Metagenome / Metatranscriptome Family F083093

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F083093
Family Type	Metagenome / Metatranscriptome
Number of Sequences	113
Average Sequence Length	39 residues
Representative Sequence	LNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Number of Associated Samples	45
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	97.35 %
% of genes from short scaffolds (< 2000 bps)	74.34 %
Associated GOLD sequencing projects	37
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (70.796 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (71.681 % of family members)
Environment Ontology (ENVO)	Unclassified (61.062 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (82.301 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.48% β-sheet: 20.90% Coil/Unstructured: 74.63%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.24
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF01609	DDE_Tnp_1	2.68
PF05685	Uma2	2.68
PF00400	WD40	2.68
PF05593	RHS_repeat	1.79
PF03050	DDE_Tnp_IS66	1.79
PF01797	Y1_Tnp	1.79
PF00004	AAA	0.89
PF16864	Dimerisation2	0.89
PF13546	DDE_5	0.89
PF13384	HTH_23	0.89
PF02599	CsrA	0.89
PF13899	Thioredoxin_7	0.89
PF07510	DUF1524	0.89
PF09286	Pro-kuma_activ	0.89
PF04221	RelB	0.89
PF00069	Pkinase	0.89
PF00753	Lactamase_B	0.89
PF01934	HepT-like	0.89
PF09339	HTH_IclR	0.89
PF10882	bPH_5	0.89
PF08814	XisH	0.89
PF13676	TIR_2	0.89
PF12765	Cohesin_HEAT	0.89
PF10431	ClpB_D2-small	0.89
PF04313	HSDR_N	0.89
PF05025	RbsD_FucU	0.89
PF04851	ResIII	0.89
PF13481	AAA_25	0.89
PF00072	Response_reg	0.89
PF02604	PhdYeFM_antitox	0.89
PF13088	BNR_2	0.89
PF01155	HypA	0.89
PF04255	DUF433	0.89
PF01420	Methylase_S	0.89
PF13561	adh_short_C2	0.89
PF01436	NHL	0.89
PF01381	HTH_3	0.89
PF13432	TPR_16	0.89
PF02384	N6_Mtase	0.89
PF04542	Sigma70_r2	0.89
PF05015	HigB-like_toxin	0.89
PF02801	Ketoacyl-synt_C	0.89
PF08388	GIIM	0.89
PF09209	CecR_C	0.89
PF00211	Guanylate_cyc	0.89
PF07592	DDE_Tnp_ISAZ013	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.57
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	2.68
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	2.68
COG5421	Transposase	Mobilome: prophages, transposons [X]	2.68
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	2.68
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	2.68
COG3293	Transposase	Mobilome: prophages, transposons [X]	2.68
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	2.68
COG3209	Uncharacterized conserved protein RhaS, contains 28 RHS repeats	General function prediction only [R]	1.79
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	1.79
COG3436	Transposase	Mobilome: prophages, transposons [X]	1.79
COG1551	sRNA-binding carbon storage regulator CsrA	Signal transduction mechanisms [T]	0.89
COG0375	Hydrogenase maturation factor HypA/HybF, metallochaperone involved in Ni insertion	Posttranslational modification, protein turnover, chaperones [O]	0.89
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.89
COG0732	Restriction endonuclease S subunit	Defense mechanisms [V]	0.89
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.89
COG4934	Serine protease, subtilase family	Posttranslational modification, protein turnover, chaperones [O]	0.89
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.89
COG4154	L-fucose mutarotase/ribose pyranase, RbsD/FucU family	Carbohydrate transport and metabolism [G]	0.89
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	0.89
COG3549	Plasmid maintenance system killer protein	Defense mechanisms [V]	0.89
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.89
COG3077	Antitoxin component of the RelBE or YafQ-DinJ toxin-antitoxin module	Defense mechanisms [V]	0.89
COG1869	D-ribose pyranose/furanose isomerase RbsD	Carbohydrate transport and metabolism [G]	0.89
COG2445	Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family	General function prediction only [R]	0.89
COG2442	Predicted antitoxin component of a toxin-antitoxin system, DUF433 family	Defense mechanisms [V]	0.89
COG2361	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	0.89
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	0.89
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.80 %
Unclassified	root	N/A	29.20 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.80 %
Unclassified	root	N/A	29.20 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.80 %
Unclassified	root	N/A	29.20 %

Name	Rank	Taxonomy	Distribution
