| Basic Information | |
|---|---|
| Family ID | F083054 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MLNPLRSEGDAFRLLLYVIAVFGTIIAIILIARAL |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 32.65 % |
| % of genes near scaffold ends (potentially truncated) | 12.39 % |
| % of genes from short scaffolds (< 2000 bps) | 65.49 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.372 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.620 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.434 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.637 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.21% β-sheet: 0.00% Coil/Unstructured: 50.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00127 | Copper-bind | 46.90 |
| PF00510 | COX3 | 34.51 |
| PF00115 | COX1 | 4.42 |
| PF13302 | Acetyltransf_3 | 1.77 |
| PF00459 | Inositol_P | 1.77 |
| PF13579 | Glyco_trans_4_4 | 1.77 |
| PF00255 | GSHPx | 0.88 |
| PF01966 | HD | 0.88 |
| PF01040 | UbiA | 0.88 |
| PF12627 | PolyA_pol_RNAbd | 0.88 |
| PF00534 | Glycos_transf_1 | 0.88 |
| PF00155 | Aminotran_1_2 | 0.88 |
| PF01872 | RibD_C | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 34.51 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.88 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.88 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.37 % |
| Unclassified | root | N/A | 33.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10893379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 564 | Open in IMG/M |
| 3300005541|Ga0070733_10290968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1078 | Open in IMG/M |
| 3300005564|Ga0070664_101268028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 696 | Open in IMG/M |
| 3300005602|Ga0070762_10453898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 834 | Open in IMG/M |
| 3300006059|Ga0075017_100239506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1324 | Open in IMG/M |
| 3300006059|Ga0075017_100714891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 771 | Open in IMG/M |
| 3300006638|Ga0075522_10078045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1837 | Open in IMG/M |
| 3300006638|Ga0075522_10100918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1564 | Open in IMG/M |
| 3300006954|Ga0079219_10550542 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300009672|Ga0116215_1070977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1570 | Open in IMG/M |
| 3300009698|Ga0116216_10292086 | Not Available | 994 | Open in IMG/M |
| 3300009824|Ga0116219_10191692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1172 | Open in IMG/M |
| 3300010042|Ga0126314_10165126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1549 | Open in IMG/M |
| 3300010152|Ga0126318_10357496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1081 | Open in IMG/M |
| 3300010341|Ga0074045_10189705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1381 | Open in IMG/M |
| 3300010379|Ga0136449_100433188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2316 | Open in IMG/M |
