NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083076

Metagenome / Metatranscriptome Family F083076

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083076
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 77 residues
Representative Sequence MAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASREKKK
Number of Associated Samples 98
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 21.24 %
% of genes near scaffold ends (potentially truncated) 31.86 %
% of genes from short scaffolds (< 2000 bps) 76.11 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(15.044 % of family members)
Environment Ontology (ENVO) Unclassified
(27.434 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.788 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.45%    β-sheet: 0.00%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF01381HTH_3 6.19
PF00912Transgly 2.65
PF01546Peptidase_M20 2.65
PF13519VWA_2 1.77
PF13620CarboxypepD_reg 1.77
PF12146Hydrolase_4 1.77
PF13643DUF4145 0.88
PF03949Malic_M 0.88
PF07876Dabb 0.88
PF00037Fer4 0.88
PF07719TPR_2 0.88
PF00437T2SSE 0.88
PF05345He_PIG 0.88
PF12704MacB_PCD 0.88
PF05649Peptidase_M13_N 0.88
PF02597ThiS 0.88
PF12867DinB_2 0.88
PF13174TPR_6 0.88
PF07238PilZ 0.88
PF07007LprI 0.88
PF00027cNMP_binding 0.88
PF01575MaoC_dehydratas 0.88
PF02775TPP_enzyme_C 0.88
PF01475FUR 0.88
PF01564Spermine_synth 0.88
PF03449GreA_GreB_N 0.88
PF02627CMD 0.88
PF00231ATP-synt 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 2.65
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 2.65
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 2.65
COG0224FoF1-type ATP synthase, gamma subunitEnergy production and conversion [C] 0.88
COG0281Malic enzymeEnergy production and conversion [C] 0.88
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.88
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.88
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.88
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.88
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.88
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.88
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.88
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.88
COG3755Uncharacterized conserved protein YecT, DUF1311 familyFunction unknown [S] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16874492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2487Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101300665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300004479|Ga0062595_100727449All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005534|Ga0070735_10002361All Organisms → cellular organisms → Bacteria17163Open in IMG/M
3300005591|Ga0070761_10156311All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300005591|Ga0070761_10223899All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300005602|Ga0070762_10462433All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300005610|Ga0070763_10303645All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005712|Ga0070764_10510202All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005921|Ga0070766_10224322All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300005921|Ga0070766_10384327All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300006052|Ga0075029_100502600All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300006052|Ga0075029_100855278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Butyrivibrio → Butyrivibrio proteoclasticus621Open in IMG/M
3300006059|Ga0075017_100933605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300006162|Ga0075030_100013448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7157Open in IMG/M
3300006162|Ga0075030_100441823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1036Open in IMG/M
