| Basic Information | |
|---|---|
| Family ID | F083093 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Number of Associated Samples | 45 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 74.34 % |
| Associated GOLD sequencing projects | 37 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.796 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (71.681 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.062 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (82.301 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 20.90% Coil/Unstructured: 74.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 2.68 |
| PF05685 | Uma2 | 2.68 |
| PF00400 | WD40 | 2.68 |
| PF05593 | RHS_repeat | 1.79 |
| PF03050 | DDE_Tnp_IS66 | 1.79 |
| PF01797 | Y1_Tnp | 1.79 |
| PF00004 | AAA | 0.89 |
| PF16864 | Dimerisation2 | 0.89 |
| PF13546 | DDE_5 | 0.89 |
| PF13384 | HTH_23 | 0.89 |
| PF02599 | CsrA | 0.89 |
| PF13899 | Thioredoxin_7 | 0.89 |
| PF07510 | DUF1524 | 0.89 |
| PF09286 | Pro-kuma_activ | 0.89 |
| PF04221 | RelB | 0.89 |
| PF00069 | Pkinase | 0.89 |
| PF00753 | Lactamase_B | 0.89 |
| PF01934 | HepT-like | 0.89 |
| PF09339 | HTH_IclR | 0.89 |
| PF10882 | bPH_5 | 0.89 |
| PF08814 | XisH | 0.89 |
| PF13676 | TIR_2 | 0.89 |
| PF12765 | Cohesin_HEAT | 0.89 |
| PF10431 | ClpB_D2-small | 0.89 |
| PF04313 | HSDR_N | 0.89 |
| PF05025 | RbsD_FucU | 0.89 |
| PF04851 | ResIII | 0.89 |
| PF13481 | AAA_25 | 0.89 |
| PF00072 | Response_reg | 0.89 |
| PF02604 | PhdYeFM_antitox | 0.89 |
| PF13088 | BNR_2 | 0.89 |
| PF01155 | HypA | 0.89 |
| PF04255 | DUF433 | 0.89 |
| PF01420 | Methylase_S | 0.89 |
| PF13561 | adh_short_C2 | 0.89 |
| PF01436 | NHL | 0.89 |
| PF01381 | HTH_3 | 0.89 |
| PF13432 | TPR_16 | 0.89 |
| PF02384 | N6_Mtase | 0.89 |
| PF04542 | Sigma70_r2 | 0.89 |
| PF05015 | HigB-like_toxin | 0.89 |
| PF02801 | Ketoacyl-synt_C | 0.89 |
| PF08388 | GIIM | 0.89 |
| PF09209 | CecR_C | 0.89 |
| PF00211 | Guanylate_cyc | 0.89 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.57 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.68 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.68 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.68 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 2.68 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.68 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.68 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.68 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 1.79 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.79 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.79 |
| COG1551 | sRNA-binding carbon storage regulator CsrA | Signal transduction mechanisms [T] | 0.89 |
| COG0375 | Hydrogenase maturation factor HypA/HybF, metallochaperone involved in Ni insertion | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.89 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.89 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.89 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.89 |
| COG4154 | L-fucose mutarotase/ribose pyranase, RbsD/FucU family | Carbohydrate transport and metabolism [G] | 0.89 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.89 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.89 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.89 |
| COG3077 | Antitoxin component of the RelBE or YafQ-DinJ toxin-antitoxin module | Defense mechanisms [V] | 0.89 |
| COG1869 | D-ribose pyranose/furanose isomerase RbsD | Carbohydrate transport and metabolism [G] | 0.89 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.89 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.89 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.89 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.89 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.80 % |
| Unclassified | root | N/A | 29.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10007877 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 7322 | Open in IMG/M |
| 3300000567|JGI12270J11330_10033679 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300000567|JGI12270J11330_10119047 | Not Available | 1082 | Open in IMG/M |
| 3300004477|Ga0068971_1548897 | Not Available | 533 | Open in IMG/M |
| 3300004604|Ga0068943_1313241 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006174|Ga0075014_100363651 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300009519|Ga0116108_1095835 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 901 | Open in IMG/M |