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	31.86 %
Unclassified	root	N/A	29.20 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	4.42 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	1.77 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.77 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.88 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.88 %

Name	Rank	Taxonomy	Distribution
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	30.97 %
Unclassified	root	N/A	29.20 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	2.65 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.77 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.88 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.88 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.20 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	23.89 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	2.65 %
Phycisphaerae	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	1.77 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.77 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.88 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.88 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.20 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	11.50 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	3.54 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.65 %
unclassified Phycisphaerae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae	1.77 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.77 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	0.88 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.88 %
Blastocatellia bacterium AA13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13	0.88 %
unclassified Planctomycetia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.88 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.20 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	11.50 %
Terriglobus	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus	2.65 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	1.77 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1.77 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.77 %
Pirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae	0.88 %
Planctomycetia bacterium 21-64-5	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	0.88 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.88 %
Blastocatellia bacterium AA13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.88 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.20 %
Singulisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	5.31 %
Terriglobus saanensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis	2.65 %
Aquisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera	2.65 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	1.77 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1.77 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.77 %
Paludisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera	0.88 %
Pirellula	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula	0.88 %
Planctomycetia bacterium 21-64-5	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	0.88 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.88 %
Blastocatellia bacterium AA13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.88 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.20 %
Terriglobus saanensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis	2.65 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.77 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	1.77 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1.77 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.77 %
unclassified Aquisphaera	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera	0.88 %
Paludisphaera borealis	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera borealis	0.88 %
Pirellula staleyi	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → Pirellula staleyi	0.88 %
Planctomycetia bacterium 21-64-5	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	0.88 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.88 %
Blastocatellia bacterium AA13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.88 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.20 %