3300006162|Ga0075030_101127575All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300006174|Ga0075014_100997695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300006358|Ga0068871_100290068All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300009174|Ga0105241_10587992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1004Open in IMG/M
3300009518|Ga0116128_1062597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1150Open in IMG/M
3300009551|Ga0105238_12757908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300009623|Ga0116133_1004848All Organisms → cellular organisms → Bacteria3429Open in IMG/M
3300009628|Ga0116125_1053568All Organisms → cellular organisms → Bacteria → Proteobacteria1031Open in IMG/M
3300009632|Ga0116102_1074267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1016Open in IMG/M
3300009643|Ga0116110_1068200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1247Open in IMG/M
3300010048|Ga0126373_10759868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1030Open in IMG/M
3300010343|Ga0074044_10130566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1685Open in IMG/M
3300010358|Ga0126370_11773558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300010361|Ga0126378_12319170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300010366|Ga0126379_12561402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300010373|Ga0134128_10728792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1100Open in IMG/M
3300010379|Ga0136449_100764142All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300010379|Ga0136449_102540609All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300010398|Ga0126383_10822908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31012Open in IMG/M
3300010398|Ga0126383_13422688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300011120|Ga0150983_13362588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300012210|Ga0137378_10010492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium8032Open in IMG/M
3300012349|Ga0137387_10323078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1117Open in IMG/M
3300012925|Ga0137419_11350198All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012927|Ga0137416_10189784All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300012971|Ga0126369_12982122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300014153|Ga0181527_1270802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300014155|Ga0181524_10016723All Organisms → cellular organisms → Bacteria5571Open in IMG/M
3300014169|Ga0181531_10688031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300014489|Ga0182018_10043302All Organisms → cellular organisms → Bacteria2787Open in IMG/M
3300014492|Ga0182013_10000079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae111107Open in IMG/M
3300014495|Ga0182015_10086025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2202Open in IMG/M
3300014501|Ga0182024_10080788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4847Open in IMG/M
3300014502|Ga0182021_10408886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1611Open in IMG/M
3300014654|Ga0181525_10016633All Organisms → cellular organisms → Bacteria4668Open in IMG/M
3300015371|Ga0132258_10018592All Organisms → cellular organisms → Bacteria → Acidobacteria15052Open in IMG/M
3300016702|Ga0181511_1391486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1186Open in IMG/M
3300017925|Ga0187856_1001016All Organisms → cellular organisms → Bacteria23271Open in IMG/M
3300017925|Ga0187856_1002783All Organisms → cellular organisms → Bacteria12635Open in IMG/M
3300017935|Ga0187848_10276588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300017939|Ga0187775_10264565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300017940|Ga0187853_10058753All Organisms → cellular organisms → Bacteria1955Open in IMG/M
3300017948|Ga0187847_10009507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6503Open in IMG/M