| 3300010379|Ga0136449_103811040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 567 | Open in IMG/M |
| 3300010379|Ga0136449_104363815 | Not Available | 522 | Open in IMG/M |
| 3300012176|Ga0153952_1132867 | Not Available | 548 | Open in IMG/M |
| 3300012212|Ga0150985_102080630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1304 | Open in IMG/M |
| 3300012678|Ga0136615_10015293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3956 | Open in IMG/M |
| 3300012958|Ga0164299_11479599 | Not Available | 529 | Open in IMG/M |
| 3300014155|Ga0181524_10037785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3226 | Open in IMG/M |
| 3300014155|Ga0181524_10381238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 620 | Open in IMG/M |
| 3300014162|Ga0181538_10443591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 688 | Open in IMG/M |
| 3300014165|Ga0181523_10324963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 865 | Open in IMG/M |
| 3300014199|Ga0181535_10024067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4745 | Open in IMG/M |
| 3300014199|Ga0181535_10392145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 814 | Open in IMG/M |
| 3300014201|Ga0181537_10960524 | Not Available | 578 | Open in IMG/M |
| 3300014489|Ga0182018_10528502 | Not Available | 623 | Open in IMG/M |
| 3300014493|Ga0182016_10154166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1540 | Open in IMG/M |
| 3300014493|Ga0182016_10300247 | Not Available | 983 | Open in IMG/M |
| 3300014501|Ga0182024_10038084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 8000 | Open in IMG/M |
| 3300014501|Ga0182024_10286328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2186 | Open in IMG/M |
| 3300014501|Ga0182024_10556396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1446 | Open in IMG/M |
| 3300014501|Ga0182024_10908454 | Not Available | 1060 | Open in IMG/M |
| 3300014501|Ga0182024_11512393 | Not Available | 766 | Open in IMG/M |
| 3300014501|Ga0182024_12952499 | Not Available | 502 | Open in IMG/M |
| 3300014655|Ga0181516_10669248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 537 | Open in IMG/M |
| 3300014838|Ga0182030_10042987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7455 | Open in IMG/M |
| 3300014838|Ga0182030_11247294 | Not Available | 631 | Open in IMG/M |
| 3300015080|Ga0167639_1012955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1196 | Open in IMG/M |
| 3300015161|Ga0167623_1039107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1015 | Open in IMG/M |
| 3300015199|Ga0167647_1001141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10194 | Open in IMG/M |
| 3300017822|Ga0187802_10264871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300017938|Ga0187854_10096424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1391 | Open in IMG/M |
| 3300017948|Ga0187847_10059096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2164 | Open in IMG/M |
| 3300018033|Ga0187867_10536356 | Not Available | 642 | Open in IMG/M |
| 3300018034|Ga0187863_10248538 | Not Available | 988 | Open in IMG/M |
