Basic Information | |
---|---|
Family ID | F083061 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 46 residues |
Representative Sequence | ATVVRDIDRTETTVRATLRVEGREDFVKEWPLGELVTVVRGP |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.64 % |
% of genes near scaffold ends (potentially truncated) | 92.92 % |
% of genes from short scaffolds (< 2000 bps) | 94.69 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.106 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.584 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.628 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.018 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 24.29% Coil/Unstructured: 75.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF07992 | Pyr_redox_2 | 9.73 |
PF00109 | ketoacyl-synt | 5.31 |
PF00069 | Pkinase | 4.42 |
PF02801 | Ketoacyl-synt_C | 3.54 |
PF13180 | PDZ_2 | 2.65 |
PF03631 | Virul_fac_BrkB | 2.65 |
PF11139 | SfLAP | 2.65 |
PF01872 | RibD_C | 1.77 |
PF14023 | DUF4239 | 1.77 |
PF03992 | ABM | 1.77 |
PF13396 | PLDc_N | 1.77 |
PF07295 | DUF1451 | 1.77 |
PF00300 | His_Phos_1 | 0.88 |
PF01263 | Aldose_epim | 0.88 |
PF04020 | Phage_holin_4_2 | 0.88 |
PF13365 | Trypsin_2 | 0.88 |
PF07366 | SnoaL | 0.88 |
PF00884 | Sulfatase | 0.88 |
PF02781 | G6PD_C | 0.88 |
PF07730 | HisKA_3 | 0.88 |
PF01022 | HTH_5 | 0.88 |
PF14534 | DUF4440 | 0.88 |
PF04828 | GFA | 0.88 |
PF00654 | Voltage_CLC | 0.88 |
PF00589 | Phage_integrase | 0.88 |
PF00211 | Guanylate_cyc | 0.88 |
PF02826 | 2-Hacid_dh_C | 0.88 |
PF13333 | rve_2 | 0.88 |
PF03729 | DUF308 | 0.88 |
PF13579 | Glyco_trans_4_4 | 0.88 |
PF04075 | F420H2_quin_red | 0.88 |
PF13489 | Methyltransf_23 | 0.88 |
PF00196 | GerE | 0.88 |
PF02585 | PIG-L | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 17.70 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.65 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.77 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.77 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.88 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.88 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.88 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.88 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.88 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.88 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.88 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.88 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.88 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.88 |
COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.88 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.88 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.11 % |
Unclassified | root | N/A | 23.89 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2032320005|FACEOR_FY84VJD01EPYPN | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig801997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3661 | Open in IMG/M |
2170459005|F1BAP7Q01DSE6C | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105583907 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300000550|F24TB_10413235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1806 | Open in IMG/M |
3300000956|JGI10216J12902_104734626 | Not Available | 718 | Open in IMG/M |
3300001431|F14TB_100080476 | All Organisms → cellular organisms → Bacteria | 2674 | Open in IMG/M |
3300002568|C688J35102_119513027 | Not Available | 710 | Open in IMG/M |