3300017955|Ga0187817_10960204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300017970|Ga0187783_10157597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1672Open in IMG/M
3300017996|Ga0187891_1310053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300017998|Ga0187870_1238078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300018003|Ga0187876_1066832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1424Open in IMG/M
3300018003|Ga0187876_1283057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300018016|Ga0187880_1047600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2309Open in IMG/M
3300018019|Ga0187874_10132159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1065Open in IMG/M
3300018020|Ga0187861_10213471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium857Open in IMG/M
3300018035|Ga0187875_10344681All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300018042|Ga0187871_10803105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300018047|Ga0187859_10199177All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300019256|Ga0181508_1207642All Organisms → cellular organisms → Bacteria2493Open in IMG/M
3300020579|Ga0210407_10300694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1253Open in IMG/M
3300020580|Ga0210403_10171958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1775Open in IMG/M
3300020581|Ga0210399_10102937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2337Open in IMG/M
3300021401|Ga0210393_10453730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1046Open in IMG/M
3300021407|Ga0210383_10033079All Organisms → cellular organisms → Bacteria → Proteobacteria4323Open in IMG/M
3300021560|Ga0126371_10744077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1128Open in IMG/M
3300021861|Ga0213853_11618197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300022557|Ga0212123_10938386All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300022731|Ga0224563_1020164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300022873|Ga0224550_1062590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300023250|Ga0224544_1011124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1217Open in IMG/M
3300027676|Ga0209333_1022154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1802Open in IMG/M
3300027745|Ga0209908_10033645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1057Open in IMG/M
3300027853|Ga0209274_10219226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium970Open in IMG/M
3300027879|Ga0209169_10088429All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300027889|Ga0209380_10235993All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300027898|Ga0209067_10683621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300027911|Ga0209698_10000546All Organisms → cellular organisms → Bacteria → Acidobacteria42904Open in IMG/M
3300027911|Ga0209698_10139396All Organisms → cellular organisms → Bacteria1997Open in IMG/M
3300027911|Ga0209698_10406230All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1064Open in IMG/M
3300027986|Ga0209168_10001641All Organisms → cellular organisms → Bacteria17173Open in IMG/M
3300028536|Ga0137415_10110360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2599Open in IMG/M
3300028748|Ga0302156_10259925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300028798|Ga0302222_10096456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1179Open in IMG/M
3300028806|Ga0302221_10298106All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300029882|Ga0311368_10287600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1252Open in IMG/M
3300029910|Ga0311369_11254318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300029989|Ga0311365_10320999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin3451338Open in IMG/M
3300030399|Ga0311353_10335982All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300030399|Ga0311353_10470829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300031234|Ga0302325_10138110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4408Open in IMG/M
