NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083061

Metagenome / Metatranscriptome Family F083061

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083061
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 46 residues
Representative Sequence ATVVRDIDRTETTVRATLRVEGREDFVKEWPLGELVTVVRGP
Number of Associated Samples 106
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.64 %
% of genes near scaffold ends (potentially truncated) 92.92 %
% of genes from short scaffolds (< 2000 bps) 94.69 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.106 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.584 % of family members)
Environment Ontology (ENVO) Unclassified
(33.628 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.018 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 24.29%    Coil/Unstructured: 75.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF07992Pyr_redox_2 9.73
PF00109ketoacyl-synt 5.31
PF00069Pkinase 4.42
PF02801Ketoacyl-synt_C 3.54
PF13180PDZ_2 2.65
PF03631Virul_fac_BrkB 2.65
PF11139SfLAP 2.65
PF01872RibD_C 1.77
PF14023DUF4239 1.77
PF03992ABM 1.77
PF13396PLDc_N 1.77
PF07295DUF1451 1.77
PF00300His_Phos_1 0.88
PF01263Aldose_epim 0.88
PF04020Phage_holin_4_2 0.88
PF13365Trypsin_2 0.88
PF07366SnoaL 0.88
PF00884Sulfatase 0.88
PF02781G6PD_C 0.88
PF07730HisKA_3 0.88
PF01022HTH_5 0.88
PF14534DUF4440 0.88
PF04828GFA 0.88
PF00654Voltage_CLC 0.88
PF00589Phage_integrase 0.88
PF00211Guanylate_cyc 0.88
PF028262-Hacid_dh_C 0.88
PF13333rve_2 0.88
PF03729DUF308 0.88
PF13579Glyco_trans_4_4 0.88
PF04075F420H2_quin_red 0.88
PF13489Methyltransf_23 0.88
PF00196GerE 0.88
PF02585PIG-L 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 17.70
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 2.65
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.77
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.77
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.88
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 0.88
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.88
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.88
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.88
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.88
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.88
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.88
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.88
COG2017Galactose mutarotase or related enzymeCarbohydrate transport and metabolism [G] 0.88
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 0.88
COG0676D-hexose-6-phosphate mutarotaseCarbohydrate transport and metabolism [G] 0.88
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.11 %
UnclassifiedrootN/A23.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2032320005|FACEOR_FY84VJD01EPYPNAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig801997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3661Open in IMG/M
2170459005|F1BAP7Q01DSE6CAll Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105583907All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300000550|F24TB_10413235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1806Open in IMG/M
3300000956|JGI10216J12902_104734626Not Available718Open in IMG/M
3300001431|F14TB_100080476All Organisms → cellular organisms → Bacteria2674Open in IMG/M
3300002568|C688J35102_119513027Not Available710Open in IMG/M
3300004022|Ga0055432_10024155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1296Open in IMG/M
3300004114|Ga0062593_100278329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1407Open in IMG/M
3300004479|Ga0062595_101144835All Organisms → cellular organisms → Bacteria → Terrabacteria group685Open in IMG/M
3300005093|Ga0062594_101571956Not Available679Open in IMG/M
3300005330|Ga0070690_100393772Not Available1016Open in IMG/M