| 3300018042|Ga0187871_10204764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1102 | Open in IMG/M |
| 3300018043|Ga0187887_10020460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4280 | Open in IMG/M |
| 3300018047|Ga0187859_10026733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3140 | Open in IMG/M |
| 3300018422|Ga0190265_10314998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1640 | Open in IMG/M |
| 3300020581|Ga0210399_10103239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2334 | Open in IMG/M |
| 3300020583|Ga0210401_10482527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1102 | Open in IMG/M |
| 3300021178|Ga0210408_10005979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 10579 | Open in IMG/M |
| 3300021180|Ga0210396_10000615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 44946 | Open in IMG/M |
| 3300021181|Ga0210388_10404599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
| 3300021403|Ga0210397_10024720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3717 | Open in IMG/M |
| 3300021404|Ga0210389_10133551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1921 | Open in IMG/M |
| 3300021420|Ga0210394_10789054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 830 | Open in IMG/M |
| 3300021433|Ga0210391_10425167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1043 | Open in IMG/M |
| 3300021433|Ga0210391_10536932 | Not Available | 918 | Open in IMG/M |
| 3300021474|Ga0210390_11495280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 535 | Open in IMG/M |
| 3300025588|Ga0208586_1101567 | Not Available | 621 | Open in IMG/M |
| 3300025627|Ga0208220_1069315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 994 | Open in IMG/M |
| 3300025862|Ga0209483_1072583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1560 | Open in IMG/M |
| 3300026075|Ga0207708_10454576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1067 | Open in IMG/M |
| 3300027867|Ga0209167_10287183 | Not Available | 888 | Open in IMG/M |
| 3300027889|Ga0209380_10656770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 604 | Open in IMG/M |
| 3300027905|Ga0209415_10038032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6617 | Open in IMG/M |
| 3300027905|Ga0209415_10098184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3233 | Open in IMG/M |
| 3300027905|Ga0209415_10122960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 2731 | Open in IMG/M |
| 3300027908|Ga0209006_10048585 | All Organisms → cellular organisms → Bacteria | 3817 | Open in IMG/M |
| 3300027911|Ga0209698_10095085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2502 | Open in IMG/M |
| 3300027911|Ga0209698_10615736 | Not Available | 833 | Open in IMG/M |
| 3300028047|Ga0209526_10407194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 902 | Open in IMG/M |
| 3300028562|Ga0302151_10020507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2453 | Open in IMG/M |
| 3300028762|Ga0302202_10106998 | Not Available | 1589 | Open in IMG/M |
| 3300028800|Ga0265338_10901833 | Not Available | 602 | Open in IMG/M |
| 3300029999|Ga0311339_11371377 | Not Available | 637 | Open in IMG/M |