Terriglobus saanensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis	2.65 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.77 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	1.77 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1.77 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.77 %
Aquisphaera sp. JC669	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669	0.88 %
Paludisphaera borealis	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera borealis	0.88 %
Pirellula staleyi	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → Pirellula staleyi	0.88 %
Planctomycetia bacterium 21-64-5	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	0.88 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.88 %
Blastocatellia bacterium AA13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13	0.88 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.88 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000567\|JGI12270J11330_10007877	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	7322	Open in IMG/M
3300000567\|JGI12270J11330_10033679	All Organisms → cellular organisms → Bacteria	2957	Open in IMG/M
3300000567\|JGI12270J11330_10119047	Not Available	1082	Open in IMG/M
3300004477\|Ga0068971_1548897	Not Available	533	Open in IMG/M
3300004604\|Ga0068943_1313241	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300006174\|Ga0075014_100363651	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300009519\|Ga0116108_1095835	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669	901	Open in IMG/M
3300009520\|Ga0116214_1020538	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2356	Open in IMG/M
3300009520\|Ga0116214_1038845	All Organisms → cellular organisms → Bacteria	1721	Open in IMG/M
3300009520\|Ga0116214_1278448	All Organisms → cellular organisms → Bacteria → Acidobacteria	639	Open in IMG/M
3300009520\|Ga0116214_1278953	Not Available	638	Open in IMG/M
3300009520\|Ga0116214_1309374	Not Available	607	Open in IMG/M
3300009520\|Ga0116214_1352795	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300009522\|Ga0116218_1247281	Not Available	801	Open in IMG/M
3300009522\|Ga0116218_1496667	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	544	Open in IMG/M
3300009524\|Ga0116225_1037177	All Organisms → cellular organisms → Bacteria	2389	Open in IMG/M
3300009525\|Ga0116220_10130550	All Organisms → cellular organisms → Bacteria	1074	Open in IMG/M
3300009525\|Ga0116220_10327794	All Organisms → cellular organisms → Bacteria → PVC group	677	Open in IMG/M
3300009630\|Ga0116114_1021146	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	1963	Open in IMG/M
3300009630\|Ga0116114_1070342	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	960	Open in IMG/M
3300009640\|Ga0116126_1231386	Not Available	584	Open in IMG/M
3300009672\|Ga0116215_1257474	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis	763	Open in IMG/M
3300009683\|Ga0116224_10141250	All Organisms → cellular organisms → Bacteria	1160	Open in IMG/M
3300009683\|Ga0116224_10219995	All Organisms → cellular organisms → Bacteria	908	Open in IMG/M
3300009698\|Ga0116216_10178760	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	1303	Open in IMG/M
3300009698\|Ga0116216_10688410	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	614	Open in IMG/M
3300009700\|Ga0116217_10108458	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	1892	Open in IMG/M
3300009824\|Ga0116219_10806014	Not Available	512	Open in IMG/M
3300009824\|Ga0116219_10806674	Not Available	512	Open in IMG/M
3300009824\|Ga0116219_10812194	Not Available	510	Open in IMG/M
3300009839\|Ga0116223_10409722	Not Available	797	Open in IMG/M
3300009839\|Ga0116223_10535066	Not Available	680	Open in IMG/M
3300009839\|Ga0116223_10615466	Not Available	626	Open in IMG/M
3300009839\|Ga0116223_10825683	Not Available	530	Open in IMG/M
3300010339\|Ga0074046_10341538	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	913	Open in IMG/M
3300010339\|Ga0074046_10377477	Not Available	859	Open in IMG/M
3300010339\|Ga0074046_10476861	All Organisms → cellular organisms → Bacteria	747	Open in IMG/M
3300010341\|Ga0074045_10125623	All Organisms → cellular organisms → Bacteria	1758	Open in IMG/M
3300010341\|Ga0074045_10381142	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	916	Open in IMG/M
3300010341\|Ga0074045_10811756	Not Available	591	Open in IMG/M
3300010343\|Ga0074044_10011484	All Organisms → cellular organisms → Bacteria	6683	Open in IMG/M
3300010343\|Ga0074044_10475161	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	817	Open in IMG/M