| 3300009520|Ga0116214_1020538 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2356 | Open in IMG/M |
| 3300009520|Ga0116214_1038845 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300009520|Ga0116214_1278448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300009520|Ga0116214_1278953 | Not Available | 638 | Open in IMG/M |
| 3300009520|Ga0116214_1309374 | Not Available | 607 | Open in IMG/M |
| 3300009520|Ga0116214_1352795 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300009522|Ga0116218_1247281 | Not Available | 801 | Open in IMG/M |
| 3300009522|Ga0116218_1496667 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 544 | Open in IMG/M |
| 3300009524|Ga0116225_1037177 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300009525|Ga0116220_10130550 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300009525|Ga0116220_10327794 | All Organisms → cellular organisms → Bacteria → PVC group | 677 | Open in IMG/M |
| 3300009630|Ga0116114_1021146 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1963 | Open in IMG/M |
| 3300009630|Ga0116114_1070342 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 960 | Open in IMG/M |
| 3300009640|Ga0116126_1231386 | Not Available | 584 | Open in IMG/M |
| 3300009672|Ga0116215_1257474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 763 | Open in IMG/M |
| 3300009683|Ga0116224_10141250 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300009683|Ga0116224_10219995 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300009698|Ga0116216_10178760 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 1303 | Open in IMG/M |
| 3300009698|Ga0116216_10688410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 614 | Open in IMG/M |
| 3300009700|Ga0116217_10108458 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 1892 | Open in IMG/M |
| 3300009824|Ga0116219_10806014 | Not Available | 512 | Open in IMG/M |
| 3300009824|Ga0116219_10806674 | Not Available | 512 | Open in IMG/M |
| 3300009824|Ga0116219_10812194 | Not Available | 510 | Open in IMG/M |
| 3300009839|Ga0116223_10409722 | Not Available | 797 | Open in IMG/M |
| 3300009839|Ga0116223_10535066 | Not Available | 680 | Open in IMG/M |
| 3300009839|Ga0116223_10615466 | Not Available | 626 | Open in IMG/M |
| 3300009839|Ga0116223_10825683 | Not Available | 530 | Open in IMG/M |
| 3300010339|Ga0074046_10341538 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 913 | Open in IMG/M |
| 3300010339|Ga0074046_10377477 | Not Available | 859 | Open in IMG/M |
| 3300010339|Ga0074046_10476861 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300010341|Ga0074045_10125623 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300010341|Ga0074045_10381142 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 916 | Open in IMG/M |
| 3300010341|Ga0074045_10811756 | Not Available | 591 | Open in IMG/M |
| 3300010343|Ga0074044_10011484 | All Organisms → cellular organisms → Bacteria | 6683 | Open in IMG/M |
| 3300010343|Ga0074044_10475161 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 817 | Open in IMG/M |
| 3300010379|Ga0136449_100016150 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 19669 | Open in IMG/M |
| 3300010379|Ga0136449_100029762 | All Organisms → cellular organisms → Bacteria | 13296 | Open in IMG/M |
| 3300010379|Ga0136449_100074054 | All Organisms → cellular organisms → Bacteria | 7260 | Open in IMG/M |
| 3300010379|Ga0136449_100144648 | Not Available | 4687 | Open in IMG/M |
| 3300010379|Ga0136449_100184111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 4011 | Open in IMG/M |
| 3300010379|Ga0136449_100261173 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300010379|Ga0136449_100788703 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1573 | Open in IMG/M |
| 3300010379|Ga0136449_101154997 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 1225 | Open in IMG/M |
| 3300010379|Ga0136449_101654075 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 968 | Open in IMG/M |
| 3300010379|Ga0136449_102176690 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 810 | Open in IMG/M |
| 3300010379|Ga0136449_102810265 | Not Available | 687 | Open in IMG/M |
| 3300010379|Ga0136449_103349554 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 615 | Open in IMG/M |
| 3300010379|Ga0136449_103830174 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 565 | Open in IMG/M |