| 3300030225|Ga0302196_10107810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1570 | Open in IMG/M |
| 3300030294|Ga0311349_10633203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1010 | Open in IMG/M |
| 3300030520|Ga0311372_12765135 | Not Available | 540 | Open in IMG/M |
| 3300031164|Ga0307502_10013506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1418 | Open in IMG/M |
| 3300031234|Ga0302325_10023158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 12963 | Open in IMG/M |
| 3300031670|Ga0307374_10233494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1258 | Open in IMG/M |
| 3300031708|Ga0310686_102990133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1683 | Open in IMG/M |
| 3300031723|Ga0318493_10694604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 570 | Open in IMG/M |
| 3300031962|Ga0307479_10774210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 936 | Open in IMG/M |
| 3300032160|Ga0311301_10283771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2676 | Open in IMG/M |
| 3300032805|Ga0335078_10601299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1387 | Open in IMG/M |
| 3300032895|Ga0335074_10409904 | Not Available | 1464 | Open in IMG/M |
| 3300032898|Ga0335072_10538342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1196 | Open in IMG/M |
| 3300032898|Ga0335072_11009058 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300032955|Ga0335076_11434987 | Not Available | 576 | Open in IMG/M |
| 3300033887|Ga0334790_003778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10486 | Open in IMG/M |
| 3300033888|Ga0334792_078359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 955 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.19% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.31% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 5.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.54% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.54% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.65% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012526 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06) | Environmental | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031164 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_108933792 | 3300001686 | Soil | VLNPLRSEGEAFRVLLYVIVVFGAIALIALLVQSLT* |
| Ga0070741_104575422 | 3300005529 | Surface Soil | MLNPLRSEGEAFRLLIYVILVAAVVIALVLGLRAIF* |
| Ga0070731_107048561 | 3300005538 | Surface Soil | VLNPLRSEEEAFRLLLYVVGFFVVVIALVLIGRAIF* |
| Ga0070733_102909681 | 3300005541 | Surface Soil | MLNPLRSEGEAFRALLYVIAFFGTIIAIILIARALS* |
| Ga0070664_1012680282 | 3300005564 | Corn Rhizosphere | VINPLRSEGEAFRFLLYVVAFFAAVILIVLLVRAL* |
| Ga0070762_104538982 | 3300005602 | Soil | MRNPLRSEGDMFRLLLYVIAVFGAIIAVIVIVRALR* |
| Ga0075017_1002395063 | 3300006059 | Watersheds | MRNPLRSEGDMFRLLLWVIAVFAVIIAVVVIARAL* |
| Ga0075017_1007148911 | 3300006059 | Watersheds | MLNPLRSEADAFRVLLYVIAVFGTLIAIILIARAL* |
| Ga0070712_1004162263 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNPLRSEGEAFRLLLYVLGVVAIAIAAILIVRAVS* |