3300010379\|Ga0136449_100016150	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	19669	Open in IMG/M
3300010379\|Ga0136449_100029762	All Organisms → cellular organisms → Bacteria	13296	Open in IMG/M
3300010379\|Ga0136449_100074054	All Organisms → cellular organisms → Bacteria	7260	Open in IMG/M
3300010379\|Ga0136449_100144648	Not Available	4687	Open in IMG/M
3300010379\|Ga0136449_100184111	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis	4011	Open in IMG/M
3300010379\|Ga0136449_100261173	All Organisms → cellular organisms → Bacteria	3204	Open in IMG/M
3300010379\|Ga0136449_100788703	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	1573	Open in IMG/M
3300010379\|Ga0136449_101154997	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	1225	Open in IMG/M
3300010379\|Ga0136449_101654075	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	968	Open in IMG/M
3300010379\|Ga0136449_102176690	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	810	Open in IMG/M
3300010379\|Ga0136449_102810265	Not Available	687	Open in IMG/M
3300010379\|Ga0136449_103349554	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	615	Open in IMG/M
3300010379\|Ga0136449_103830174	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	565	Open in IMG/M
3300011051\|Ga0138540_157853	Not Available	668	Open in IMG/M
3300011061\|Ga0138534_1010010	All Organisms → cellular organisms → Bacteria	1107	Open in IMG/M
3300011077\|Ga0138572_1151476	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300014162\|Ga0181538_10430934	Not Available	700	Open in IMG/M
3300016319\|Ga0182033_12084985	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300017928\|Ga0187806_1247507	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	616	Open in IMG/M
3300018008\|Ga0187888_1010884	All Organisms → cellular organisms → Bacteria	5373	Open in IMG/M
3300018008\|Ga0187888_1016657	All Organisms → cellular organisms → Bacteria	4008	Open in IMG/M
3300018008\|Ga0187888_1087599	All Organisms → cellular organisms → Bacteria	1345	Open in IMG/M
3300018008\|Ga0187888_1087599	All Organisms → cellular organisms → Bacteria	1345	Open in IMG/M
3300018008\|Ga0187888_1347925	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300018022\|Ga0187864_10040274	Not Available	2694	Open in IMG/M
3300018022\|Ga0187864_10057088	Not Available	2162	Open in IMG/M
3300018022\|Ga0187864_10118218	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1353	Open in IMG/M
3300018086\|Ga0187769_11260260	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300018086\|Ga0187769_11279573	Not Available	555	Open in IMG/M
3300026959\|Ga0207852_1017517	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	748	Open in IMG/M
3300027497\|Ga0208199_1023113	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1384	Open in IMG/M
3300027570\|Ga0208043_1020008	All Organisms → cellular organisms → Bacteria	2134	Open in IMG/M
3300027604\|Ga0208324_1002803	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	6432	Open in IMG/M
3300027604\|Ga0208324_1013443	All Organisms → cellular organisms → Bacteria	2623	Open in IMG/M
3300027604\|Ga0208324_1040921	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	1371	Open in IMG/M
3300027625\|Ga0208044_1013369	All Organisms → cellular organisms → Bacteria	3070	Open in IMG/M
3300027625\|Ga0208044_1166950	Not Available	603	Open in IMG/M
3300027625\|Ga0208044_1217985	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera	505	Open in IMG/M
3300027641\|Ga0208827_1034735	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	1779	Open in IMG/M
3300027662\|Ga0208565_1015005	All Organisms → cellular organisms → Bacteria	2944	Open in IMG/M
3300027662\|Ga0208565_1238972	Not Available	508	Open in IMG/M
3300030494\|Ga0310037_10016395	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	3581	Open in IMG/M
3300030494\|Ga0310037_10070152	Not Available	1649	Open in IMG/M
3300030494\|Ga0310037_10136910	Not Available	1117	Open in IMG/M
3300030494\|Ga0310037_10336260	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300030494\|Ga0310037_10430807	Not Available	542	Open in IMG/M
3300030494\|Ga0310037_10458158	Not Available	521	Open in IMG/M
3300030706\|Ga0310039_10006429	All Organisms → cellular organisms → Bacteria → Proteobacteria	6811	Open in IMG/M
3300030706\|Ga0310039_10058384	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	1690	Open in IMG/M
3300030706\|Ga0310039_10364806	Not Available	536	Open in IMG/M