| 3300011051|Ga0138540_157853 | Not Available | 668 | Open in IMG/M |
| 3300011061|Ga0138534_1010010 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300011077|Ga0138572_1151476 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300014162|Ga0181538_10430934 | Not Available | 700 | Open in IMG/M |
| 3300016319|Ga0182033_12084985 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300017928|Ga0187806_1247507 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 616 | Open in IMG/M |
| 3300018008|Ga0187888_1010884 | All Organisms → cellular organisms → Bacteria | 5373 | Open in IMG/M |
| 3300018008|Ga0187888_1016657 | All Organisms → cellular organisms → Bacteria | 4008 | Open in IMG/M |
| 3300018008|Ga0187888_1087599 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300018008|Ga0187888_1087599 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300018008|Ga0187888_1347925 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300018022|Ga0187864_10040274 | Not Available | 2694 | Open in IMG/M |
| 3300018022|Ga0187864_10057088 | Not Available | 2162 | Open in IMG/M |
| 3300018022|Ga0187864_10118218 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 1353 | Open in IMG/M |
| 3300018086|Ga0187769_11260260 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300018086|Ga0187769_11279573 | Not Available | 555 | Open in IMG/M |
| 3300026959|Ga0207852_1017517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 748 | Open in IMG/M |
| 3300027497|Ga0208199_1023113 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1384 | Open in IMG/M |
| 3300027570|Ga0208043_1020008 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300027604|Ga0208324_1002803 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 6432 | Open in IMG/M |
| 3300027604|Ga0208324_1013443 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
| 3300027604|Ga0208324_1040921 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1371 | Open in IMG/M |
| 3300027625|Ga0208044_1013369 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
| 3300027625|Ga0208044_1166950 | Not Available | 603 | Open in IMG/M |
| 3300027625|Ga0208044_1217985 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera | 505 | Open in IMG/M |
| 3300027641|Ga0208827_1034735 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1779 | Open in IMG/M |
| 3300027662|Ga0208565_1015005 | All Organisms → cellular organisms → Bacteria | 2944 | Open in IMG/M |
| 3300027662|Ga0208565_1238972 | Not Available | 508 | Open in IMG/M |
| 3300030494|Ga0310037_10016395 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 3581 | Open in IMG/M |
| 3300030494|Ga0310037_10070152 | Not Available | 1649 | Open in IMG/M |
| 3300030494|Ga0310037_10136910 | Not Available | 1117 | Open in IMG/M |
| 3300030494|Ga0310037_10336260 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300030494|Ga0310037_10430807 | Not Available | 542 | Open in IMG/M |
| 3300030494|Ga0310037_10458158 | Not Available | 521 | Open in IMG/M |
| 3300030706|Ga0310039_10006429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6811 | Open in IMG/M |
| 3300030706|Ga0310039_10058384 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 1690 | Open in IMG/M |
| 3300030706|Ga0310039_10364806 | Not Available | 536 | Open in IMG/M |
| 3300031234|Ga0302325_11076661 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1087 | Open in IMG/M |
| 3300031524|Ga0302320_12097361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 526 | Open in IMG/M |
| 3300032160|Ga0311301_10004817 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 47971 | Open in IMG/M |
| 3300032160|Ga0311301_10009578 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 31337 | Open in IMG/M |
| 3300032160|Ga0311301_10012570 | All Organisms → cellular organisms → Bacteria | 26272 | Open in IMG/M |
| 3300032160|Ga0311301_10055106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 8915 | Open in IMG/M |
| 3300032160|Ga0311301_10160932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 4010 | Open in IMG/M |
| 3300032160|Ga0311301_10208161 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → Pirellula staleyi | 3331 | Open in IMG/M |
| 3300032160|Ga0311301_10245822 | Not Available | 2961 | Open in IMG/M |
| 3300032160|Ga0311301_10801096 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300032160|Ga0311301_10872705 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300032160|Ga0311301_11234660 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 953 | Open in IMG/M |