| Ga0075522_100780452 | 3300006638 | Arctic Peat Soil | LLNPLRSEGDAFRLLLYVIAVFGAIIAIILIARAL* |
| Ga0075522_101009183 | 3300006638 | Arctic Peat Soil | MRNPLRSEGEMFRLLLYVIAVFGTIIAIIVIVRALR* |
| Ga0075521_104066912 | 3300006642 | Arctic Peat Soil | VLNPLRSEGEAFKLLLYVLVVAAAVVALILILRAIL* |
| Ga0079221_107934512 | 3300006804 | Agricultural Soil | VFNPLRSEGEAFRLLLYVLVIAIVVIGVVLLLRAT* |
| Ga0079219_105505422 | 3300006954 | Agricultural Soil | MLNPLRSEGDAFRLLWYVVAVFAAIVIIVLLIRAFS* |
| Ga0116215_10709771 | 3300009672 | Peatlands Soil | MRNPLRSEGDMFRLLLYVIAVFGTIIAIIVIVRALR* |
| Ga0116216_102920862 | 3300009698 | Peatlands Soil | MLNPLRSETDAFRLLLYVIAFFGTIILIVVIARAL* |
| Ga0116219_101916922 | 3300009824 | Peatlands Soil | MRNPLRSEGDMFRLLLYVIVVFGTIIAIIVIVRALR* |
| Ga0126314_101651263 | 3300010042 | Serpentine Soil | MLNPLDSEQAAFRFLLYAIVFFAIVIAIVLIARLI* |
| Ga0126318_103574963 | 3300010152 | Soil | MFNPLRSEGDAFRTLLYIIGFFALLIAIVLIARAL* |
| Ga0074045_101897052 | 3300010341 | Bog Forest Soil | MLNPLRSEGEAFRLLLYVGGVFLVIIVIALVLHALL* |
| Ga0134125_110926832 | 3300010371 | Terrestrial Soil | VLNPLRSEGEAFRLLVYVLVLTVVVIALVLGLRAIF* |
| Ga0134128_100504933 | 3300010373 | Terrestrial Soil | MFNPLRSEGEAFQLLLYVIAVAVVVIVLVLGLRAIF* |
| Ga0136449_1004331883 | 3300010379 | Peatlands Soil | MLNPLRSEGEAFRLLLYVMVVFGTIIAVVLIARAL* |
| Ga0136449_1038110402 | 3300010379 | Peatlands Soil | MLNPLRSEGEAFRLLLYVIAFFGTIIAIILIARAV* |
| Ga0136449_1043638151 | 3300010379 | Peatlands Soil | MRNPLRSEGDMFRLLLYVIAVFGTIIAIILIVRALT* |
| Ga0136623_104762341 | 3300012045 | Polar Desert Sand | VLNPLRSEGEAFRLLLYVLVIAVVIGAIVLIVRAL* |
| Ga0153952_11328671 | 3300012176 | Attine Ant Fungus Gardens | VLNPLRSEGEMFRLLIYVIAFFAVIIALVLILRAIF* |
| Ga0150985_1020806303 | 3300012212 | Avena Fatua Rhizosphere | MLNPLDSEQAAFRFLLYAIVFFAIVIAIVLLVRALT* |
| Ga0150985_1083856852 | 3300012212 | Avena Fatua Rhizosphere | VRFNPLRSEGEAFRLLLYVVAAAVLVIAVVLLARAVT* |
| Ga0150985_1209846621 | 3300012212 | Avena Fatua Rhizosphere | VFNPLRSEGEAFQLLLYVIVVAAVVIALVLGLRAIF* |
| Ga0134058_12400971 | 3300012379 | Grasslands Soil | VLNPLRSEGEAFQLLLWVIAAAIAIVIVVEVGRAIF* |
| Ga0136637_11735531 | 3300012526 | Polar Desert Sand | AAVLNPLRSEGEAFRLLLYVLVIAVVIGAIVLIVRAL* |
| Ga0136615_100152935 | 3300012678 | Polar Desert Sand | LNPLRSESEAFRLLLYVAVVLGVIVVIVLVARAL* |
| Ga0164299_114795992 | 3300012958 | Soil | MLNPLRSEGEAFRALLWVVGVAAVIIAIVLIARALF* |
| Ga0181524_100377851 | 3300014155 | Bog | MLNPLRSEGDAFRVLLYVIAGFAVIIALIEIARAIV* |
| Ga0181524_103812382 | 3300014155 | Bog | MLNPLRSEGDAFRLLLYVAGVFLTIVVLILAVRAIF* |
| Ga0181538_104435912 | 3300014162 | Bog | MLNPLRSEGDAFRLLLYVAGVFLAIVVLILAVRAIF* |
| Ga0181523_103249632 | 3300014165 | Bog | VLNPLRSEGEAFRLLLYVIVFFGLVIAIVVIIRAL* |
| Ga0181535_100240674 | 3300014199 | Bog | MLNPLRSEGDAFRFLLYVIVVFGSIIAVILIARALS* |
| Ga0181535_103921452 | 3300014199 | Bog | MLNPLRSESDAFRFLLYVIAVFGTIIAIIVIVRAI* |
| Ga0181537_109605242 | 3300014201 | Bog | VINPLRSEGEAFRFLLWVIAVFGAIIAIIVIVRAL* |
| Ga0182018_105285022 | 3300014489 | Palsa | MINPLRSEGDAFRFLLYVIAVFGAIIAIIVIVRAL* |