3300004022|Ga0055432_10024155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1296 | Open in IMG/M |
3300004114|Ga0062593_100278329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1407 | Open in IMG/M |
3300004479|Ga0062595_101144835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 685 | Open in IMG/M |
3300005093|Ga0062594_101571956 | Not Available | 679 | Open in IMG/M |
3300005330|Ga0070690_100393772 | Not Available | 1016 | Open in IMG/M |
3300005332|Ga0066388_101106559 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300005336|Ga0070680_100263275 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300005338|Ga0068868_101065517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
3300005345|Ga0070692_10798963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300005347|Ga0070668_100299813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
3300005356|Ga0070674_100367431 | Not Available | 1167 | Open in IMG/M |
3300005436|Ga0070713_101268998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
3300005437|Ga0070710_10021121 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
3300005439|Ga0070711_100115396 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
3300005441|Ga0070700_101210940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
3300005445|Ga0070708_101267312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
3300005468|Ga0070707_100796717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 909 | Open in IMG/M |
3300005543|Ga0070672_100461657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1095 | Open in IMG/M |
3300005553|Ga0066695_10749067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300005555|Ga0066692_10898382 | Not Available | 543 | Open in IMG/M |
3300005576|Ga0066708_10685748 | Not Available | 650 | Open in IMG/M |
3300005718|Ga0068866_10197542 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300005764|Ga0066903_108030211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300006028|Ga0070717_11396766 | Not Available | 636 | Open in IMG/M |
3300006057|Ga0075026_100832576 | Not Available | 562 | Open in IMG/M |
3300006175|Ga0070712_100277574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1348 | Open in IMG/M |
3300006606|Ga0074062_12752253 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300009098|Ga0105245_10649659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1085 | Open in IMG/M |
3300009098|Ga0105245_11062171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 855 | Open in IMG/M |
3300009137|Ga0066709_101501604 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300009147|Ga0114129_11829973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300009156|Ga0111538_11429213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
3300009177|Ga0105248_13397002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
3300010154|Ga0127503_10809345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
3300010322|Ga0134084_10345271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300010335|Ga0134063_10692362 | Not Available | 526 | Open in IMG/M |
3300010396|Ga0134126_11801040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
3300010397|Ga0134124_11913709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
3300011107|Ga0151490_1280497 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300012198|Ga0137364_10153052 | Not Available | 1669 | Open in IMG/M |
3300012200|Ga0137382_11176896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
3300012208|Ga0137376_11788822 | Not Available | 505 | Open in IMG/M |
