126381_105155744 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300011270|Ga0137391_11156176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300011271|Ga0137393_10547887 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300012096|Ga0137389_11031381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300012096|Ga0137389_11101807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300012096|Ga0137389_11542571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300012189|Ga0137388_11118575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300012199|Ga0137383_11297290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300012200|Ga0137382_10143799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1612 | Open in IMG/M |
| 3300012202|Ga0137363_10212640 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300012203|Ga0137399_11529940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300012203|Ga0137399_11737680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012207|Ga0137381_10999504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300012285|Ga0137370_10963791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300012361|Ga0137360_10180400 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300012361|Ga0137360_10603706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300012361|Ga0137360_10730391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300012582|Ga0137358_11030728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300012918|Ga0137396_10715806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300012922|Ga0137394_10666859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300012924|Ga0137413_10991579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300012927|Ga0137416_11463240 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012929|Ga0137404_11151307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300012929|Ga0137404_11190915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300012929|Ga0137404_12159216 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012930|Ga0137407_10446069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1203 | Open in IMG/M |
| 3300013832|Ga0120132_1155398 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300014968|Ga0157379_10471267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1161 | Open in IMG/M |
| 3300015052|Ga0137411_1321352 | All Organisms → cellular organisms → Bacteria | 5934 | Open in IMG/M |
| 3300015053|Ga0137405_1072531 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300015245|Ga0137409_10038167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4623 | Open in IMG/M |
| 3300015245|Ga0137409_10073808 | All Organisms → cellular organisms → Bacteria | 3194 | Open in IMG/M |