| Ga0182016_101541663 | 3300014493 | Bog | MLNPLRSEQDAFRLLIYAIVVFGVIIAVILAARAIF* |
| Ga0182016_103002471 | 3300014493 | Bog | VINPLGSESEAFRFLLYVIAVFGTIIAIIVIVRAI* |
| Ga0182024_100380849 | 3300014501 | Permafrost | MRNPLRSEGDMFRLLLYVIAVFGTIIAIIVIARALR* |
| Ga0182024_102863283 | 3300014501 | Permafrost | MLNPLRSEGEAFRALLYVIAFFGTIIAIVLIARALS* |
| Ga0182024_105563962 | 3300014501 | Permafrost | MRNPLRSEGDMFRLLLYVIAVFGTIIAVIVIVRALR* |
| Ga0182024_109084542 | 3300014501 | Permafrost | MRNPLRSEGDMFRLLLYVIGVFGTIIAIIVIARALR* |
| Ga0182024_115123931 | 3300014501 | Permafrost | LNPLRSEGEAFRALLYVIAFFGTIIAIILIARALS* |
| Ga0182024_129524992 | 3300014501 | Permafrost | MRNPLRSEGDMFRLLLYVIAVFGTIIAIIIIVRALR* |
| Ga0181516_106692482 | 3300014655 | Bog | VINPLRSEGEAFRFLLYVIAVFGAIIAIIVIVRAL* |
| Ga0182030_100429872 | 3300014838 | Bog | MLNPLRSESDAFRLLLYVIAVFGTIIAIIVIARAL* |
| Ga0182030_112472942 | 3300014838 | Bog | MLNPLRSEGEAFRLLLYVIVFFGLVIAIVLIARAL* |
| Ga0167639_10129552 | 3300015080 | Glacier Forefield Soil | LNPLRSEGEAFRLLIYAIAFFAVVIALILIGRAIF* |
| Ga0167623_10391072 | 3300015161 | Glacier Forefield Soil | VNPLRSEGEAFRFLLYVIGVFLVLTAIVVIARAL* |
| Ga0167647_10011411 | 3300015199 | Glacier Forefield Soil | MLNPLRSEGEAFRFVIYVAVFFGVLIAVVVIARAV* |
| Ga0187802_102648712 | 3300017822 | Freshwater Sediment | VLNPLRSEGDAFRLLLYAIAVTGVIAALVIILRAIL |
| Ga0187854_100964242 | 3300017938 | Peatland | MLNPLRSEGDAFRVLLYVIAGFAVIIALIEIARAIV |
| Ga0187847_100590963 | 3300017948 | Peatland | MLNPLRSEGDAFRFLLYVIVVFGSIIAVILIARALS |
| Ga0187867_105363562 | 3300018033 | Peatland | VLNPLRSEGDAFRVLLYVIAGFAVIIALIEIARALS |
| Ga0187863_102485382 | 3300018034 | Peatland | GWSGRRVINPLRSEGDAFRFLLYVIAVFGAIIAIIVIVRAL |
| Ga0187871_102047642 | 3300018042 | Peatland | VINPLRSEGDAFRFLLYVIAVFGAIIAIIVIVRAL |
| Ga0187887_100204604 | 3300018043 | Peatland | MINPLRSEGDAFRFLLYVIVVFGSIIAVILIARALS |
| Ga0187859_100267334 | 3300018047 | Peatland | VINPLRSEGEAFRFLLWVIAVFGAIIAIIVIVRAL |
| Ga0190265_103149982 | 3300018422 | Soil | VLNPLRSEGEAFRFLLYVAVTVGVITATILILRAIL |
| Ga0210399_101032393 | 3300020581 | Soil | VLNPLRSEGEMFRLLLYVIVVFAVIIAAILILRAIF |
| Ga0210401_104825271 | 3300020583 | Soil | MLNPLRSEAEMFRLLLYVIVVFGVIIAAILIARAIF |
| Ga0210408_1000597910 | 3300021178 | Soil | MLNPLRSEGEMFRLLIYVVVVFAVIIAAILILRAI |
| Ga0210396_1000061529 | 3300021180 | Soil | MLNPLRSEGEMFRALIYVIVFFALVIALVLIGRAIF |
| Ga0210388_104045992 | 3300021181 | Soil | VLNPLRSEGEAFRLLIYAIAFFAVVIALVLIGRAIF |
| Ga0210397_100247204 | 3300021403 | Soil | MPNPLRSEGEMFRLLLYVIVVFAVLIAAILIVRAIS |
| Ga0210389_101335513 | 3300021404 | Soil | LLNPLRSEGEAFRLLIYAIAFFAIVIALVLIGRAIF |
| Ga0210394_107890542 | 3300021420 | Soil | MLNPLRSEGEMFRLLLYVIVVFAVLIAAILIVRAIT |
| Ga0210391_104251672 | 3300021433 | Soil | VLNPLRSEGEMFRLLVYVIVAFAVIIALILVLRAIF |
| Ga0210391_105369322 | 3300021433 | Soil | MLNPLRSEGDAFRVLLYVIAGFAVIIALIEIVRALS |
| Ga0210390_114952802 | 3300021474 | Soil | VLNPLRSEGEMFRLLLYVVVAFAVIIALILIVRAIF |
| Ga0208715_10113373 | 3300025482 | Arctic Peat Soil | VLNPLRSEGEAFKLLLYVLVVAAAVVALILILRAIL |
| Ga0208586_11015672 | 3300025588 | Arctic Peat Soil | MRNPLRSEGDMFRLLLYVIAVFGAIIAVIVIVRALR |