3300012285|Ga0137370_10601856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
3300012957|Ga0164303_10615536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
3300012989|Ga0164305_10810304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
3300013102|Ga0157371_10124448 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
3300014325|Ga0163163_10621942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1143 | Open in IMG/M |
3300014326|Ga0157380_13356119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
3300015374|Ga0132255_100859508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1355 | Open in IMG/M |
3300015374|Ga0132255_101826537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
3300017659|Ga0134083_10397040 | Not Available | 601 | Open in IMG/M |
3300018053|Ga0184626_10165395 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300018056|Ga0184623_10250179 | Not Available | 809 | Open in IMG/M |
3300018073|Ga0184624_10387739 | Not Available | 622 | Open in IMG/M |
3300018422|Ga0190265_10940284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 986 | Open in IMG/M |
3300018429|Ga0190272_11396690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 704 | Open in IMG/M |
3300018468|Ga0066662_12181120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
3300018481|Ga0190271_13170509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300018482|Ga0066669_10743796 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300019356|Ga0173481_10611717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
3300022756|Ga0222622_10906190 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300023071|Ga0247752_1061981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
3300025901|Ga0207688_10181411 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300025901|Ga0207688_10997998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300025917|Ga0207660_10990289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
3300025926|Ga0207659_10780598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 820 | Open in IMG/M |
3300025926|Ga0207659_11402935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
3300025927|Ga0207687_11208731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300025934|Ga0207686_10129263 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
3300025935|Ga0207709_10584195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 883 | Open in IMG/M |
3300025937|Ga0207669_10750218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300025941|Ga0207711_10683405 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300025972|Ga0207668_10261982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1409 | Open in IMG/M |
3300026023|Ga0207677_10582849 | Not Available | 979 | Open in IMG/M |
3300026075|Ga0207708_11207490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
3300026089|Ga0207648_11846471 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 566 | Open in IMG/M |
3300026089|Ga0207648_12075814 | Not Available | 529 | Open in IMG/M |
3300026142|Ga0207698_10865921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 909 | Open in IMG/M |
3300027907|Ga0207428_10832572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
3300028381|Ga0268264_10607160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
3300028744|Ga0307318_10027945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1832 | Open in IMG/M |
3300028754|Ga0307297_10350230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