3300031236|Ga0302324_100222682All Organisms → cellular organisms → Bacteria → Acidobacteria2979Open in IMG/M
3300031236|Ga0302324_100381345All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300031236|Ga0302324_102402392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300031525|Ga0302326_10548622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli1735Open in IMG/M
3300031708|Ga0310686_105199563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300031823|Ga0307478_10997359All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Anammoximicrobium → unclassified Candidatus Anammoximicrobium → Candidatus Anammoximicrobium sp.700Open in IMG/M
3300031962|Ga0307479_10810126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium912Open in IMG/M
3300032783|Ga0335079_10000241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae64158Open in IMG/M
3300032783|Ga0335079_11699655All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300033405|Ga0326727_10000050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae486585Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.04%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds9.73%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil8.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.08%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.42%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.77%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.77%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.77%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.89%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.89%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.89%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_029712402088090014SoilMAYKANTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKEPSERLLEKLGFSRQTTYVRSPAVSREEQEKKK
INPhiseqgaiiFebDRAFT_10130066523300000364SoilVRDTLYPNMAYKANTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKEPSERLLEKLGFSRQTTYVRSPAVSREEQEKK*
Ga0062595_10072744923300004479SoilMAYKASTIEELLAIMKRIQGEKTLTQFADDLDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSATAATQEKKK*
Ga0070735_10002361123300005534Surface SoilMAYKAATIEELLAIMKRVQGEKTLTEFAEDLDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAANRGKKK*
Ga0070761_1015631113300005591SoilLYPSMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTTYVRSPTAASREKKQ*
Ga0070761_1022389913300005591SoilMYPSMAYKATTIEELIAIMKRVQGEKSLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASREKK
Ga0070762_1046243323300005602SoilMYPSMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPTAASREKK
Ga0070763_1030364523300005610SoilMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPTAASREKKH*
Ga0070764_1051020223300005712SoilMYPSMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPTAASREKKH*
Ga0070766_1022432223300005921SoilMAYKATTIEELIAIMKRVQGEKTLTKFAAELDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAASREKKK*
Ga0070766_1038432723300005921SoilMAYKATTIEELIAIMKLVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPTAASREKK
Ga0075029_10050260023300006052WatershedsMAYKATTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKEPSGRLLEKLGFSRQTTYVRSPAASRQEQEKKK*
Ga0075029_10085527813300006052WatershedsMAYKATTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKDPSERLLEKLGFSRQTTYVRSPAASRQEQEKKK*
Ga0075017_10093360513300006059WatershedsMAYKATTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKEPSERLLEKIGFSRQTTYVRSPAASRQEQEKKK*
Ga0075030_10001344823300006162WatershedsLTRIPQRDTLYPCMAYKATTIEELLAIMKRVQGEKTLTEFAAQLDLSKQYVSNVYNRRKEPSERLLDKLGFQRQTTYVRSPAAARKETKK*
Ga0075030_10044182313300006162WatershedsMGRAHVTVAVCRQQLTRIPFRDTLYPSMAYKATTIEELIAIMKRVQGDKTLTQFAGELDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAATREKKNERK*
Ga0075030_10112757513300006162WatershedsDTLYPSMAYKATTIEELIAIMKHVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTVASREKKK*