| 3300017930|Ga0187825_10294432 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300017930|Ga0187825_10441498 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017936|Ga0187821_10153767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300018431|Ga0066655_10976101 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300019789|Ga0137408_1129947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300019890|Ga0193728_1231264 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300020170|Ga0179594_10109673 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300020579|Ga0210407_10163872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1717 | Open in IMG/M |
| 3300020579|Ga0210407_10678065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300020580|Ga0210403_11177164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300021046|Ga0215015_10632433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1557 | Open in IMG/M |
| 3300021181|Ga0210388_10015301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6141 | Open in IMG/M |
| 3300021401|Ga0210393_10275656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1365 | Open in IMG/M |
| 3300021404|Ga0210389_11351653 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021432|Ga0210384_10386020 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300021474|Ga0210390_10951931 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300021478|Ga0210402_11306171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300021479|Ga0210410_10336643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1353 | Open in IMG/M |
| 3300021559|Ga0210409_10295350 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300024182|Ga0247669_1014930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1377 | Open in IMG/M |
| 3300024286|Ga0247687_1014125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1097 | Open in IMG/M |
| 3300024330|Ga0137417_1447166 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300026334|Ga0209377_1072981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1472 | Open in IMG/M |
| 3300026547|Ga0209156_10047917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2288 | Open in IMG/M |
| 3300026557|Ga0179587_10522271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300027562|Ga0209735_1068872 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300027583|Ga0209527_1082635 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300027783|Ga0209448_10083968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1068 | Open in IMG/M |
| 3300027846|Ga0209180_10339728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300027862|Ga0209701_10126046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1582 | Open in IMG/M |
| 3300027875|Ga0209283_10322672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300027915|Ga0209069_10897565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300029636|Ga0222749_10021595 | All Organisms → cellular organisms → Bacteria | 2666 | Open in IMG/M |
| 3300030056|Ga0302181_10022824 | All Organisms → cellular organisms → Bacteria | 3548 | Open in IMG/M |