3300028755|Ga0307316_10341744 | Not Available | 550 | Open in IMG/M |
3300028778|Ga0307288_10189235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300028784|Ga0307282_10043265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1990 | Open in IMG/M |
3300028784|Ga0307282_10159609 | Not Available | 1070 | Open in IMG/M |
3300028791|Ga0307290_10183034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
3300028807|Ga0307305_10271574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
3300028819|Ga0307296_10199816 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300028824|Ga0307310_10198076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 947 | Open in IMG/M |
3300028872|Ga0307314_10069978 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300028872|Ga0307314_10112884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus | 753 | Open in IMG/M |
3300028878|Ga0307278_10429222 | Not Available | 580 | Open in IMG/M |
3300031094|Ga0308199_1108164 | Not Available | 620 | Open in IMG/M |
3300031228|Ga0299914_10173905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1910 | Open in IMG/M |
3300031668|Ga0318542_10623447 | Not Available | 563 | Open in IMG/M |
3300031764|Ga0318535_10562387 | Not Available | 505 | Open in IMG/M |
3300031892|Ga0310893_10067455 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300032013|Ga0310906_10322038 | Not Available | 995 | Open in IMG/M |
3300032174|Ga0307470_11655809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300032783|Ga0335079_10560828 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300034147|Ga0364925_0067487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1236 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.54% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.65% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.77% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.89% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005487 | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACEORA_5221030 | 2032320005 | Soil | ERTESSVRVTLRVHGSDDVVREWPIGEMVTVVRGP |
KansclcFeb2_16592300 | 2124908045 | Soil | VTSSLPEQGTEVEASVTREIDRTGQTVRVTLRVEEREDFIKEWPIGEMVTVDSGP |
E41_00191740 | 2170459005 | Grass Soil | IDRTDTTVRVTLRVGKGDNFVKEWPIGELVTVVRGP |
INPhiseqgaiiFebDRAFT_1055839075 | 3300000364 | Soil | MSSWADFPEHGGKVEATVVRQIDRTETAVRVTLRVAGHDEFVTEWPLGALVTVVSGP* |
F24TB_104132353 | 3300000550 | Soil | VTSSLPEQGTEVEASVTREIDRTGQTVRVTLRVEGREDFIKEWPIGEMVTVDSGP* |
JGI10216J12902_1047346262 | 3300000956 | Soil | RAIDRTDTTVRATLRVEGREDLVKEWRLGEFVTVVRGP* |
F14TB_1000804766 | 3300001431 | Soil | VTSSLPEQGTEVEASVTREIDRTGQTVRVTLRVEEREDFIKEWPIGEMVTVDSGP* |
C688J35102_1195130272 | 3300002568 | Soil | AVEATVVREIDRTDTAVHATLRVKGREDFVREWPLGELVTVVRGP* |
Ga0055432_100241553 | 3300004022 | Natural And Restored Wetlands | DLHEQGEQVEAKVIRVIDRTETSVRVSLHVQGREDFVREWAIDERVTVVRGP* |
Ga0062593_1002783292 | 3300004114 | Soil | EDERPVEATVVRDIDRTETTVRATLRVAGREDFVREWPLGELVTVVRGP* |
Ga0062595_1011448352 | 3300004479 | Soil | DGEVEATVIRDIDRTDATIRATLRVAGREEFVTEWPLGELVTVVRGP* |
Ga0062594_1015719561 | 3300005093 | Soil | IGLPDEDRQVEATVVREIDRTDTAVRATLRVKGREDFVKEWPLGELVTVVRGP* |
Ga0070690_1003937722 | 3300005330 | Switchgrass Rhizosphere | SLTSLPDQEREVEATVVREIDRTETAVRATLRVKGREDFVKEWPVGEIVTVVRGP* |
Ga0066388_1011065591 | 3300005332 | Tropical Forest Soil | VVRDIDRTPTSVIATLRVEGRDDFVKEWPLGEMVTLVRGP* |
Ga0070680_1002632751 | 3300005336 | Corn Rhizosphere | TVVREIDRTETAVRATLRVKGREDFVKEWPVGEIVTVVRGP* |