Ga0075014_10099769523300006174WatershedsMAYKATTIEELLAIMKRVQGEKTLTEFAAQLDLSKQYVSNVYNRRKEPSERLLDKLGFQRQTT
Ga0068871_10029006813300006358Miscanthus RhizosphereCIPYRDTMYPSMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRKTTYVRSPTAANQEKKK*
Ga0105241_1058799223300009174Corn RhizosphereMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAANQENKK*
Ga0116128_106259713300009518PeatlandMAYKATTIEDLLAIMKRVQGEKTLTQFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTYFRSPTAARKEKKK*
Ga0105238_1275790823300009551Corn RhizosphereMYPGMAYKATTIEELIAIMKRIQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAANQEKKK*
Ga0116133_100484833300009623PeatlandMAYKATTIEDLLGIMKRVQGEKTLTQFAAELDLSKQYLCNVYNRRKEPSQRLLDKLGFARETTYFRSPTAARKEKKK*
Ga0116125_105356823300009628PeatlandMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLGKLGFTRQTTYLRSPTAASREKKK*
Ga0116102_107426723300009632PeatlandMAYKATTIEDLLAIMKRVQGEKTLKRFAAELDLSKQYLRNGYNRRKEPSERLLDKMGFGRQT
Ga0116110_106820023300009643PeatlandMAYKATTIEDLLAIMKRVQGEKTLTRFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTYFRSPTAARKEKKK*
Ga0126373_1075986823300010048Tropical Forest SoilMYPEMAYKATTIEELLAIMRRVQGERTLTEFATDMEMSKQYLSNVYTRRKEPSERLLSKLGFTRQTIYVRSPAASRQEKKK*
Ga0074044_1013056633300010343Bog Forest SoilMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFARQTTYVRSPTAASREKNK*
Ga0126370_1177355823300010358Tropical Forest SoilMAYKATTIEELLAIMKRVQGEKTLTEFATDMEVSKQYLCNVYSRRKEPSERILAKLGFTRQTTYVRSSAASRQEKKK*
Ga0126378_1231917013300010361Tropical Forest SoilMAYKATTIEELLAIMKQVQGERTLTEFATDMDVSKQYLCNVYSRRKEPSERILAKLGFTRQTTYVRSPALSQKEKKK*
Ga0126379_1256140223300010366Tropical Forest SoilMAYKATTIEELLAIMKRVQGERTLTEFATDMEVSKQYLSNVYCRRKEPSERILAKLGFTRQTTYVRSSAASRQEKKR*
Ga0134128_1072879213300010373Terrestrial SoilMAYKATTIEDLLAIMKRVQGEKTLTEFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFARQTTYFRSPTAARKEKKK*
Ga0136449_10076414223300010379Peatlands SoilMAYKATTIEDLLAIMKRIQGEKTLTEFAAELDLSKQYLSNVYNRHKEPSERLLDKLGFARQTTYVRSPTAANREKKK*
Ga0136449_10254060913300010379Peatlands SoilMAYKATTIEDLLAIMKRVQGEKTLTQFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFERQTTYFRSPTAARKEKKK*
Ga0126383_1082290833300010398Tropical Forest SoilMAYKATTIEELLAIMKRVQGEKTLTEFAADMEVSKQYLCNVYSRRKEPSERILAKLGFTRQTTYVRSSAASRQEKK
Ga0126383_1342268813300010398Tropical Forest SoilMAYKATTIQELLQIMKRVQGEKTLTEFAAELDMSKQYLSNVYNRHKEPSERLLDKLGFTRQTTYLRSSTAAKREKKK*
Ga0150983_1336258813300011120Forest SoilEDLLAIMKRVQGEKTLTQFAAEMDMSKQYVSNVYNRRKEPSERLLDKLGFARQTTYVRSPTAARQEKKK*
Ga0137378_1001049293300012210Vadose Zone SoilMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASREKEK*
Ga0137387_1032307813300012349Vadose Zone SoilKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASREKEK*
Ga0137419_1135019813300012925Vadose Zone SoilMAYKATTIEELIAIMKRVQGEKTLTMFAAELDMSKQYVSNVYNRHKEPSERLLEKLGFTRQTTYVRSP
Ga0137416_1018978423300012927Vadose Zone SoilMAYKATTIEELIAIMKRVQGEKTLTMFAAELDMSKQYVSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASREKKK*
Ga0126369_1298212213300012971Tropical Forest SoilMYPEMAYKANTIEELLAIMKRVQGDKTLTEFAADLDVSKQYLSNVYNRHKEPSERILGKLGFTRQTAYVPSLPARREDKEEKKK*
Ga0181527_127080213300014153BogIPYRDTLYPCMAYKATTIEELLAIMKRVQGEKTLTKFAAELDISKQYLSNVYNRHKEPSERLLDKLGFTRQTTYVRSPTAANQEKKK*
Ga0181524_1001672323300014155BogMAYKATTIEELLAIMKRVQGEKTLTKFAAELDISKQYLSNVYNRHKEPSERLLDKLGFTRQTTYVRSPTAANQEKKK*
Ga0181531_1068803113300014169BogIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASLEKKR*
Ga0182018_1004330243300014489PalsaMAYKATNIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLGQLGFTRQTTYVRSPTAASREKKQ*
Ga0182013_10000079563300014492BogMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYVSNVYNRHKEPSERLLGKLGFTRQTTYLRSPTAASRERKK*
Ga0182015_1008602533300014495PalsaMAYKATTIEELIAIMKRVQGEKTLTQFAAELDLSKQYVSNVYNRHKAPSERLLEKLGFTRQTAYVRSLTAASREKKK*