| 3300030991|Ga0073994_12307804 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300031718|Ga0307474_10892416 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031720|Ga0307469_10131627 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300031820|Ga0307473_10798034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300031962|Ga0307479_11424784 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032180|Ga0307471_100913610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1045 | Open in IMG/M |
| 3300032898|Ga0335072_11270888 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300033803|Ga0314862_0127760 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 42.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_103495751 | 3300003505 | Forest Soil | MAYEILTPIPTEEPRIELKSYSTTIPLGSLAIGVDNIHHDVFL |
| Ga0066675_108481041 | 3300005187 | Soil | MIKSILTPSGTEEGGINLKSYSTTIPMGSLAIGVDNIHHDVFLSPRF |
| Ga0065715_107875221 | 3300005293 | Miscanthus Rhizosphere | MAYEILTPSLTEAARIELKSYNVTIPMGSLAIGVDNIHHDVF |
| Ga0070709_111419061 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVSLMPVATEAARTELKRYNVTIPMGSLSIGVDNIHHDVFLSPK |
| Ga0070708_1011032902 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MANSIFTPSTTEAARIELKSYNTTIPMGSLAIGVDNIHHDVFLSP |
| Ga0070707_1004618031 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MANGLLTLNTGNAGGIELKSYSVTLPMGSLAIGVDNIHHDVFL |
| Ga0070733_110967831 | 3300005541 | Surface Soil | MAPELLTLNPTEDARVELKSYNETIPMGSLAIGVDNIHHDV |
| Ga0070693_1007494951 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MAYEILTPSLTEAARIELKSYNVTIPMGSLAIGVDNIHHDVFLSPR |
| Ga0066670_100530281 | 3300005560 | Soil | MSNELLTLIATEEARTELTSYNVTIPMASLAIGVDNI |
| Ga0066694_100957313 | 3300005574 | Soil | MLNEILAPSPSEQARPELKSYNVTIPMESLAIGVDNIHHD |
| Ga0070761_102008363 | 3300005591 | Soil | VRRDDMAPELLTLNPTEDARVELKSYNETIPMGSLAIGVDNIHHDVF |
| Ga0070761_104533901 | 3300005591 | Soil | MADETLTLGAAEASRIELKSYSTTIPMGSLSIGVD |
| Ga0066788_101942892 | 3300005944 | Soil | MANASLSLTPSATEASRVELKSYNVTIPMGSLSIGVDNIHHDVFLSP |
| Ga0080027_102893271 | 3300005993 | Prmafrost Soil | MAYETLTLSAAEAPKTELKSYTATIPMGSLAIGVDNIHHDIFLSPKLVQGTQDYL |
| Ga0066651_100174421 | 3300006031 | Soil | MLNEILAPSPTEQARPELKSYNVTIPMESLAIGVDNIHH |
| Ga0075023_1003091212 | 3300006041 | Watersheds | MAYEILTPIATEEARIELKSYNTTIPMGSLAIGVDNIHHDVFLSPKFV |
| Ga0075023_1004907981 | 3300006041 | Watersheds | MANELATPSASESARIELKSYNVTIPMGSLAIGVDNIHHDVFLS |
| Ga0075014_1001511011 | 3300006174 | Watersheds | MANDLALFSSSDATGIELKSYNVSIPMGSLSIGVDNIHHDVYLSPKFVQATSDY |
| Ga0066658_106420941 | 3300006794 | Soil | MPNELLTTSATEEALNELKSYNGTSPMASLAIGVDNIHHDVFLSPMFVQ |
| Ga0066665_110368892 | 3300006796 | Soil | MLNEILAPSPTEQARPELKSYNVTIPMESLAIGVDNIHHDVFLS |
| Ga0079221_111561902 | 3300006804 | Agricultural Soil | MVNSILIPSQADAPSTELKSYNTTIPMGSLSIGVDNIH |
| Ga0099793_101565703 | 3300007258 | Vadose Zone Soil | MLNELLAPSANEEARTELKSYNVTIPMGSLAIGVDNIHHDVFLSP |
| Ga0099794_101104403 | 3300007265 | Vadose Zone Soil | MANELSTSGAGEAARIELKSYNVTIPMGSLSIGVDNI |