| 3300032160|Ga0311301_11468032 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300032160|Ga0311301_11517964 | Not Available | 824 | Open in IMG/M |
| 3300032160|Ga0311301_11669287 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 769 | Open in IMG/M |
| 3300032160|Ga0311301_11785435 | Not Available | 734 | Open in IMG/M |
| 3300032160|Ga0311301_12088293 | Not Available | 656 | Open in IMG/M |
| 3300032160|Ga0311301_12301354 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 613 | Open in IMG/M |
| 3300032896|Ga0335075_11245388 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera borealis | 641 | Open in IMG/M |
| 3300033405|Ga0326727_10305207 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 1563 | Open in IMG/M |
| 3300033818|Ga0334804_132954 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera | 626 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 71.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.08% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 7.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004604 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011051 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100078771 | 3300000567 | Peatlands Soil | FTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV* |
| JGI12270J11330_100336796 | 3300000567 | Peatlands Soil | FTYPGTSLRLVYSLAGEAETPNSVPHQNPADQKV* |
| JGI12270J11330_101190472 | 3300000567 | Peatlands Soil | HLLEHLNAAEFTYPGTSLRLVYSLAGEAETPNLVPH* |
| Ga0068971_15488971 | 3300004477 | Peatlands Soil | LLEHLNAAEFTYPGTSLRLVNSLAGEAETPNSVPHQNPADQEV* |
| Ga0068943_13132412 | 3300004604 | Peatlands Soil | HLLEHLNAAEFTYPGTKLQLVYSIAGEAEIPNSVPQQNPTDQEV* |
| Ga0075014_1003636513 | 3300006174 | Watersheds | FTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV* |
| Ga0116108_10958351 | 3300009519 | Peatland | FTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI* |
| Ga0116214_10205381 | 3300009520 | Peatlands Soil | AAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV* |
| Ga0116214_10388454 | 3300009520 | Peatlands Soil | LLEHLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQKV* |
| Ga0116214_12784483 | 3300009520 | Peatlands Soil | AEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV* |
| Ga0116214_12789531 | 3300009520 | Peatlands Soil | LNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV* |
| Ga0116214_13093742 | 3300009520 | Peatlands Soil | AAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV* |
| Ga0116214_13527951 | 3300009520 | Peatlands Soil | EFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV* |
| Ga0116218_12472813 | 3300009522 | Peatlands Soil | AEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV* |
| Ga0116218_14966672 | 3300009522 | Peatlands Soil | LNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV* |
| Ga0116225_10371772 | 3300009524 | Peatlands Soil | AEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV* |
| Ga0116220_101305501 | 3300009525 | Peatlands Soil | AAEFTYPGTKLQLVYSIAGEAEIPNSVPQQNPTDQEV* |
| Ga0116220_103277942 | 3300009525 | Peatlands Soil | HLLEHLNAAEFPYPGTNLRLVYSIAGEAETPNLAPHQNPADQEV* |
| Ga0116114_10211464 | 3300009630 | Peatland | NATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI* |
| Ga0116114_10703422 | 3300009630 | Peatland | EFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI* |
| Ga0116126_12313861 | 3300009640 | Peatland | LNATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI* |
| Ga0116215_12574741 | 3300009672 | Peatlands Soil | LNAAECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV* |
| Ga0116224_101412501 | 3300009683 | Peatlands Soil | EHLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQKV* |
| Ga0116224_102199951 | 3300009683 | Peatlands Soil | RAIAHLLEHLNAAEFPYPGTNLRLIYSIAGEAETPNLVPHQNPADQEV* |
| Ga0116216_101787602 | 3300009698 | Peatlands Soil | FTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV* |
| Ga0116216_106884101 | 3300009698 | Peatlands Soil | NAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV* |
| Ga0116217_101084581 | 3300009700 | Peatlands Soil | AECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV* |
| Ga0116219_108060141 | 3300009824 | Peatlands Soil | NAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV* |
| Ga0116219_108066741 | 3300009824 | Peatlands Soil | NAAEFPYPGTNLRLVYSIAGEPETPNLAPHQNPADQEV* |