3300031234\|Ga0302325_11076661	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1087	Open in IMG/M
3300031524\|Ga0302320_12097361	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13	526	Open in IMG/M
3300032160\|Ga0311301_10004817	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	47971	Open in IMG/M
3300032160\|Ga0311301_10009578	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	31337	Open in IMG/M
3300032160\|Ga0311301_10012570	All Organisms → cellular organisms → Bacteria	26272	Open in IMG/M
3300032160\|Ga0311301_10055106	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	8915	Open in IMG/M
3300032160\|Ga0311301_10160932	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis	4010	Open in IMG/M
3300032160\|Ga0311301_10208161	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → Pirellula staleyi	3331	Open in IMG/M
3300032160\|Ga0311301_10245822	Not Available	2961	Open in IMG/M
3300032160\|Ga0311301_10801096	All Organisms → cellular organisms → Bacteria	1294	Open in IMG/M
3300032160\|Ga0311301_10872705	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300032160\|Ga0311301_11234660	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	953	Open in IMG/M
3300032160\|Ga0311301_11468032	All Organisms → cellular organisms → Bacteria	843	Open in IMG/M
3300032160\|Ga0311301_11517964	Not Available	824	Open in IMG/M
3300032160\|Ga0311301_11669287	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	769	Open in IMG/M
3300032160\|Ga0311301_11785435	Not Available	734	Open in IMG/M
3300032160\|Ga0311301_12088293	Not Available	656	Open in IMG/M
3300032160\|Ga0311301_12301354	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	613	Open in IMG/M
3300032896\|Ga0335075_11245388	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera borealis	641	Open in IMG/M
3300033405\|Ga0326727_10305207	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	1563	Open in IMG/M
3300033818\|Ga0334804_132954	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera	626	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	86.73%
Aquatic	Environmental → Aquatic	13.27%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	83.19%
Freshwater	Environmental → Aquatic → Freshwater	12.39%
Peat	Environmental → Terrestrial → Peat	3.54%
Sediment	Environmental → Aquatic → Sediment	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	72.57%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	12.39%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	9.73%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.54%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.89%
Loam	Environmental → Terrestrial → Soil → Loam	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	71.68%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	9.73%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	7.96%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.54%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.54%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.89%

Habitat	Taxonomy	Distribution
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	71.68%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	7.08%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	7.08%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	3.54%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.77%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.89%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.89%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.89%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.89%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.89%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.89%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental	Open in IMG/M
3300004477	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004604	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300009519	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150	Environmental	Open in IMG/M
3300009520	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG	Environmental	Open in IMG/M
3300009522	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG	Environmental	Open in IMG/M
3300009524	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG	Environmental	Open in IMG/M
3300009525	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG	Environmental	Open in IMG/M
3300009630	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40	Environmental	Open in IMG/M