| Ga0099794_102007433 | 3300007265 | Vadose Zone Soil | MVNSIFTPSATEAAGIELKSYNTTIPMGSLAIGVDNIHHDVFL |
| Ga0099794_105880971 | 3300007265 | Vadose Zone Soil | MANELLTLTPAEEARPELKSYNVTIPMGSLAIGVDNIHHDVF |
| Ga0099794_107636262 | 3300007265 | Vadose Zone Soil | MTNELASPSASEAARIDLKSYNVTIPMGALSIGVG |
| Ga0099794_108018661 | 3300007265 | Vadose Zone Soil | MVNSILMPSATEAARIELKRYNTTVPMGSVSIGVDNIHHDVFLSPRFVQA |
| Ga0099829_107247823 | 3300009038 | Vadose Zone Soil | MLNELLAPSATEEARTELRRYNVTIPMGSLAIGVDNIHHD |
| Ga0099829_108720642 | 3300009038 | Vadose Zone Soil | MQMELLSAGQTETARMELKRYDVRIPMGTLAIGVDNIHHDVFLS |
| Ga0099830_101194343 | 3300009088 | Vadose Zone Soil | MANESSSPSAAEAARIELKSYDVTIPMGSLAIGVDNIHHDVFLSP |
| Ga0099828_113950402 | 3300009089 | Vadose Zone Soil | MLNELLTPSATEEARTELKSYNVTIPMGSLAIGVDNIHHDVFL |
| Ga0099828_118511071 | 3300009089 | Vadose Zone Soil | MPNELLTPSATEEALTELKSYNVTIPMGSLAIGVDNIHHDVF |
| Ga0099827_102057073 | 3300009090 | Vadose Zone Soil | MPNELLTPSATEEALTELKSYSVTIPMGSLAIGVDNIHHDVFL |
| Ga0126380_116081802 | 3300010043 | Tropical Forest Soil | MAPELLTLNPTEDARVELKSYNETIPMGSLAIGVDNIHH |
| Ga0134067_100014885 | 3300010321 | Grasslands Soil | MLNEILAPSPTEQARPELKSYNVTIPMDSLAIGVDNTHHDVS* |
| Ga0074046_105444691 | 3300010339 | Bog Forest Soil | MANLQVAPGVSEAALIELKSYSVALPMGTLSIGVDNVHHDVFLSPRFSQAA |
| Ga0126376_131359911 | 3300010359 | Tropical Forest Soil | MPIDSLIPAPEMAQIELKSFSLTLPMGTLAIGVDNIHHNVFLSPK |
| Ga0126378_109393801 | 3300010361 | Tropical Forest Soil | MATELVPPIAQAPGQIELKSYNVALPMASLSIGVDNIHHDVFLSPKFVQAA |
| Ga0134128_105270273 | 3300010373 | Terrestrial Soil | MADEILTLGVAEAARIELKSYNVTIPMGSLSIGVDNIH |
| Ga0126381_1051557442 | 3300010376 | Tropical Forest Soil | MPNEPSTSSASEASRIDLKSYGLTLPMGTLAIGVDNIHHDVFLS |
| Ga0137391_111561762 | 3300011270 | Vadose Zone Soil | MANELATPSAAEAARSELKSYNVTIPMGSLAIGVDNIHHD |
| Ga0137393_105478873 | 3300011271 | Vadose Zone Soil | MLNELLTPSATEEARTELKSYNVTIPMGSLAIGVDNI |
| Ga0137389_110313812 | 3300012096 | Vadose Zone Soil | MLNELLALSATEEDRTELQRYNVTIPMGSLAIGVDNIHHDVFFSPRFV |
| Ga0137389_111018071 | 3300012096 | Vadose Zone Soil | MLNELLAPSAAEEARTQLKSYNVTIPMGSLAIGVDNIHHDV |
| Ga0137389_115425711 | 3300012096 | Vadose Zone Soil | MLNELLAPSATEEARNELQRYNVTIPMGSLAIGVDNIHHDVFFSPRFVQAAR |
| Ga0137388_111185752 | 3300012189 | Vadose Zone Soil | MLNELLAPSATEEARTELRRYNVTIPMGSLAIGVDNIHHDVFFSPRFVQAAR |
| Ga0137383_112972902 | 3300012199 | Vadose Zone Soil | MANESSSPSAPEAARIELKSYDVTIPMGSLAIGVDNI |
| Ga0137382_101437991 | 3300012200 | Vadose Zone Soil | MSIELLTLIATEEARTELTSYNVTIPMASLAIGVDNIHHDVF |
| Ga0137363_102126403 | 3300012202 | Vadose Zone Soil | MANELASPSAGEAARIDLKSYNVTIPMGSLSIGVDNIHHDVFL |
| Ga0137399_115299401 | 3300012203 | Vadose Zone Soil | MLNELLAPSANEEARTELKSYNVTIPMGSLAIGVDNIHHDVFLSPK |
| Ga0137399_117376801 | 3300012203 | Vadose Zone Soil | MANELASPSAGEAARIDLKSYNVTIPMGSLSIGVDNIHHDVFLSPK |
| Ga0137381_109995042 | 3300012207 | Vadose Zone Soil | MTNESSSPSAAEAARIELKSYDVTIPMGSLAIGVDNIHHDVF |