3300005332|Ga0066388_101106559All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300005336|Ga0070680_100263275All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300005338|Ga0068868_101065517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300005345|Ga0070692_10798963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300005347|Ga0070668_100299813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1347Open in IMG/M
3300005356|Ga0070674_100367431Not Available1167Open in IMG/M
3300005436|Ga0070713_101268998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300005437|Ga0070710_10021121All Organisms → cellular organisms → Bacteria3388Open in IMG/M
3300005439|Ga0070711_100115396All Organisms → cellular organisms → Bacteria1977Open in IMG/M
3300005441|Ga0070700_101210940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium631Open in IMG/M
3300005445|Ga0070708_101267312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300005468|Ga0070707_100796717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales909Open in IMG/M
3300005543|Ga0070672_100461657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1095Open in IMG/M
3300005553|Ga0066695_10749067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300005555|Ga0066692_10898382Not Available543Open in IMG/M
3300005576|Ga0066708_10685748Not Available650Open in IMG/M
3300005718|Ga0068866_10197542All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300005764|Ga0066903_108030211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300006028|Ga0070717_11396766Not Available636Open in IMG/M
3300006057|Ga0075026_100832576Not Available562Open in IMG/M
3300006175|Ga0070712_100277574All Organisms → cellular organisms → Bacteria → Terrabacteria group1348Open in IMG/M
3300006606|Ga0074062_12752253All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300009098|Ga0105245_10649659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1085Open in IMG/M
3300009098|Ga0105245_11062171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12855Open in IMG/M
3300009137|Ga0066709_101501604All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300009147|Ga0114129_11829973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300009156|Ga0111538_11429213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300009177|Ga0105248_13397002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300010154|Ga0127503_10809345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300010322|Ga0134084_10345271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300010335|Ga0134063_10692362Not Available526Open in IMG/M
3300010396|Ga0134126_11801040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300010397|Ga0134124_11913709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300011107|Ga0151490_1280497All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012198|Ga0137364_10153052Not Available1669Open in IMG/M
3300012200|Ga0137382_11176896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300012208|Ga0137376_11788822Not Available505Open in IMG/M
3300012285|Ga0137370_10601856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300012957|Ga0164303_10615536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300012989|Ga0164305_10810304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium778Open in IMG/M
3300013102|Ga0157371_10124448All Organisms → cellular organisms → Bacteria1834Open in IMG/M
3300014325|Ga0163163_10621942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1143Open in IMG/M
3300014326|Ga0157380_13356119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300015374|Ga0132255_100859508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1355Open in IMG/M
3300015374|Ga0132255_101826537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria923Open in IMG/M
3300017659|Ga0134083_10397040Not Available601Open in IMG/M
3300018053|Ga0184626_10165395All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300018056|Ga0184623_10250179Not Available809Open in IMG/M