Ga0182024_1008078843300014501PermafrostMAYKATTIEELIAIMKRVQGEKTLTQFAAELDLSKQYVSNVYNRHKEPSERLLVKLGFTRQTAYVRSLTAASREKKK*
Ga0182021_1040888633300014502FenMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAASREKKK*
Ga0181525_1001663353300014654BogMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASLEKKR*
Ga0132258_1001859273300015371Arabidopsis RhizosphereMAYKATTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKEPSERLLEKLGFSRQTTYVRSPAVSRQEQEKKK*
Ga0181511_139148613300016702PeatlandMAYKATTIEELLAIMKRVQGEKTLTKFAAELDISKQYLSNVYNRHKEPSERLLDKLGFTRQTTYVRSPTAANQEKKK
Ga0187856_1001016193300017925PeatlandMAYKATTIEDLLAIMKRVQGEKTLTRFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTYFRSPAAARKEKKK
Ga0187856_100278313300017925PeatlandMAYKATTIEDLLAIMKRVQGEKTLTQFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTYFRSPTAARKEKKK
Ga0187848_1027658813300017935PeatlandMAYKATTIEELLAIMKRVQGEKTLTQFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTYFRSPTAARKEKKK
Ga0187775_1026456513300017939Tropical PeatlandMYSSMAYKATTIEDLLAIMKRIQGEKTLTEFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFTRQTTYVRSPTAARKEKKK
Ga0187853_1005875333300017940PeatlandMAYKATTIEDLLGIMKRVQGEKTLTQFAAELDLSKQYLCNVYNRRKEPSQRLLDKLGFARETTYFRSPTAARKEKKK
Ga0187847_1000950743300017948PeatlandMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLGKLGFTRQTTYLRSPTAASREKKK
Ga0187817_1096020413300017955Freshwater SedimentMAYKATTIEELLAIMKRIQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFARQTTYVRSPTAANQEKKK
Ga0187783_1015759723300017970Tropical PeatlandMAYKATTIEELIAIMKRIQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTTYVRSPTAASREKKP
Ga0187891_131005313300017996PeatlandMAYKATTIEDLLAIMKRVQGEKTLTQFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQT
Ga0187870_123807823300017998PeatlandMAYKATTIEDLLAIMKRVQGEKTLTRFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTYFRSPTAARKEKKK
Ga0187876_106683223300018003PeatlandMAYKATTIEDLLAIMKRVQGEKTLTRFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTYFRSPA
Ga0187876_128305713300018003PeatlandMAYKATTIEDLLAIMKRVQGEKTLTQFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTYFRSPA
Ga0187880_104760053300018016PeatlandMAYKATTIEDLLAIMKRVQGEKTLTRFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQT
Ga0187874_1013215913300018019PeatlandMAYKATTIEDLLAIMKRVQGEKTLTQFAAELDLSKQYLSNVYNRRKEPSERLLDKLGFGRQTTY
Ga0187861_1021347113300018020PeatlandKEREQRLSCIPIRDTLYPMAYKATTIEDLLGIMKRVQGEKTLTQFAAELDLSKQYLCNVYNRRKEPSQRLLDKLGFARETTYFRSPTAARKEKKK
Ga0187875_1034468123300018035PeatlandMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLGKLGFTRQTTY
Ga0187871_1080310513300018042PeatlandMAYKATTIEDLLAIMKRIQGEKTLTEFAADLDLSKQYLSNVYNRHKDPSERLLDKLGFTRQTTYVRSPTAASKEKKK
Ga0187859_1019917723300018047PeatlandMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASREKKK
Ga0181508_120764213300019256PeatlandICIPEWDTLYPSMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLGKLGFTRQTTYLRSPTAASREKKK
Ga0210407_1030069423300020579SoilMAYKATTIEDLLAIMKRVQGEKTLTQFAAELDLSKQYVSNVYNRRKEPSERLLDKLGFARQTTYVRSPTAARQEKKK
Ga0210403_1017195813300020580SoilLYPSMAYKATTIEELIAIMKRVQGEKTLTKFAAELDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAASREKKK
Ga0210399_1010293723300020581SoilMAYKATTIEELIAIMKRVQGDKTLTHFAAELDLSKQYVSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAASREKKK
Ga0210393_1045373023300021401SoilMAYKATTIEELIALMKRVQGEKTLTKFAAELDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYLRSPTAASREKKK
Ga0210383_1003307913300021407SoilMAYKATTIEELIAIMKRVQGEKTLTKFAAELDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAASREKKK
Ga0126371_1074407723300021560Tropical Forest SoilLEYDVFDMAYKATTIEELLAIMRRVQGERRLTEFATDMEMSKQYLCNVYSRRKEPSERILAKLGFTRQTTYVRSSAASRQEKKR
Ga0213853_1161819723300021861WatershedsLRDTLYPDMAYKATTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKVPSERLLDKLGFSRQTTYVRSPAASRQEQEKKK
Ga0212123_1093838613300022557Iron-Sulfur Acid SpringMKRVQGEKTLTQFAAELDLSKQYVSNVYNRRKEPSERLLDKLGFARQTTYVRSPTAARQEKKK