| Ga0137370_109637912 | 3300012285 | Vadose Zone Soil | MSNELLTLIATEEARTELTSYNVTIPMASLAIGVDNIHHDVFLSPKFV |
| Ga0137360_101804001 | 3300012361 | Vadose Zone Soil | MANESSSPSAAEAARIELKSYDVTIPMGSLAIGVDNI |
| Ga0137360_106037063 | 3300012361 | Vadose Zone Soil | MVNSVLTPSATGAVRIELKSYNTTLPMGSLAIGVDNIHHDVFLSPRFV |
| Ga0137360_107303912 | 3300012361 | Vadose Zone Soil | MANELLTLTPAEEARPELKSYNVTIPMGSLAIGVDNIHHDVFL |
| Ga0137358_110307282 | 3300012582 | Vadose Zone Soil | MPNELLTTSATEEALTELKSYNVTIPMGSLAIGVDNIHHDV |
| Ga0137396_107158062 | 3300012918 | Vadose Zone Soil | MVNSILTPSKTEAARIELKSYNTTIPMGSLAIGVDNIHH |
| Ga0137394_106668593 | 3300012922 | Vadose Zone Soil | MANELSTSGAGEAARIELKSYNVTIPMGSLAIGVDNIHHDVFLSPKF |
| Ga0137413_109915791 | 3300012924 | Vadose Zone Soil | MSNELLTLGAAEEARTELKSYNVTLPMGSLAIGVDNIHH |
| Ga0137416_114632402 | 3300012927 | Vadose Zone Soil | MVNSILTPSTTEAARIELKSYSTTIPMGSLAIGVDNIHHDVFLS |
| Ga0137404_111513072 | 3300012929 | Vadose Zone Soil | MPNELLIPSAAEEARTELKSYNVTLPMGSLAIGVDNIHHD |
| Ga0137404_111909152 | 3300012929 | Vadose Zone Soil | MPNELLIPSAAEEARTELKSYNVTLPMGSLAIGVDNI |
| Ga0137404_121592162 | 3300012929 | Vadose Zone Soil | MVNSILTPSATEAARIELKSYSTTIPMGSLAIGVD |
| Ga0137407_104460693 | 3300012930 | Vadose Zone Soil | MPNELLIPSAAEEARTELKSYNVTLPMGSLAIGVDNIHH |
| Ga0120132_11553982 | 3300013832 | Permafrost | MANLTLIPSPAEAARAELKSYNVTIPMGTLSIGVDNIHHD |
| Ga0157379_104712673 | 3300014968 | Switchgrass Rhizosphere | MAPELLTLNPTEDARVELKSYNETIPMGSLAIGVDNIHHDVFLSP |
| Ga0137411_132135210 | 3300015052 | Vadose Zone Soil | MPNELLIPSATEEARTELQSYNVTIPMGSLSIGVDNIHHDVFLSPRSSRRPATISST* |
| Ga0137405_10725311 | 3300015053 | Vadose Zone Soil | MANELASPIAGEAARIDLKSYNVTIPMGSLYGVAVD |
| Ga0137409_100381671 | 3300015245 | Vadose Zone Soil | MTNELASPSASEAARIDLKSYNVTIPMGSLSIGVDN |
| Ga0137409_100738084 | 3300015245 | Vadose Zone Soil | MANELASPSAGEAARIDLKSYNVTIPMGSLSIGVDN |
| Ga0187825_102944322 | 3300017930 | Freshwater Sediment | MADETLTLGVAEAARIELKSYNVTIPMGSLSIGVDNIHHD |
| Ga0187825_104414981 | 3300017930 | Freshwater Sediment | MANGILTLSSGEASGIELKSYSVTLPMGSLAIGVDNIHHDVF |
| Ga0187821_101537672 | 3300017936 | Freshwater Sediment | MADEILTLGVADAARVELKNYNVTIPMGSLSIGVDNIHHDVFLSPK |
| Ga0066655_109761011 | 3300018431 | Grasslands Soil | MAYEILTPCLTEAARTELKTYSVTVPMVSLASGAENIHH |
| Ga0137408_11299472 | 3300019789 | Vadose Zone Soil | MANELSSPSAGDAARIELQSYNVTIPMGSLAIGVDNIH |
| Ga0193728_12312642 | 3300019890 | Soil | MANLSLMPIATEAARAELKRYNVTIPMGSLSIGVDNIHHDVFISPKFAHAARD |
| Ga0179594_101096731 | 3300020170 | Vadose Zone Soil | MANELASPIAGEAARIDLKSYNVTIPMGSLSIGVDNIHHDVFLSP |
| Ga0210407_101638723 | 3300020579 | Soil | MANGILTLSSGNAGGIELKSYNVNLPMGSLAIGVDNIHHDVYLSPRFL |
| Ga0210407_106780651 | 3300020579 | Soil | MADETLTLGVALAARVELKSYNVTIPMGSLSIGVDNIHHDVFFSPKFAQAARDY |
| Ga0210403_111771641 | 3300020580 | Soil | MVNSILTPSATEAARIELKSYNTTIPMASLSIGVDNIH |
| Ga0215015_106324333 | 3300021046 | Soil | MVNSILMPSATEAARIELKRYNTTIPMGSVSIGVDLSL |