| Ga0116219_108121941 | 3300009824 | Peatlands Soil | AEFTYPGTKLQLVYSIAGEAETPNSVPQRNPTDQEV* |
| Ga0116223_104097221 | 3300009839 | Peatlands Soil | HLLEHLNAAEFPYPGTNLRLIYSIAGEAETPNLVPHQNPADQEV* |
| Ga0116223_105350662 | 3300009839 | Peatlands Soil | ECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV* |
| Ga0116223_106154661 | 3300009839 | Peatlands Soil | EFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV* |
| Ga0116223_108256831 | 3300009839 | Peatlands Soil | FTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV* |
| Ga0074046_103415382 | 3300010339 | Bog Forest Soil | LLEHLNAAEFTYPGTKLQLVYSIAGEAQTPNSVPQQNPTDQEV* |
| Ga0074046_103774772 | 3300010339 | Bog Forest Soil | HLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV* |
| Ga0074046_104768612 | 3300010339 | Bog Forest Soil | AAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV* |
| Ga0074045_101256231 | 3300010341 | Bog Forest Soil | LNAAEFTYPGTSLRLVYSLASEAQTPNSVPQQNPTDQEV* |
| Ga0074045_103811422 | 3300010341 | Bog Forest Soil | LNGAEFTYPGTSLQLVYSLAGEAETSNSAPRQNPTDQEA* |
| Ga0074045_108117562 | 3300010341 | Bog Forest Soil | FTYPGTKLQLVYSIAGEAETPNSVPQRNPTDQEV* |
| Ga0074044_100114841 | 3300010343 | Bog Forest Soil | NAAEFTYPGTSLRLVYSLASEAQTPNSVPQQNPTDQEV* |
| Ga0074044_104751611 | 3300010343 | Bog Forest Soil | HLNASEFTYPGTSLQLVYSLAGEGETPNLAPYLNPADQEV* |
| Ga0136449_1000161501 | 3300010379 | Peatlands Soil | HLNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV* |
| Ga0136449_1000297621 | 3300010379 | Peatlands Soil | LNAAEFTYPGTNLRLVYSITGQAETPDLAPDQNPADQEV* |
| Ga0136449_1000740545 | 3300010379 | Peatlands Soil | NAAEFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV* |
| Ga0136449_1001446482 | 3300010379 | Peatlands Soil | LNAAEFPYPGTNLRLVYSIAGEPETPNLAPHQNPADQEV* |
| Ga0136449_1001841111 | 3300010379 | Peatlands Soil | NAAECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV* |
| Ga0136449_1002611731 | 3300010379 | Peatlands Soil | LNAAEFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV* |
| Ga0136449_1007887032 | 3300010379 | Peatlands Soil | FSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV* |
| Ga0136449_1011549973 | 3300010379 | Peatlands Soil | QLNAAEFTYPGTSLRLVYSIAGQAGPTNLDSAQNPADQEV* |
| Ga0136449_1016540752 | 3300010379 | Peatlands Soil | NAAEFTYPGTNLRLVYSIAGGAETPNLAPDQNPADQEV* |
| Ga0136449_1021766902 | 3300010379 | Peatlands Soil | AIAHLLEHLNAAEFPYPGTNLRLVYSIAGEAETPNLAPHQNPADQEV* |
| Ga0136449_1028102651 | 3300010379 | Peatlands Soil | EFTYPGTKLQLVYSIAGEAQTPNSVPQQNPTDQEV* |
| Ga0136449_1033495541 | 3300010379 | Peatlands Soil | LNATEFTYPGTELRLVYSIAGEAENPSSAPHQNPAGQDF* |
| Ga0136449_1038301741 | 3300010379 | Peatlands Soil | NAAEFTYPGTNLRLVYSITGQAETPDLAPDQNPADQEV* |
| Ga0138540_1578532 | 3300011051 | Peatlands Soil | IAHLLEHLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV* |
| Ga0138534_10100101 | 3300011061 | Peatlands Soil | AAEFTYPGTKLQLVYSIAGEAQTPNSVPQQNPTDQEV* |
| Ga0138572_11514762 | 3300011077 | Peatlands Soil | AEFTYPGTKLQLVYSIAGEVETPNSVPQQNPTDQEV* |
| Ga0181538_104309342 | 3300014162 | Bog | LLEHLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV* |
| Ga0182033_120849852 | 3300016319 | Soil | HLNAAEFKYPGTNLRLVYSIAGLVEMPELAPDQNPANQEV |
| Ga0187806_12475071 | 3300017928 | Freshwater Sediment | LNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0187888_10108849 | 3300018008 | Peatland | NATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI |
| Ga0187888_10166575 | 3300018008 | Peatland | EFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI |
| Ga0187888_10875991 | 3300018008 | Peatland | NATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEIWACGQ |
| Ga0187888_10875994 | 3300018008 | Peatland | LNATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI |
| Ga0187888_13479251 | 3300018008 | Peatland | ATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI |
| Ga0187864_100402741 | 3300018022 | Peatland | AAEFPYPGTNLRLIYSIAGEAETPNLVPHQNPADQEV |
| Ga0187864_100570882 | 3300018022 | Peatland | LEHLNAAEFPYPGTNLRLVYSIAGEAETPNLAPHQNPADQEV |
| Ga0187864_101182181 | 3300018022 | Peatland | LLEHLNAAEFPYPGTNLRLIYSIAGEAETPNLVPHQNPADHEV |
| Ga0187769_112602602 | 3300018086 | Tropical Peatland | EHLNATEFTYPGTELRLVYSIAGEAESPSPAPHQNPAGQEV |
| Ga0187769_112795731 | 3300018086 | Tropical Peatland | AEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0207852_10175172 | 3300026959 | Tropical Forest Soil | HLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0208199_10231131 | 3300027497 | Peatlands Soil | HLNAAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV |
| Ga0208043_10200083 | 3300027570 | Peatlands Soil | HLNAAQFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0208324_10028038 | 3300027604 | Peatlands Soil | EHLNAAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV |
| Ga0208324_10134435 | 3300027604 | Peatlands Soil | HLNAAEFTYPGTKLQLVYSIAGEAEIPNSVPQQNPTDQEV |
| Ga0208324_10409211 | 3300027604 | Peatlands Soil | EFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV |
| Ga0208044_10133694 | 3300027625 | Peatlands Soil | AEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV |
| Ga0208044_11669501 | 3300027625 | Peatlands Soil | EFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0208044_12179851 | 3300027625 | Peatlands Soil | LNAAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV |
| Ga0208827_10347353 | 3300027641 | Peatlands Soil | AAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0208565_10150051 | 3300027662 | Peatlands Soil | HLLEHLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQKV |
| Ga0208565_12389722 | 3300027662 | Peatlands Soil | NAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0310037_100163951 | 3300030494 | Peatlands Soil | HLNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV |
| Ga0310037_100701521 | 3300030494 | Peatlands Soil | LNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV |
| Ga0310037_101369102 | 3300030494 | Peatlands Soil | NAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV |
| Ga0310037_103362601 | 3300030494 | Peatlands Soil | EHLNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV |
| Ga0310037_104308071 | 3300030494 | Peatlands Soil | EHLNAAEFTYPGTNLRLVYSITGQAETPDLAPDQNPADQEV |
| Ga0310037_104581581 | 3300030494 | Peatlands Soil | EFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV |
| Ga0310039_100064295 | 3300030706 | Peatlands Soil | NAAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV |
| Ga0310039_100583844 | 3300030706 | Peatlands Soil | EHLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0310039_103648061 | 3300030706 | Peatlands Soil | LNAAEFTYPGTKLQLVYSIAGEAEIPNSVPQQNPTDQEV |
| Ga0302325_110766611 | 3300031234 | Palsa | MSTPQSHRAIAHLLEHLNAAEFTDLDTDLPLVYSIAGQAEIPNLAPHQNPADQEV |
| Ga0302320_120973611 | 3300031524 | Bog | QLNAAEFTYPGTSLQLVYSIAGEAENPNLAPHQNPADQEI |
| Ga0311301_1000481739 | 3300032160 | Peatlands Soil | QLNAAECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV |
| Ga0311301_100095781 | 3300032160 | Peatlands Soil | AEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV |
| Ga0311301_100125701 | 3300032160 | Peatlands Soil | LNAAEFTYPGTSLRLVYSIAGDAETPNSAPHQNPTDQEV |
| Ga0311301_100551061 | 3300032160 | Peatlands Soil | QLNAAEFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV |
| Ga0311301_101609326 | 3300032160 | Peatlands Soil | LNAAECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV |
| Ga0311301_102081613 | 3300032160 | Peatlands Soil | AAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV |
| Ga0311301_102458221 | 3300032160 | Peatlands Soil | AAEFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV |
| Ga0311301_108010961 | 3300032160 | Peatlands Soil | EQLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0311301_108727051 | 3300032160 | Peatlands Soil | EQLNAAEFTYPGTSLRLVYSIAGQAGPTNLDSAQNPADQEV |
| Ga0311301_112346602 | 3300032160 | Peatlands Soil | NAAEFTYPGTKLQLVYSIAGEAQTPNSVPQQNPTDQEV |
| Ga0311301_114680322 | 3300032160 | Peatlands Soil | AEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV |
| Ga0311301_115179641 | 3300032160 | Peatlands Soil | LNATEFTYPATNLRLVYSIAGQAATAELAPDQNPVDQEV |
| Ga0311301_116692871 | 3300032160 | Peatlands Soil | EQLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQRNPTDQEV |
| Ga0311301_117854352 | 3300032160 | Peatlands Soil | EQLNAAEFTYPGTSLQLVYSIAGQAETPELAPDQNPADQEV |
| Ga0311301_120882931 | 3300032160 | Peatlands Soil | QLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV |
| Ga0311301_123013542 | 3300032160 | Peatlands Soil | LEHLNAAAFTYPGTNLRLVYSITGQAETPDLAPDQNPADQEV |
| Ga0335075_112453881 | 3300032896 | Soil | LTAAELTYPGTSLQLIYSIAGHAPTPQSVPEQNPPDQEV |
| Ga0326727_103052073 | 3300033405 | Peat Soil | QLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQRNPTDQEV |
| Ga0334804_132954_509_625 | 3300033818 | Soil | NAAEFTYPGTNLRLVYSLAGEAETPNSVPHQNPADQEV |
| ⦗Top⦘ |