Ga0068868_1010655172 | 3300005338 | Miscanthus Rhizosphere | LIDVPEENRELEATVVRPIDRTEWSVRALLRAQGREDFVKEWPLGQLVTVIRGP* |
Ga0070692_107989632 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TVVREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP* |
Ga0070668_1002998131 | 3300005347 | Switchgrass Rhizosphere | THLPDQGADVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP* |
Ga0070674_1003674312 | 3300005356 | Miscanthus Rhizosphere | DQEREVEATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP* |
Ga0070713_1012689981 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DQGADVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP* |
Ga0070710_100211211 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VEATVVREIDRTDTTVRATLRVKGREDFVKEWPLGELVTVVRGP* |
Ga0070711_1001153963 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TVVREIDRTDTTVRATLRVKGREDFVKEWPLGELVTVVRGP* |
Ga0070700_1012109402 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | ATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP* |
Ga0070708_1012673121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP* |
Ga0070707_1007967171 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HDEKVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP* |
Ga0074211_1375633 | 3300005487 | Sediment | DRTDTTVRVSLRVEGGEEFVKEWPIDARVTVVRGP* |
Ga0070672_1004616571 | 3300005543 | Miscanthus Rhizosphere | VEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP* |
Ga0066695_107490671 | 3300005553 | Soil | KVEAKVVREIDRTDTTVRAVLRVKGREDFVKEWHLGELVTVVRGP* |
Ga0066692_108983821 | 3300005555 | Soil | REIDRTDTDVRATLRVKGREDFVKEWPLGELVTVVRGP* |
Ga0066708_106857481 | 3300005576 | Soil | TVVREIDRTDTAVRATLRVKGREDFVREWPLGELVTVVRGP* |
Ga0068866_101975421 | 3300005718 | Miscanthus Rhizosphere | VVALPEEGSEVEATVAREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP* |
Ga0066903_1080302111 | 3300005764 | Tropical Forest Soil | PEHGGEVEARVVRNIERAGTTVRATLRVEGLEDFVREWRLGEMVTVVRGP* |
Ga0070717_113967662 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VVREIDRTDTAVRATLRVKGREDFVKEWPLGELVTVVRGP* |
Ga0075026_1008325762 | 3300006057 | Watersheds | ELPEGGEEVEAKVVRAIDRTERTVRVSLRVEGREDFVKEWPLGEMVTVVRGP* |
Ga0070712_1002775741 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VVALPEQGSEVEATVAREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP* |
Ga0074062_127522533 | 3300006606 | Soil | PGLDDKVEATAVRDIDRTATTVRATLRVAGREDFVEEWPLDELVTVVRGP* |
Ga0105245_106496592 | 3300009098 | Miscanthus Rhizosphere | LIDLPEENRELEATVVRPIDRTEWSVRALLRAQGREDFVKEWPLGQMVTVIRGP* |
Ga0105245_110621711 | 3300009098 | Miscanthus Rhizosphere | GSEVEATVAREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP* |
Ga0066709_1015016042 | 3300009137 | Grasslands Soil | LPEQDGEVEATVVREIDRTNGTVRVTLRVEGREDFVKEWALGEMVTVVRGP* |
Ga0114129_118299731 | 3300009147 | Populus Rhizosphere | IDRTETTVRVTLRADGREDFVKEWSLGELVTVVRGP* |
Ga0111538_114292132 | 3300009156 | Populus Rhizosphere | DFLEDERPVEATVVRDIDRTDTTVRATLRVAGREDFVREWPVGELVTVVRGP* |
Ga0105248_133970021 | 3300009177 | Switchgrass Rhizosphere | TVVREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP* |
Ga0127503_108093452 | 3300010154 | Soil | VEARVVREIDRTETTVRVTLRVDGYDDLVKEWPLDHMVTVVRGP* |
Ga0134084_103452711 | 3300010322 | Grasslands Soil | IDRTEQTVRALLRVEGRDDFVKEWQLGEMVTVVRGP* |
Ga0134063_106923621 | 3300010335 | Grasslands Soil | SLPEQEGEVEAMVVRDIERTETAVRVTLRVEGHDDFVREWQSGDKVTVVRRP* |