3300009640	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40	Environmental	Open in IMG/M
3300009672	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG	Environmental	Open in IMG/M
3300009683	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG	Environmental	Open in IMG/M
3300009698	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG	Environmental	Open in IMG/M
3300009700	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG	Environmental	Open in IMG/M
3300009824	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG	Environmental	Open in IMG/M
3300009839	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300011051	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011061	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011077	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300014162	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300017928	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1	Environmental	Open in IMG/M
3300018008	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40	Environmental	Open in IMG/M
3300018022	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300026959	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)	Environmental	Open in IMG/M
3300027497	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)	Environmental	Open in IMG/M
3300027570	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)	Environmental	Open in IMG/M
3300027604	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)	Environmental	Open in IMG/M
3300027625	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)	Environmental	Open in IMG/M
3300027641	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)	Environmental	Open in IMG/M
3300027662	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)	Environmental	Open in IMG/M
3300030494	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)	Environmental	Open in IMG/M
3300030706	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)	Environmental	Open in IMG/M
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental	Open in IMG/M
3300031524	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental	Open in IMG/M
3300033405	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY	Environmental	Open in IMG/M
3300033818	Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12270J11330_100078771	3300000567	Peatlands Soil	FTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV*
JGI12270J11330_100336796	3300000567	Peatlands Soil	FTYPGTSLRLVYSLAGEAETPNSVPHQNPADQKV*
JGI12270J11330_101190472	3300000567	Peatlands Soil	HLLEHLNAAEFTYPGTSLRLVYSLAGEAETPNLVPH*
Ga0068971_15488971	3300004477	Peatlands Soil	LLEHLNAAEFTYPGTSLRLVNSLAGEAETPNSVPHQNPADQEV*
Ga0068943_13132412	3300004604	Peatlands Soil	HLLEHLNAAEFTYPGTKLQLVYSIAGEAEIPNSVPQQNPTDQEV*
Ga0075014_1003636513	3300006174	Watersheds	FTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV*
Ga0116108_10958351	3300009519	Peatland	FTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI*
Ga0116214_10205381	3300009520	Peatlands Soil	AAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV*
Ga0116214_10388454	3300009520	Peatlands Soil	LLEHLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQKV*
Ga0116214_12784483	3300009520	Peatlands Soil	AEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV*
Ga0116214_12789531	3300009520	Peatlands Soil	LNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV*
Ga0116214_13093742	3300009520	Peatlands Soil	AAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV*
Ga0116214_13527951	3300009520	Peatlands Soil	EFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV*
Ga0116218_12472813	3300009522	Peatlands Soil	AEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV*
Ga0116218_14966672	3300009522	Peatlands Soil	LNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV*
Ga0116225_10371772	3300009524	Peatlands Soil	AEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV*
Ga0116220_101305501	3300009525	Peatlands Soil	AAEFTYPGTKLQLVYSIAGEAEIPNSVPQQNPTDQEV*
Ga0116220_103277942	3300009525	Peatlands Soil	HLLEHLNAAEFPYPGTNLRLVYSIAGEAETPNLAPHQNPADQEV*
Ga0116114_10211464	3300009630	Peatland	NATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI*
Ga0116114_10703422	3300009630	Peatland	EFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI*
Ga0116126_12313861	3300009640	Peatland	LNATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI*