| Ga0210388_100153011 | 3300021181 | Soil | MANELALPSASESARIELKSYNVTIPMGSLSIGVDNIHHDV |
| Ga0210393_102756563 | 3300021401 | Soil | MPDETLTLGVVEAARIELKSYNVTIPMGSLSIGVDN |
| Ga0210389_113516531 | 3300021404 | Soil | MADETLTLGVAVAARVELKSYNVTIPMGSLSIGVDNIHH |
| Ga0210384_103860201 | 3300021432 | Soil | MADETLTLGVALAARVELKSYNVTIPMGSLSIGVDN |
| Ga0210390_109519311 | 3300021474 | Soil | MPDETLTLGVIEAARIELKSYNVTIPMGSLSIGVDNI |
| Ga0210402_113061711 | 3300021478 | Soil | MATELLISSAADPARIDLKSYNVTIPMGSLSIGVDNIHHDVFLS |
| Ga0210410_103366431 | 3300021479 | Soil | MPDETLTLGVVEAARIELKSYNVTIPMGSLSIGVDNI |
| Ga0210409_102953503 | 3300021559 | Soil | MSNELLAPAAAEETGSELKSYNVTIPMGSLAIGVDNIHH |
| Ga0247669_10149303 | 3300024182 | Soil | MADEILTLGVAEAARIELKSYNVTIPMGSLSIGVDNI |
| Ga0247687_10141251 | 3300024286 | Soil | MADVILTLGVAEAARIELKSYNVTIPMGSLSIGVDNIH |
| Ga0137417_14471664 | 3300024330 | Vadose Zone Soil | MVNSILTPSAPGAAGIELKSYNTTIPMGSLAIGVDNIHHDVFLSPDSSRPRANII |
| Ga0209377_10729811 | 3300026334 | Soil | MLNEILSPSPTEQARPELKSYNVTIPMESLAIGVDNIHHD |
| Ga0209156_100479173 | 3300026547 | Soil | MLNEILAPSPTEQARPELKSYNVTIPMESLAIGVDNIHHD |
| Ga0179587_105222711 | 3300026557 | Vadose Zone Soil | MANELASPSAGEAARIDLKSYNVTIPMGSLSIGVDNI |
| Ga0209735_10688721 | 3300027562 | Forest Soil | MQSLLVECMANLSLMPIATEAARTELKRYNVTIPMGSLSIGVDNIHHD |
| Ga0209527_10826352 | 3300027583 | Forest Soil | MANLSLMASATEAARTELKRYNVTIPMGSLSIGVDNIHHDVFMSPKFAQA |
| Ga0209448_100839681 | 3300027783 | Bog Forest Soil | MADESLTLGVAEASRIELKSYNVTIPMGSLSIGVDNIHHDVFLSSKFVQ |
| Ga0209180_103397283 | 3300027846 | Vadose Zone Soil | MLNELLSPSATEEARTELRRYNVTIPMGSLAIGVDNIHHDVFF |
| Ga0209701_101260463 | 3300027862 | Vadose Zone Soil | MLNELLALSATEEDRTELQRYNVTIPMGSLAIGVDN |
| Ga0209283_103226721 | 3300027875 | Vadose Zone Soil | MPNELLTPSATEESRTELKSYNVTIPMGSLAIGVDN |
| Ga0209069_108975651 | 3300027915 | Watersheds | MPNELLIPSAAEEARTELKSYNVTLPMGSLAIGVDN |
| Ga0222749_100215951 | 3300029636 | Soil | MPDETLTLGVVEAPRIELKSYNVTIPMGSLSIGVDNIHHDV |
| Ga0302181_100228241 | 3300030056 | Palsa | MADIQVAPGTSEAALIELKSYNLTLPMGTLAIGVDNIHHDVFLSP |
| Ga0073994_123078041 | 3300030991 | Soil | MANLSLMPIATEAARTELKRYNVTIPMGSLSIGVDNIHHDVFLS |
| Ga0307474_108924162 | 3300031718 | Hardwood Forest Soil | MANAQAPPGPSDTALIELKSYNLTIPMGTLSIGVDNIHHDVFLSPRFLQS |
| Ga0307469_101316271 | 3300031720 | Hardwood Forest Soil | MANELASPSAGEAARIDLKSYNVTIPMGSLSIGVDNIHHDVFLSPKF |
| Ga0307473_107980342 | 3300031820 | Hardwood Forest Soil | MTNELASPSASEAARIDLKSYNVTIPMGSLSIGVDNI |
| Ga0307479_114247841 | 3300031962 | Hardwood Forest Soil | MAIEIETPSTAATGRFELKSYNVTIPMGSLAIGVDNIHHDVFLSPKF |
| Ga0307471_1009136101 | 3300032180 | Hardwood Forest Soil | MVNSILTPSTTEAARIELKSYNTTIPMGSLAIGVDN |
| Ga0335072_112708881 | 3300032898 | Soil | MADESLTLGVAEAARIELKSYSVTIPMGSLAIGVDNIHHDV |
| Ga0314862_0127760_3_122 | 3300033803 | Peatland | MDLATPGVSDEKRLQLESYNTTIPMASLAIGVDNIHHDVF |
| ⦗Top⦘ |