3300018073|Ga0184624_10387739Not Available622Open in IMG/M
3300018422|Ga0190265_10940284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12986Open in IMG/M
3300018429|Ga0190272_11396690All Organisms → cellular organisms → Bacteria → Terrabacteria group704Open in IMG/M
3300018468|Ga0066662_12181120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300018481|Ga0190271_13170509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300018482|Ga0066669_10743796All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300019356|Ga0173481_10611717All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300022756|Ga0222622_10906190All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300023071|Ga0247752_1061981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300025901|Ga0207688_10181411All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300025901|Ga0207688_10997998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300025917|Ga0207660_10990289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300025926|Ga0207659_10780598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12820Open in IMG/M
3300025926|Ga0207659_11402935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300025927|Ga0207687_11208731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300025934|Ga0207686_10129263All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300025935|Ga0207709_10584195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium883Open in IMG/M
3300025937|Ga0207669_10750218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300025941|Ga0207711_10683405All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300025972|Ga0207668_10261982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1409Open in IMG/M
3300026023|Ga0207677_10582849Not Available979Open in IMG/M
3300026075|Ga0207708_11207490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300026089|Ga0207648_11846471All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae566Open in IMG/M
3300026089|Ga0207648_12075814Not Available529Open in IMG/M
3300026142|Ga0207698_10865921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium909Open in IMG/M
3300027907|Ga0207428_10832572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300028381|Ga0268264_10607160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1079Open in IMG/M
3300028744|Ga0307318_10027945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1832Open in IMG/M
3300028754|Ga0307297_10350230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300028755|Ga0307316_10341744Not Available550Open in IMG/M
3300028778|Ga0307288_10189235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300028784|Ga0307282_10043265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1990Open in IMG/M
3300028784|Ga0307282_10159609Not Available1070Open in IMG/M
3300028791|Ga0307290_10183034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300028807|Ga0307305_10271574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300028819|Ga0307296_10199816All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300028824|Ga0307310_10198076All Organisms → cellular organisms → Bacteria → Terrabacteria group947Open in IMG/M
3300028872|Ga0307314_10069978All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300028872|Ga0307314_10112884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus753Open in IMG/M
3300028878|Ga0307278_10429222Not Available580Open in IMG/M
3300031094|Ga0308199_1108164Not Available620Open in IMG/M
3300031228|Ga0299914_10173905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1910Open in IMG/M
3300031668|Ga0318542_10623447Not Available563Open in IMG/M
3300031764|Ga0318535_10562387Not Available505Open in IMG/M
3300031892|Ga0310893_10067455All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300032013|Ga0310906_10322038Not Available995Open in IMG/M