Ga0116215_12574741	3300009672	Peatlands Soil	LNAAECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV*
Ga0116224_101412501	3300009683	Peatlands Soil	EHLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQKV*
Ga0116224_102199951	3300009683	Peatlands Soil	RAIAHLLEHLNAAEFPYPGTNLRLIYSIAGEAETPNLVPHQNPADQEV*
Ga0116216_101787602	3300009698	Peatlands Soil	FTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV*
Ga0116216_106884101	3300009698	Peatlands Soil	NAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV*
Ga0116217_101084581	3300009700	Peatlands Soil	AECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV*
Ga0116219_108060141	3300009824	Peatlands Soil	NAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV*
Ga0116219_108066741	3300009824	Peatlands Soil	NAAEFPYPGTNLRLVYSIAGEPETPNLAPHQNPADQEV*
Ga0116219_108121941	3300009824	Peatlands Soil	AEFTYPGTKLQLVYSIAGEAETPNSVPQRNPTDQEV*
Ga0116223_104097221	3300009839	Peatlands Soil	HLLEHLNAAEFPYPGTNLRLIYSIAGEAETPNLVPHQNPADQEV*
Ga0116223_105350662	3300009839	Peatlands Soil	ECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV*
Ga0116223_106154661	3300009839	Peatlands Soil	EFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV*
Ga0116223_108256831	3300009839	Peatlands Soil	FTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV*
Ga0074046_103415382	3300010339	Bog Forest Soil	LLEHLNAAEFTYPGTKLQLVYSIAGEAQTPNSVPQQNPTDQEV*
Ga0074046_103774772	3300010339	Bog Forest Soil	HLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV*
Ga0074046_104768612	3300010339	Bog Forest Soil	AAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV*
Ga0074045_101256231	3300010341	Bog Forest Soil	LNAAEFTYPGTSLRLVYSLASEAQTPNSVPQQNPTDQEV*
Ga0074045_103811422	3300010341	Bog Forest Soil	LNGAEFTYPGTSLQLVYSLAGEAETSNSAPRQNPTDQEA*
Ga0074045_108117562	3300010341	Bog Forest Soil	FTYPGTKLQLVYSIAGEAETPNSVPQRNPTDQEV*
Ga0074044_100114841	3300010343	Bog Forest Soil	NAAEFTYPGTSLRLVYSLASEAQTPNSVPQQNPTDQEV*
Ga0074044_104751611	3300010343	Bog Forest Soil	HLNASEFTYPGTSLQLVYSLAGEGETPNLAPYLNPADQEV*
Ga0136449_1000161501	3300010379	Peatlands Soil	HLNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV*
Ga0136449_1000297621	3300010379	Peatlands Soil	LNAAEFTYPGTNLRLVYSITGQAETPDLAPDQNPADQEV*
Ga0136449_1000740545	3300010379	Peatlands Soil	NAAEFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV*
Ga0136449_1001446482	3300010379	Peatlands Soil	LNAAEFPYPGTNLRLVYSIAGEPETPNLAPHQNPADQEV*
Ga0136449_1001841111	3300010379	Peatlands Soil	NAAECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV*
Ga0136449_1002611731	3300010379	Peatlands Soil	LNAAEFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV*
Ga0136449_1007887032	3300010379	Peatlands Soil	FSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV*
Ga0136449_1011549973	3300010379	Peatlands Soil	QLNAAEFTYPGTSLRLVYSIAGQAGPTNLDSAQNPADQEV*
Ga0136449_1016540752	3300010379	Peatlands Soil	NAAEFTYPGTNLRLVYSIAGGAETPNLAPDQNPADQEV*
Ga0136449_1021766902	3300010379	Peatlands Soil	AIAHLLEHLNAAEFPYPGTNLRLVYSIAGEAETPNLAPHQNPADQEV*
Ga0136449_1028102651	3300010379	Peatlands Soil	EFTYPGTKLQLVYSIAGEAQTPNSVPQQNPTDQEV*
Ga0136449_1033495541	3300010379	Peatlands Soil	LNATEFTYPGTELRLVYSIAGEAENPSSAPHQNPAGQDF*
Ga0136449_1038301741	3300010379	Peatlands Soil	NAAEFTYPGTNLRLVYSITGQAETPDLAPDQNPADQEV*
Ga0138540_1578532	3300011051	Peatlands Soil	IAHLLEHLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV*
Ga0138534_10100101	3300011061	Peatlands Soil	AAEFTYPGTKLQLVYSIAGEAQTPNSVPQQNPTDQEV*
Ga0138572_11514762	3300011077	Peatlands Soil	AEFTYPGTKLQLVYSIAGEVETPNSVPQQNPTDQEV*
Ga0181538_104309342	3300014162	Bog	LLEHLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV*
Ga0182033_120849852	3300016319	Soil	HLNAAEFKYPGTNLRLVYSIAGLVEMPELAPDQNPANQEV
Ga0187806_12475071	3300017928	Freshwater Sediment	LNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0187888_10108849	3300018008	Peatland	NATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI
Ga0187888_10166575	3300018008	Peatland	EFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI
Ga0187888_10875991	3300018008	Peatland	NATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEIWACGQ
Ga0187888_10875994	3300018008	Peatland	LNATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI
Ga0187888_13479251	3300018008	Peatland	ATEFTYPGTELKLVYSIAAEAESPSSAPHQNPAGQEI
Ga0187864_100402741	3300018022	Peatland	AAEFPYPGTNLRLIYSIAGEAETPNLVPHQNPADQEV
Ga0187864_100570882	3300018022	Peatland	LEHLNAAEFPYPGTNLRLVYSIAGEAETPNLAPHQNPADQEV