Ga0134126_118010403 | 3300010396 | Terrestrial Soil | VVRDIDRTETTVRVTLRVDGHEDFVEEWRIGELVTVVRGP* |
Ga0134124_119137091 | 3300010397 | Terrestrial Soil | DRTELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP* |
Ga0151490_12804971 | 3300011107 | Soil | RTPTSVIVTLRVAGLDDFVKEWPLGEFVTLVRGP* |
Ga0137364_101530521 | 3300012198 | Vadose Zone Soil | ERTETAVRATLRVKGREDFVKEWPLGELVTVVRGP* |
Ga0137382_111768961 | 3300012200 | Vadose Zone Soil | TVVRAIDRTETTVRATLRVDGYDDFVKEWPLDDMVTVVRGP* |
Ga0137376_117888221 | 3300012208 | Vadose Zone Soil | TVVREIERTETAVRATLRVKGREDFVKEWPLGELVTVVRGP* |
Ga0137370_106018561 | 3300012285 | Vadose Zone Soil | EVEAMVVRDIDRTERTVRVTLRVEGHDDFVREWQIDDMVTVVRGP* |
Ga0164303_106155361 | 3300012957 | Soil | IDRTELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP* |
Ga0164305_108103042 | 3300012989 | Soil | REINRTELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP* |
Ga0157371_101244481 | 3300013102 | Corn Rhizosphere | KVVEPIDRTKTSVRVSLRVAGREDFVKEWPLGEKVTVVRGP* |
Ga0163163_106219423 | 3300014325 | Switchgrass Rhizosphere | ELADHDTKVEAKVVRAIDRTESTVLATLRVVGRDDFVKEWPLDELVTLVRGP* |
Ga0157380_133561191 | 3300014326 | Switchgrass Rhizosphere | IRGITRTASSVLATLRAPGREDFVKEWPLDELVTLVRGP* |
Ga0132255_1008595081 | 3300015374 | Arabidopsis Rhizosphere | AVEALVVRPVERTGTSVRVTLRPEGGEEFVKEWTVGDLVTVVRGP* |
Ga0132255_1018265371 | 3300015374 | Arabidopsis Rhizosphere | DRTETTVRVMLRADGREDFVKEWSLGELVTVVRGP* |
Ga0134083_103970402 | 3300017659 | Grasslands Soil | VIGLPDEEGTVEATVVREIERTDTAVRATLRVRGREDFVKEWPLGELVTVVRGP |
Ga0184626_101653951 | 3300018053 | Groundwater Sediment | LPEQGGVVEAKVMRDIDRTDTTVRVVLRVVGHEEDFLKEWPIGERVTVVRGP |
Ga0184623_102501793 | 3300018056 | Groundwater Sediment | VLADLPEQAEEVEAKVVREIDRTDSTVRVTLRVEGHDDFVKEWELGEIVTVVRGP |
Ga0184624_103877391 | 3300018073 | Groundwater Sediment | KVEATVVRDIDRTETTVRVTLRAEGHEDFVEEWRIGELVTVVRGP |
Ga0190265_109402841 | 3300018422 | Soil | PEQGGEVEATVVRDIDRTESTVRVTLRAEGHAEFVREWALGEMVTVVRGP |
Ga0190272_113966901 | 3300018429 | Soil | GEGEGDVEATVVRDIDRTETTVRATMRVKGREDFVKEWPLDARVVVVRGP |
Ga0066662_121811202 | 3300018468 | Grasslands Soil | VTPAGEDAEAEAMVTREPERTESTIRVTLRVAGRDDFVQEWPIGELVTVVRGP |
Ga0190270_130704231 | 3300018469 | Soil | KVVQAIDRTDTTVRVTLRVDGREDFVREWRLGERITVVRGP |
Ga0190271_131705092 | 3300018481 | Soil | VVLIELDQAGQVEAKVVQAIDRTDTTVRVTLRVDGREDFVREWRLGDRVTVVRGP |
Ga0066669_107437963 | 3300018482 | Grasslands Soil | SLHEQEGELEAMVVRDIERTETAVRVTLRVEGHDDFVREWQLGDMVTVVRGP |
Ga0173481_106117172 | 3300019356 | Soil | GEVEAKVVEPIDRTKATVRVSLRVAGREDFVKEWPLGEKVTVVRGP |
Ga0222622_109061901 | 3300022756 | Groundwater Sediment | DIDRTDTTVLVTLRVPGREDFIEEWRIGELVTVVRGP |
Ga0247752_10619811 | 3300023071 | Soil | GGEVEAKVVEPIDRTQTTVRVSLRVAGREDIVKEWPLDEKVTVVRGP |
Ga0207688_101814111 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | QGGEVEAKVVEPIDRTKTSVRVSLRVAGREDFVKEWPLGEKVTVVRGP |
Ga0207688_109979982 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | GHDEKIEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP |
Ga0207660_109902891 | 3300025917 | Corn Rhizosphere | EVEATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP |
Ga0207659_107805982 | 3300025926 | Miscanthus Rhizosphere | DRAELTVRVTLRVEGREDFIKEWPIGEMVTVIRGP |
Ga0207659_114029351 | 3300025926 | Miscanthus Rhizosphere | AKVVRAIDRTESTVLATLRVVGRDDFVKEWPLDELVTLVRGP |
Ga0207687_112087313 | 3300025927 | Miscanthus Rhizosphere | EVEATVVREIDRTELTVRVTLRVEGREDFIKEWPIGEMVTVVRGP |
Ga0207686_101292631 | 3300025934 | Miscanthus Rhizosphere | LPDQEREVEATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP |
Ga0207709_105841953 | 3300025935 | Miscanthus Rhizosphere | ATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP |
Ga0207669_107502181 | 3300025937 | Miscanthus Rhizosphere | PDQEREVEATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP |
Ga0207711_106834051 | 3300025941 | Switchgrass Rhizosphere | GHDERVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP |
Ga0207668_102619821 | 3300025972 | Switchgrass Rhizosphere | PVQGADVEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP |
Ga0207677_105828491 | 3300026023 | Miscanthus Rhizosphere | LVSLPGQDEKVEATVVRDIDRTETTVRVTLRVEGHEDFVEEWRIGELVTVVRGP |
Ga0207708_112074901 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ATVVREIDRTETAVRATLRVKGREDFVKEWPLGEIVTVVRGP |
Ga0207648_118464712 | 3300026089 | Miscanthus Rhizosphere | LPNLCTFVVALPEQGSEVEATVAREIDRAELTVRVTLRVEGREDFIKEWPIGEMVTVIRG |
Ga0207648_120758142 | 3300026089 | Miscanthus Rhizosphere | ERQVEATVVRAVDRTETTVRVSLRVEGRDEFVREWPLDTMVTVVRGP |
Ga0207698_108659211 | 3300026142 | Corn Rhizosphere | GHDETVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP |
Ga0207428_108325722 | 3300027907 | Populus Rhizosphere | RLPDEEDEVEARVVREIDRTDTTVRATLRVDGRPDFVMEWPVGEIVTVVRGP |
Ga0268264_106071602 | 3300028381 | Switchgrass Rhizosphere | VEATVVRAIDRTESTVRATLRVPGRDDFIKEWALGDLITIVRGP |
Ga0307318_100279454 | 3300028744 | Soil | ATVVRDIDRTETTVRATLRVEGREDFVKEWPLGELVTVVRGP |
Ga0307297_103502301 | 3300028754 | Soil | TVEATVVRDIDRTETTVRVTLRVEGREDFVQEWPLDDLVTVVRGP |
Ga0307316_103417441 | 3300028755 | Soil | ADLPEQGGEVEATVVREIDRTDSTVRVTLRVQGHDDFVREWTLGELVTVVRGP |
Ga0307288_101892352 | 3300028778 | Soil | RDLDRTETTVRATLRVEGREDFVKEWPLDELVTVVRGP |
Ga0307282_100432654 | 3300028784 | Soil | VLPGQDEKVEATVVRDIDRTETTDRTETTVRVTLRVEGREDFVKEWPLDELITVVRGP |
Ga0307282_101596092 | 3300028784 | Soil | VREIDRTETAVRATLRAKGREDFVKEWPLGELVTVVRGP |
Ga0307290_101830341 | 3300028791 | Soil | GQDEKVEATVVRDIDRTETTVRATVRVEGREDFVKEWPLGELVTVVRGP |
Ga0307305_102715741 | 3300028807 | Soil | TVVRDLDRTETTVRATLRVEGREDFVKEWPLDELVTVVRGP |
Ga0307296_101998161 | 3300028819 | Soil | RAIDRTDTTVRALLRVKGRDDIVREWPLGDRVTVVRGP |
Ga0307310_101980762 | 3300028824 | Soil | VLVAPPGQDDTVEATVVRDIDRTETTVRVTLRVEGREDFVKEWPLDDLVTVVRGP |
Ga0307314_100699782 | 3300028872 | Soil | VVLIDLPGLERQVEATVVRDIDRTDATVLVTLRVPGREDFAEEWRIGDMVTVVRGP |
Ga0307314_101128842 | 3300028872 | Soil | EQVEATVVRDIDRTDTTVRATLRVPGREDFAREWAVDEMVTVVRGP |
Ga0307278_104292222 | 3300028878 | Soil | VREIDRTDTAVRATLRVQGREDFVKEWPLGELVTVVRGP |
Ga0308199_11081642 | 3300031094 | Soil | LADLPEQAEEVEAKVVREIDRTDSTVRVTLRVEGHDDFVKEWELGEIVTVVRGP |
Ga0299914_101739054 | 3300031228 | Soil | TVVRTIDRTDTSVLATMRVEGREDFVKEWRLGELVTVVRGP |
Ga0318542_106234471 | 3300031668 | Soil | PRRVEAKVVRQIERTESAVFVTLRVPERDDFVREWMLDEMVTVVRGP |
Ga0318535_105623872 | 3300031764 | Soil | EPRKVEAKVVRQIERTESAVFVTLRVPERDDFVREWMLDEMVTVVRGP |
Ga0310893_100674551 | 3300031892 | Soil | EREVEATVVREIDRTETAVRATLRVKGCEDFVKEWPVGEIVTVVRGP |
Ga0310906_103220381 | 3300032013 | Soil | VREIDRTETAVRATLRVKGREDFVKEWPVGEIVTVVRGP |
Ga0307470_116558092 | 3300032174 | Hardwood Forest Soil | VLVSLPGHDEKVEATVVRDIDRTETSVRATLRVEGREDFVQEWPLGELVTVVRGP |
Ga0335079_105608281 | 3300032783 | Soil | RDITRTDSTVRVALRAAGGADFTREWPLGELVTVVRGP |
Ga0364925_0067487_3_125 | 3300034147 | Sediment | VARDIDRTEQMVRVTLRVEGRADFVKEWPLGALVTVVRGP |
Ga0364927_0136931_3_113 | 3300034148 | Sediment | IERTDTTVRVSLRVDGREDFVREWRLGERVTVVRGP |
⦗Top⦘ |