3300032174|Ga0307470_11655809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300032783|Ga0335079_10560828All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300034147|Ga0364925_0067487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1236Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.77%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.77%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.77%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.89%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2032320005Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2-EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005487Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichmentEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACEORA_52210302032320005SoilERTESSVRVTLRVHGSDDVVREWPIGEMVTVVRGP
KansclcFeb2_165923002124908045SoilVTSSLPEQGTEVEASVTREIDRTGQTVRVTLRVEEREDFIKEWPIGEMVTVDSGP
E41_001917402170459005Grass SoilIDRTDTTVRVTLRVGKGDNFVKEWPIGELVTVVRGP
INPhiseqgaiiFebDRAFT_10558390753300000364SoilMSSWADFPEHGGKVEATVVRQIDRTETAVRVTLRVAGHDEFVTEWPLGALVTVVSGP*
F24TB_1041323533300000550SoilVTSSLPEQGTEVEASVTREIDRTGQTVRVTLRVEGREDFIKEWPIGEMVTVDSGP*
JGI10216J12902_10473462623300000956SoilRAIDRTDTTVRATLRVEGREDLVKEWRLGEFVTVVRGP*
F14TB_10008047663300001431SoilVTSSLPEQGTEVEASVTREIDRTGQTVRVTLRVEEREDFIKEWPIGEMVTVDSGP*
C688J35102_11951302723300002568SoilAVEATVVREIDRTDTAVHATLRVKGREDFVREWPLGELVTVVRGP*
Ga0055432_1002415533300004022Natural And Restored WetlandsDLHEQGEQVEAKVIRVIDRTETSVRVSLHVQGREDFVREWAIDERVTVVRGP*
Ga0062593_10027832923300004114SoilEDERPVEATVVRDIDRTETTVRATLRVAGREDFVREWPLGELVTVVRGP*
Ga0062595_10114483523300004479SoilDGEVEATVIRDIDRTDATIRATLRVAGREEFVTEWPLGELVTVVRGP*
Ga0062594_10157195613300005093SoilIGLPDEDRQVEATVVREIDRTDTAVRATLRVKGREDFVKEWPLGELVTVVRGP*
Ga0070690_10039377223300005330Switchgrass RhizosphereSLTSLPDQEREVEATVVREIDRTETAVRATLRVKGREDFVKEWPVGEIVTVVRGP*
Ga0066388_10110655913300005332Tropical Forest SoilVVRDIDRTPTSVIATLRVEGRDDFVKEWPLGEMVTLVRGP*
Ga0070680_10026327513300005336Corn RhizosphereTVVREIDRTETAVRATLRVKGREDFVKEWPVGEIVTVVRGP*
Ga0068868_10106551723300005338Miscanthus RhizosphereLIDVPEENRELEATVVRPIDRTEWSVRALLRAQGREDFVKEWPLGQLVTVIRGP*
Ga0070692_1079896323300005345Corn, Switchgrass And Miscanthus RhizosphereTVVREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP*
Ga0070668_10029981313300005347Switchgrass RhizosphereTHLPDQGADVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP*
Ga0070674_10036743123300005356Miscanthus RhizosphereDQEREVEATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP*
Ga0070713_10126899813300005436Corn, Switchgrass And Miscanthus RhizosphereDQGADVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP*
Ga0070710_1002112113300005437Corn, Switchgrass And Miscanthus RhizosphereVEATVVREIDRTDTTVRATLRVKGREDFVKEWPLGELVTVVRGP*
Ga0070711_10011539633300005439Corn, Switchgrass And Miscanthus RhizosphereTVVREIDRTDTTVRATLRVKGREDFVKEWPLGELVTVVRGP*
Ga0070700_10121094023300005441Corn, Switchgrass And Miscanthus RhizosphereATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP*
Ga0070708_10126731213300005445Corn, Switchgrass And Miscanthus RhizosphereDVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP*
Ga0070707_10079671713300005468Corn, Switchgrass And Miscanthus RhizosphereHDEKVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP*
Ga0074211_13756333300005487SedimentDRTDTTVRVSLRVEGGEEFVKEWPIDARVTVVRGP*
Ga0070672_10046165713300005543Miscanthus RhizosphereVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP*
Ga0066695_1074906713300005553SoilKVEAKVVREIDRTDTTVRAVLRVKGREDFVKEWHLGELVTVVRGP*
Ga0066692_1089838213300005555SoilREIDRTDTDVRATLRVKGREDFVKEWPLGELVTVVRGP*
Ga0066708_1068574813300005576SoilTVVREIDRTDTAVRATLRVKGREDFVREWPLGELVTVVRGP*
Ga0068866_1019754213300005718Miscanthus RhizosphereVVALPEEGSEVEATVAREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP*
Ga0066903_10803021113300005764Tropical Forest SoilPEHGGEVEARVVRNIERAGTTVRATLRVEGLEDFVREWRLGEMVTVVRGP*
Ga0070717_1139676623300006028Corn, Switchgrass And Miscanthus RhizosphereVVREIDRTDTAVRATLRVKGREDFVKEWPLGELVTVVRGP*
Ga0075026_10083257623300006057WatershedsELPEGGEEVEAKVVRAIDRTERTVRVSLRVEGREDFVKEWPLGEMVTVVRGP*
Ga0070712_10027757413300006175Corn, Switchgrass And Miscanthus RhizosphereVVALPEQGSEVEATVAREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP*
Ga0074062_1275225333300006606SoilPGLDDKVEATAVRDIDRTATTVRATLRVAGREDFVEEWPLDELVTVVRGP*
Ga0105245_1064965923300009098Miscanthus RhizosphereLIDLPEENRELEATVVRPIDRTEWSVRALLRAQGREDFVKEWPLGQMVTVIRGP*
Ga0105245_1106217113300009098Miscanthus RhizosphereGSEVEATVAREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP*
Ga0066709_10150160423300009137Grasslands SoilLPEQDGEVEATVVREIDRTNGTVRVTLRVEGREDFVKEWALGEMVTVVRGP*
Ga0114129_1182997313300009147Populus RhizosphereIDRTETTVRVTLRADGREDFVKEWSLGELVTVVRGP*
Ga0111538_1142921323300009156Populus RhizosphereDFLEDERPVEATVVRDIDRTDTTVRATLRVAGREDFVREWPVGELVTVVRGP*
Ga0105248_1339700213300009177Switchgrass RhizosphereTVVREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP*
Ga0127503_1080934523300010154SoilVEARVVREIDRTETTVRVTLRVDGYDDLVKEWPLDHMVTVVRGP*
Ga0134084_1034527113300010322Grasslands SoilIDRTEQTVRALLRVEGRDDFVKEWQLGEMVTVVRGP*
Ga0134063_1069236213300010335Grasslands SoilSLPEQEGEVEAMVVRDIERTETAVRVTLRVEGHDDFVREWQSGDKVTVVRRP*
Ga0134126_1180104033300010396Terrestrial SoilVVRDIDRTETTVRVTLRVDGHEDFVEEWRIGELVTVVRGP*
Ga0134124_1191370913300010397Terrestrial SoilDRTELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP*
Ga0151490_128049713300011107SoilRTPTSVIVTLRVAGLDDFVKEWPLGEFVTLVRGP*
Ga0137364_1015305213300012198Vadose Zone SoilERTETAVRATLRVKGREDFVKEWPLGELVTVVRGP*
Ga0137382_1117689613300012200Vadose Zone SoilTVVRAIDRTETTVRATLRVDGYDDFVKEWPLDDMVTVVRGP*
Ga0137376_1178882213300012208Vadose Zone SoilTVVREIERTETAVRATLRVKGREDFVKEWPLGELVTVVRGP*
Ga0137370_1060185613300012285Vadose Zone SoilEVEAMVVRDIDRTERTVRVTLRVEGHDDFVREWQIDDMVTVVRGP*
Ga0164303_1061553613300012957SoilIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP*
Ga0164305_1081030423300012989SoilREINRTELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP*
Ga0157371_1012444813300013102Corn RhizosphereKVVEPIDRTKTSVRVSLRVAGREDFVKEWPLGEKVTVVRGP*
Ga0163163_1062194233300014325Switchgrass RhizosphereELADHDTKVEAKVVRAIDRTESTVLATLRVVGRDDFVKEWPLDELVTLVRGP*
Ga0157380_1335611913300014326Switchgrass RhizosphereIRGITRTASSVLATLRAPGREDFVKEWPLDELVTLVRGP*
Ga0132255_10085950813300015374Arabidopsis RhizosphereAVEALVVRPVERTGTSVRVTLRPEGGEEFVKEWTVGDLVTVVRGP*
Ga0132255_10182653713300015374Arabidopsis RhizosphereDRTETTVRVMLRADGREDFVKEWSLGELVTVVRGP*
Ga0134083_1039704023300017659Grasslands SoilVIGLPDEEGTVEATVVREIERTDTAVRATLRVRGREDFVKEWPLGELVTVVRGP
Ga0184626_1016539513300018053Groundwater SedimentLPEQGGVVEAKVMRDIDRTDTTVRVVLRVVGHEEDFLKEWPIGERVTVVRGP
Ga0184623_1025017933300018056Groundwater SedimentVLADLPEQAEEVEAKVVREIDRTDSTVRVTLRVEGHDDFVKEWELGEIVTVVRGP
Ga0184624_1038773913300018073Groundwater SedimentKVEATVVRDIDRTETTVRVTLRAEGHEDFVEEWRIGELVTVVRGP
Ga0190265_1094028413300018422SoilPEQGGEVEATVVRDIDRTESTVRVTLRAEGHAEFVREWALGEMVTVVRGP
Ga0190272_1139669013300018429SoilGEGEGDVEATVVRDIDRTETTVRATMRVKGREDFVKEWPLDARVVVVRGP
Ga0066662_1218112023300018468Grasslands SoilVTPAGEDAEAEAMVTREPERTESTIRVTLRVAGRDDFVQEWPIGELVTVVRGP
Ga0190270_1307042313300018469SoilKVVQAIDRTDTTVRVTLRVDGREDFVREWRLGERITVVRGP
Ga0190271_1317050923300018481SoilVVLIELDQAGQVEAKVVQAIDRTDTTVRVTLRVDGREDFVREWRLGDRVTVVRGP
Ga0066669_1074379633300018482Grasslands SoilSLHEQEGELEAMVVRDIERTETAVRVTLRVEGHDDFVREWQLGDMVTVVRGP
Ga0173481_1061171723300019356SoilGEVEAKVVEPIDRTKATVRVSLRVAGREDFVKEWPLGEKVTVVRGP
Ga0222622_1090619013300022756Groundwater SedimentDIDRTDTTVLVTLRVPGREDFIEEWRIGELVTVVRGP
Ga0247752_106198113300023071SoilGGEVEAKVVEPIDRTQTTVRVSLRVAGREDIVKEWPLDEKVTVVRGP
Ga0207688_1018141113300025901Corn, Switchgrass And Miscanthus RhizosphereQGGEVEAKVVEPIDRTKTSVRVSLRVAGREDFVKEWPLGEKVTVVRGP
Ga0207688_1099799823300025901Corn, Switchgrass And Miscanthus RhizosphereGHDEKIEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP
Ga0207660_1099028913300025917Corn RhizosphereEVEATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP
Ga0207659_1078059823300025926Miscanthus RhizosphereDRAELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP
Ga0207659_1140293513300025926Miscanthus RhizosphereAKVVRAIDRTESTVLATLRVVGRDDFVKEWPLDELVTLVRGP
Ga0207687_1120873133300025927Miscanthus RhizosphereEVEATVVREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP
Ga0207686_1012926313300025934Miscanthus RhizosphereLPDQEREVEATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP
Ga0207709_1058419533300025935Miscanthus RhizosphereATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP
Ga0207669_1075021813300025937Miscanthus RhizospherePDQEREVEATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP
Ga0207711_1068340513300025941Switchgrass RhizosphereGHDERVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP
Ga0207668_1026198213300025972Switchgrass RhizospherePVQGADVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP
Ga0207677_1058284913300026023Miscanthus RhizosphereLVSLPGQDEKVEATVVRDIDRTETTVRVTLRVEGHEDFVEEWRIGELVTVVRGP
Ga0207708_1120749013300026075Corn, Switchgrass And Miscanthus RhizosphereATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP
Ga0207648_1184647123300026089Miscanthus RhizosphereLPNLCTFVVALPEQGSEVEATVAREIDRAELTVRVTLRVEGREDFIKEWPIGEMVTVIRG
Ga0207648_1207581423300026089Miscanthus RhizosphereERQVEATVVRAVDRTETTVRVSLRVEGRDEFVREWPLDTMVTVVRGP
Ga0207698_1086592113300026142Corn RhizosphereGHDETVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP
Ga0207428_1083257223300027907Populus RhizosphereRLPDEEDEVEARVVREIDRTDTTVRATLRVDGRPDFVMEWPVGEIVTVVRGP
Ga0268264_1060716023300028381Switchgrass RhizosphereVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP
Ga0307318_1002794543300028744SoilATVVRDIDRTETTVRATLRVEGREDFVKEWPLGELVTVVRGP
Ga0307297_1035023013300028754SoilTVEATVVRDIDRTETTVRVTLRVEGREDFVQEWPLDDLVTVVRGP
Ga0307316_1034174413300028755SoilADLPEQGGEVEATVVREIDRTDSTVRVTLRVQGHDDFVREWTLGELVTVVRGP
Ga0307288_1018923523300028778SoilRDLDRTETTVRATLRVEGREDFVKEWPLDELVTVVRGP
Ga0307282_1004326543300028784SoilVLPGQDEKVEATVVRDIDRTETTDRTETTVRVTLRVEGREDFVKEWPLDELITVVRGP
Ga0307282_1015960923300028784SoilVREIDRTETAVRATLRAKGREDFVKEWPLGELVTVVRGP
Ga0307290_1018303413300028791SoilGQDEKVEATVVRDIDRTETTVRATVRVEGREDFVKEWPLGELVTVVRGP
Ga0307305_1027157413300028807SoilTVVRDLDRTETTVRATLRVEGREDFVKEWPLDELVTVVRGP
Ga0307296_1019981613300028819SoilRAIDRTDTTVRALLRVKGRDDIVREWPLGDRVTVVRGP
Ga0307310_1019807623300028824SoilVLVAPPGQDDTVEATVVRDIDRTETTVRVTLRVEGREDFVKEWPLDDLVTVVRGP
Ga0307314_1006997823300028872SoilVVLIDLPGLERQVEATVVRDIDRTDATVLVTLRVPGREDFAEEWRIGDMVTVVRGP
Ga0307314_1011288423300028872SoilEQVEATVVRDIDRTDTTVRATLRVPGREDFAREWAVDEMVTVVRGP
Ga0307278_1042922223300028878SoilVREIDRTDTAVRATLRVQGREDFVKEWPLGELVTVVRGP
Ga0308199_110816423300031094SoilLADLPEQAEEVEAKVVREIDRTDSTVRVTLRVEGHDDFVKEWELGEIVTVVRGP
Ga0299914_1017390543300031228SoilTVVRTIDRTDTSVLATMRVEGREDFVKEWRLGELVTVVRGP
Ga0318542_1062344713300031668SoilPRRVEAKVVRQIERTESAVFVTLRVPERDDFVREWMLDEMVTVVRGP
Ga0318535_1056238723300031764SoilEPRKVEAKVVRQIERTESAVFVTLRVPERDDFVREWMLDEMVTVVRGP
Ga0310893_1006745513300031892SoilEREVEATVVREIDRTETAVRATLRVKGCEDFVKEWPVGEIVTVVRGP
Ga0310906_1032203813300032013SoilVREIDRTETAVRATLRVKGREDFVKEWPVGEIVTVVRGP
Ga0307470_1165580923300032174Hardwood Forest SoilVLVSLPGHDEKVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP
Ga0335079_1056082813300032783SoilRDITRTDSTVRVALRAAGGADFTREWPLGELVTVVRGP
Ga0364925_0067487_3_1253300034147SedimentVARDIDRTEQMVRVTLRVEGRADFVKEWPLGALVTVVRGP
Ga0364927_0136931_3_1133300034148SedimentIERTDTTVRVSLRVDGREDFVREWRLGERVTVVRGP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.