Ga0224563_102016413300022731SoilMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKGPSERLLEKLGFTRQTAYVRSPTAASREKKK
Ga0224550_106259023300022873SoilKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPAAASREKKK
Ga0224544_101112413300023250SoilTNIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTTYVRSPTAASREKKQ
Ga0209333_102215433300027676Forest SoilMYPSMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFARQTTYVRSPTAASLEKKK
Ga0209908_1003364523300027745Thawing PermafrostMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLGQLGFTRQTTYVRSPTAASREKKQ
Ga0209274_1021922623300027853SoilQRIPKWDTLYPSMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTTYVRSPTAASREKKK
Ga0209169_1008842923300027879SoilMYPSMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPTAASREKKH
Ga0209380_1023599323300027889SoilMAYKATTIEELIAIMKLVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPTAASREKKK
Ga0209067_1068362113300027898WatershedsMAYKATTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKEPSGRLLEKLGFSRQTTYVRSPAASRQEQEKKK
Ga0209698_1000054673300027911WatershedsMAYKATTIEELLAIMKRIQGEKTLTEFAAELDLSKQYLSNVYNRHKEPSERLLDKLGFTRQTAYLRSSTVANREKKK
Ga0209698_1013939633300027911WatershedsMYPCMAYKATTIEELLAIMKRVQGEKTLTEFAAQLDLSKQYVSNVYNRRKEPSERLLDKLGFQRQTTYVRSPAAARKETKK
Ga0209698_1040623013300027911WatershedsMGRAHVTVAVCRQQLTRIPFRDTLYPSMAYKATTIEELIAIMKRVQGDKTLTQFAGELDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAATREKKNERK
Ga0209168_10001641113300027986Surface SoilMAYKAATIEELLAIMKRVQGEKTLTEFAEDLDLSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTAANRGKKK
Ga0137415_1011036043300028536Vadose Zone SoilMAYKATTIEELIAIMKRVQGEKTLTMFAAELDMSKQYVSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASREKKK
Ga0302156_1025992513300028748BogMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTAYVRSPTDASREKKK
Ga0302222_1009645623300028798PalsaMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPTAASREKKH
Ga0302221_1029810613300028806PalsaMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFTRQTTYVRSPTAASLEKKR
Ga0311368_1028760013300029882PalsaMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFARQTTYVRSPTAASLEKKR
Ga0311369_1125431813300029910PalsaMAYKATTIEELIAIMKRVQGEKTLTKFAAELDMSKQYLSNVYNRHKEPSERLLEKLGFARQTTYVPAPTAAKPEKK
Ga0311365_1032099913300029989FenMAYKATTIEELIAIMKRVQGDKTLTEFAAELDLSKQYVSNVYNRHKEPSGRLLEQLGFTRQTTYVPSPTAAKREK
Ga0311353_1033598213300030399PalsaMAYKATTIEELIDIMKRVQGDKTLTQFAAELDLSKQYLSNVYHRHKEPSERLLEQLGFTRQTAYVRSPTAASR
Ga0311353_1047082923300030399PalsaPSMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTAYVRSPTAASREKKH
Ga0302325_1013811013300031234PalsaMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTTYVRSPTAASREKKQ
Ga0302324_10022268223300031236PalsaMYPCMAYKATTIEELIAIMKRVQGERTLTEFAAELDMSKQYICNVYNRHKEPSERLLEKLGFARQTTYVPAPTAAKPEKKK
Ga0302324_10038134513300031236PalsaTTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTTYVRSPTAASREKKQ
Ga0302324_10240239213300031236PalsaMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTTYVRSPTAAS
Ga0302326_1054862213300031525PalsaMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKEPSERLLEQLGFTRQTTYLRSPTAASREKKQ
Ga0310686_10519956323300031708SoilELIAIMKRVQGDKTLTQFAAELDLSKQYLSNVYNRHKGPSERLLEKLGFTRQTAYVRSPTAASREKKK
Ga0307478_1099735923300031823Hardwood Forest SoilMAYKATTIEDLLAIMKRVQGEKTLTQFAAELDLSKQYVSNVYNRRKEPSERLLDKLGFARQTT
Ga0307479_1081012623300031962Hardwood Forest SoilMAYKATTIEELLAIMKRVQGEKTLTQFAADLDISKQYLSNVYNRHKEPSGRLLEKLGFSRQTTYVRTPAAGRQEQEKKK
Ga0335079_10000241563300032783SoilMYPEMAYKANTIEELLEIMKRVQGDKTLTEFAADLEISKQYLSNVYNRHKEPSERLLGKLGFTRKTAYVRTPPGSLGEKEDKKK
Ga0335079_1169965523300032783SoilMAYKANTIEELLEIMKRVQGDKTLTEFAADLELSKQYLSNVYNRHKEPSERLLGKLGFTRQTAYVRSAAAGQDEKEEKKK
Ga0326727_10000050693300033405Peat SoilMYPSMAYKATTIEELIAIMKRVQGDKTLTQFAAELDLSKQYVSNVYNRHKEPSERLLGKLGFTRQTTYLRSPTAASRERKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.