| Ga0208220_10693151 | 3300025627 | Arctic Peat Soil | MRNPLRSEGEMFRLLLYVIAVFGTIIAIIVIVRALR |
| Ga0209483_10725832 | 3300025862 | Arctic Peat Soil | LLNPLRSEGDAFRLLLYVIAVFGAIIAIILIARAL |
| Ga0207708_104545761 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VINPLRSEGEAFRFLLYVVAFFAAVILIVLLVRAL |
| Ga0209167_102871831 | 3300027867 | Surface Soil | MLNPLRGEGEAFRALLFVIAFFGTIIAIILIARALSCRFLAGSY |
| Ga0209380_106567702 | 3300027889 | Soil | MLNPLRSEGEAFRALLYVIAFFGTIIAIILIARALS |
| Ga0209415_100380327 | 3300027905 | Peatlands Soil | MLNPLRSETDAFRLLLYVIAFFGTIILIVVIARAL |
| Ga0209415_100981844 | 3300027905 | Peatlands Soil | MRNPLRSEGDMFRLLLYVIAVFGTIIAIIVIVRALR |
| Ga0209415_101229601 | 3300027905 | Peatlands Soil | MLNPLRSEGEAFRLLLYVIAFFGTIIAIILIARAV |
| Ga0209006_100485852 | 3300027908 | Forest Soil | VLNPLRSEGEAFRLLIYAIVFFAIVIALVLILRAVL |
| Ga0209698_100950851 | 3300027911 | Watersheds | MLNPLRSEGEAFRLLLYVIAFFGTIIAIVLIARAV |
| Ga0209698_106157362 | 3300027911 | Watersheds | MRNPLRSEGDMFRLLLWVIAVFAVIIAVVVIARAL |
| Ga0209526_104071942 | 3300028047 | Forest Soil | MRNPLRSEGDAFRFLLWVIAVFGTLIAIIVIVRAF |
| Ga0302151_100205073 | 3300028562 | Bog | MLNPLRSESDAFRLLLYVIAVFGTIIAIIVIARAL |
| Ga0302202_101069984 | 3300028762 | Bog | LMLNPLRSESDAFRLLLYVIAVFGTIIAIIVIARAL |
| Ga0265338_109018332 | 3300028800 | Rhizosphere | VLNPLRSEGEAFRLLLWVIVVFGLIIAVVLIARAV |
| Ga0311339_113713771 | 3300029999 | Palsa | MLNPLRSEADAFKFLLYVIAFFGTIIAIILIARYA |
| Ga0302196_101078102 | 3300030225 | Bog | MLNPLRSESDAFRLLLYVIAVFGTIIAIVLIVRAI |
| Ga0311349_106332031 | 3300030294 | Fen | MLNPLRSEGDAFRLLWYVVAVFAAIVAVGLLIRAFS |
| Ga0311372_127651352 | 3300030520 | Palsa | RVINPLRSEGAAFRFLLYVLAVFGAIIAIIVIVRAL |
| Ga0307502_100135063 | 3300031164 | Soil | MLNPLRSEGEAFRFLIYVAIFFGVLTAIVLIARTL |
| Ga0302325_100231585 | 3300031234 | Palsa | MINPLRSEGDAFRFLLYVIAVFGAIIAIIVIVRAL |
| Ga0272433_102947672 | 3300031450 | Rock | VLNPLRSEGEAFRLLLYVLVIAVVIGAIVLIVRAL |
| Ga0307374_102334944 | 3300031670 | Soil | MRNPLRSEGEMFRLLLYVIAVFGTIIAIIIIVRALR |
| Ga0310686_1029901332 | 3300031708 | Soil | MLNPLRSEGEAFRLLLYVIVFFGLIIAIVLIARAL |
| Ga0318493_106946042 | 3300031723 | Soil | MLNPLRSEGEAFRLLLYVAAVAGVVIAVVLIVRAVS |
| Ga0307479_107742102 | 3300031962 | Hardwood Forest Soil | VLNPLRSEREAFRFLLYVVAVFGAIIAIVLIVRAF |
| Ga0311301_102837715 | 3300032160 | Peatlands Soil | MLNPLRSEGEAFRLLLYVMVVFGTIIAVVLIARAL |
| Ga0335078_106012992 | 3300032805 | Soil | VLNPLRSEGDAFRVLLYVIAGFAVIIALIEILRAIL |
| Ga0335074_104099044 | 3300032895 | Soil | VLNPLRSEGDAFKFLLYVIAVFGFVIAIVLIARYA |
| Ga0335072_105383422 | 3300032898 | Soil | VLNPIRSEAEAFKALLYVVAVFAVIIAIILIARAL |
| Ga0335072_110090582 | 3300032898 | Soil | VFNPLRSEGDAFRLLLYVIAFFGVVIAIVVIVRAV |
| Ga0335083_101198253 | 3300032954 | Soil | VLNPLRSEGEAFRLLIYVLVVAVAVIVLVLALRAIF |
| Ga0335076_114349872 | 3300032955 | Soil | AVLNPLRSEGDAFRVLLYVVAVVGVLLIIGLILRAVL |
| Ga0334790_003778_5925_6032 | 3300033887 | Soil | MLNPLHSEGEAFRLLLYVIAVFGTIIAIVLIVRAL |
| Ga0334792_078359_268_375 | 3300033888 | Soil | MLNPLRSEGDAFRLLLYVIAVFGTIIAIILIARAL |
| ⦗Top⦘ |