Ga0187864_101182181	3300018022	Peatland	LLEHLNAAEFPYPGTNLRLIYSIAGEAETPNLVPHQNPADHEV
Ga0187769_112602602	3300018086	Tropical Peatland	EHLNATEFTYPGTELRLVYSIAGEAESPSPAPHQNPAGQEV
Ga0187769_112795731	3300018086	Tropical Peatland	AEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0207852_10175172	3300026959	Tropical Forest Soil	HLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0208199_10231131	3300027497	Peatlands Soil	HLNAAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV
Ga0208043_10200083	3300027570	Peatlands Soil	HLNAAQFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0208324_10028038	3300027604	Peatlands Soil	EHLNAAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV
Ga0208324_10134435	3300027604	Peatlands Soil	HLNAAEFTYPGTKLQLVYSIAGEAEIPNSVPQQNPTDQEV
Ga0208324_10409211	3300027604	Peatlands Soil	EFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV
Ga0208044_10133694	3300027625	Peatlands Soil	AEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV
Ga0208044_11669501	3300027625	Peatlands Soil	EFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0208044_12179851	3300027625	Peatlands Soil	LNAAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV
Ga0208827_10347353	3300027641	Peatlands Soil	AAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0208565_10150051	3300027662	Peatlands Soil	HLLEHLNAAEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQKV
Ga0208565_12389722	3300027662	Peatlands Soil	NAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0310037_100163951	3300030494	Peatlands Soil	HLNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV
Ga0310037_100701521	3300030494	Peatlands Soil	LNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV
Ga0310037_101369102	3300030494	Peatlands Soil	NAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV
Ga0310037_103362601	3300030494	Peatlands Soil	EHLNAAEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV
Ga0310037_104308071	3300030494	Peatlands Soil	EHLNAAEFTYPGTNLRLVYSITGQAETPDLAPDQNPADQEV
Ga0310037_104581581	3300030494	Peatlands Soil	EFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV
Ga0310039_100064295	3300030706	Peatlands Soil	NAAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV
Ga0310039_100583844	3300030706	Peatlands Soil	EHLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0310039_103648061	3300030706	Peatlands Soil	LNAAEFTYPGTKLQLVYSIAGEAEIPNSVPQQNPTDQEV
Ga0302325_110766611	3300031234	Palsa	MSTPQSHRAIAHLLEHLNAAEFTDLDTDLPLVYSIAGQAEIPNLAPHQNPADQEV
Ga0302320_120973611	3300031524	Bog	QLNAAEFTYPGTSLQLVYSIAGEAENPNLAPHQNPADQEI
Ga0311301_1000481739	3300032160	Peatlands Soil	QLNAAECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV
Ga0311301_100095781	3300032160	Peatlands Soil	AEFTYPGTHLQLVYSIAGHAGPPDLAPDQNPADQEV
Ga0311301_100125701	3300032160	Peatlands Soil	LNAAEFTYPGTSLRLVYSIAGDAETPNSAPHQNPTDQEV
Ga0311301_100551061	3300032160	Peatlands Soil	QLNAAEFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV
Ga0311301_101609326	3300032160	Peatlands Soil	LNAAECTFPATNLRLVYSIAGQATLVDLAPDQIPADQEV
Ga0311301_102081613	3300032160	Peatlands Soil	AAEFTYPGTSLRLVYSLAGEAQTPNSVPQQNPTDQEV
Ga0311301_102458221	3300032160	Peatlands Soil	AAEFSYPGTNLQLVYSIAGQAQTAELAPEQNPADQEV
Ga0311301_108010961	3300032160	Peatlands Soil	EQLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0311301_108727051	3300032160	Peatlands Soil	EQLNAAEFTYPGTSLRLVYSIAGQAGPTNLDSAQNPADQEV
Ga0311301_112346602	3300032160	Peatlands Soil	NAAEFTYPGTKLQLVYSIAGEAQTPNSVPQQNPTDQEV
Ga0311301_114680322	3300032160	Peatlands Soil	AEFTYPGTSLRLVYSLAGEAETPNSVPHQNPADQEV
Ga0311301_115179641	3300032160	Peatlands Soil	LNATEFTYPATNLRLVYSIAGQAATAELAPDQNPVDQEV
Ga0311301_116692871	3300032160	Peatlands Soil	EQLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQRNPTDQEV
Ga0311301_117854352	3300032160	Peatlands Soil	EQLNAAEFTYPGTSLQLVYSIAGQAETPELAPDQNPADQEV
Ga0311301_120882931	3300032160	Peatlands Soil	QLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQQNPTDQEV
Ga0311301_123013542	3300032160	Peatlands Soil	LEHLNAAAFTYPGTNLRLVYSITGQAETPDLAPDQNPADQEV
Ga0335075_112453881	3300032896	Soil	LTAAELTYPGTSLQLIYSIAGHAPTPQSVPEQNPPDQEV
Ga0326727_103052073	3300033405	Peat Soil	QLNAAEFTYPGTKLQLVYSIAGEAETPNSVPQRNPTDQEV
Ga0334804_132954_509_625	3300033818	Soil	NAAEFTYPGTNLRLVYSLAGEAETPNSVPHQNPADQEV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F083093

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences