| Basic Information | |
|---|---|
| Family ID | F083033 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.46 % |
| % of genes from short scaffolds (< 2000 bps) | 92.92 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.611 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (45.133 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.788 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.903 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 24.29% Coil/Unstructured: 75.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03972 | MmgE_PrpD | 38.94 |
| PF12146 | Hydrolase_4 | 2.65 |
| PF00496 | SBP_bac_5 | 1.77 |
| PF13487 | HD_5 | 0.88 |
| PF01343 | Peptidase_S49 | 0.88 |
| PF13007 | LZ_Tnp_IS66 | 0.88 |
| PF00296 | Bac_luciferase | 0.88 |
| PF00657 | Lipase_GDSL | 0.88 |
| PF09912 | DUF2141 | 0.88 |
| PF14579 | HHH_6 | 0.88 |
| PF00211 | Guanylate_cyc | 0.88 |
| PF13358 | DDE_3 | 0.88 |
| PF12681 | Glyoxalase_2 | 0.88 |
| PF02738 | MoCoBD_1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 38.94 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.77 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.61 % |
| Unclassified | root | N/A | 12.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100773898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300005172|Ga0066683_10677957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300005332|Ga0066388_106555876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 587 | Open in IMG/M |
| 3300005437|Ga0070710_10117640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
| 3300005437|Ga0070710_10234773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1172 | Open in IMG/M |
| 3300005439|Ga0070711_101562100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300005445|Ga0070708_101401303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300005552|Ga0066701_10526376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300005556|Ga0066707_10292640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300005569|Ga0066705_10401083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300005764|Ga0066903_106393237 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300006175|Ga0070712_101288788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300006175|Ga0070712_101912301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300006796|Ga0066665_10971799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300006806|Ga0079220_11763224 | Not Available | 544 | Open in IMG/M |
| 3300010048|Ga0126373_10182680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2019 | Open in IMG/M |
| 3300010048|Ga0126373_11908265 | Not Available | 657 | Open in IMG/M |
| 3300010343|Ga0074044_10140526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1618 | Open in IMG/M |
| 3300010359|Ga0126376_11813526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300010360|Ga0126372_12352133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300010376|Ga0126381_100393469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1928 | Open in IMG/M |
| 3300010398|Ga0126383_13367629 | Not Available | 522 | Open in IMG/M |
| 3300010398|Ga0126383_13448900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300012202|Ga0137363_10815339 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300012210|Ga0137378_10259654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1617 | Open in IMG/M |
| 3300012210|Ga0137378_11007188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300012210|Ga0137378_11706518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300012971|Ga0126369_10844506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300014497|Ga0182008_10715015 | Not Available | 574 | Open in IMG/M |
| 3300014497|Ga0182008_10991613 | Not Available | 500 | Open in IMG/M |
| 3300015245|Ga0137409_10537654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300016270|Ga0182036_10317492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1190 | Open in IMG/M |
| 3300016270|Ga0182036_11398882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300016294|Ga0182041_11843918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300016357|Ga0182032_10309420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1250 | Open in IMG/M |
| 3300016357|Ga0182032_11164398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300016387|Ga0182040_10348833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
| 3300016387|Ga0182040_10468423 | Not Available | 1001 | Open in IMG/M |
| 3300016422|Ga0182039_11885495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300020199|Ga0179592_10077577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1523 | Open in IMG/M |
| 3300021178|Ga0210408_11078755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300021401|Ga0210393_10767397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300021407|Ga0210383_11497992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300021432|Ga0210384_11126471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300021474|Ga0210390_11357716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300021478|Ga0210402_10488805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1143 | Open in IMG/M |
| 3300021560|Ga0126371_11532064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
| 3300022507|Ga0222729_1013139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300022525|Ga0242656_1013570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1132 | Open in IMG/M |
| 3300022531|Ga0242660_1092402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300022713|Ga0242677_1034663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300022726|Ga0242654_10203126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300025939|Ga0207665_10381684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1069 | Open in IMG/M |
| 3300026550|Ga0209474_10268058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1038 | Open in IMG/M |
| 3300026557|Ga0179587_10954801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300027698|Ga0209446_1095729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300027765|Ga0209073_10253375 | Not Available | 685 | Open in IMG/M |
| 3300027903|Ga0209488_10032177 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
| 3300028047|Ga0209526_10448448 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300031469|Ga0170819_10815268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300031545|Ga0318541_10660730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300031549|Ga0318571_10264289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300031564|Ga0318573_10014061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3469 | Open in IMG/M |
| 3300031668|Ga0318542_10603872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300031724|Ga0318500_10575725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300031740|Ga0307468_101326829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300031744|Ga0306918_10197931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1513 | Open in IMG/M |
| 3300031748|Ga0318492_10118361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1315 | Open in IMG/M |
| 3300031764|Ga0318535_10036770 | Not Available | 1991 | Open in IMG/M |
| 3300031770|Ga0318521_10353962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 870 | Open in IMG/M |
| 3300031771|Ga0318546_10475376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300031777|Ga0318543_10297885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300031792|Ga0318529_10101020 | Not Available | 1301 | Open in IMG/M |
| 3300031794|Ga0318503_10033039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1525 | Open in IMG/M |
| 3300031795|Ga0318557_10115595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1197 | Open in IMG/M |
| 3300031795|Ga0318557_10358375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300031796|Ga0318576_10491732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300031798|Ga0318523_10314226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300031819|Ga0318568_10685477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300031823|Ga0307478_10124421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2025 | Open in IMG/M |
| 3300031831|Ga0318564_10361340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300031833|Ga0310917_11005294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300031835|Ga0318517_10158756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1013 | Open in IMG/M |
| 3300031835|Ga0318517_10519130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031859|Ga0318527_10036493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1860 | Open in IMG/M |
| 3300031893|Ga0318536_10446704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300031896|Ga0318551_10415165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300031897|Ga0318520_10970390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031910|Ga0306923_10336113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1723 | Open in IMG/M |
| 3300031941|Ga0310912_11031821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300031942|Ga0310916_11518114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031945|Ga0310913_10701150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300031946|Ga0310910_10637194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300031947|Ga0310909_10189518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1705 | Open in IMG/M |
| 3300031981|Ga0318531_10039609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1967 | Open in IMG/M |
| 3300032001|Ga0306922_10242046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1938 | Open in IMG/M |
| 3300032001|Ga0306922_10585795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1183 | Open in IMG/M |
| 3300032001|Ga0306922_11074421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300032025|Ga0318507_10036504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1868 | Open in IMG/M |
| 3300032025|Ga0318507_10493307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300032035|Ga0310911_10301643 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300032035|Ga0310911_10326717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300032051|Ga0318532_10205427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300032065|Ga0318513_10125661 | Not Available | 1213 | Open in IMG/M |
| 3300032065|Ga0318513_10583099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300032094|Ga0318540_10309603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300032261|Ga0306920_100128679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3768 | Open in IMG/M |
| 3300032261|Ga0306920_101222408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1084 | Open in IMG/M |
| 3300032515|Ga0348332_11798773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300032893|Ga0335069_11914567 | Not Available | 627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 45.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.77% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_07508660 | 2170459010 | Grass Soil | EINLNDADFVLGIDFLGSQRVWISYGSQQLFLMRRI |
| Ga0062386_1007738981 | 3300004152 | Bog Forest Soil | PALIVADVSLRDADLILGVDFLSSRRIWLSYGSQQIFLSRRT* |
| Ga0066683_106779572 | 3300005172 | Soil | RNPEIIIADLKLSDADLVLCIDIVRQRRIWLSYGAQKIFLLRRT* |
| Ga0066388_1065558762 | 3300005332 | Tropical Forest Soil | IRNPQLIVTDIRLNDADVVLGIDLLKSQRVWMSYGSQQIFLMRR* |
| Ga0070710_101176402 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IRDPEIGVTDLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRVG* |
| Ga0070710_102347735 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IRDPEIGVTDLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRS* |
| Ga0070711_1015621003 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EVIRDPEIGVTDLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRS* |
| Ga0070708_1014013031 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IVTDVKLSDADLVLGIDFLNSRRIWLSYGSQQIFLLRRT* |
| Ga0066701_105263761 | 3300005552 | Soil | GGEVIRNPEIIIADLKLGDADLVLGIDIVRPWRIWLSYGAQKIFVLRRT* |
| Ga0066707_102926401 | 3300005556 | Soil | RNPEIIIADLKLSDADLVLGIDVVRPWRIWLSYGAQKIFVLRRT* |
| Ga0066705_104010831 | 3300005569 | Soil | NPTLIVADVSLKDADLILGIDFLSSRRIWLSYGSQQIFLSRRT* |
| Ga0066903_1063932372 | 3300005764 | Tropical Forest Soil | DIFIRNPEIDVADIRLSEADLVLGIDFLSSRRIWMSYGSQQIFLWGRT* |
| Ga0070766_101290471 | 3300005921 | Soil | EINLNDADFVLGIDFLGSQRVWISYGSQQLFLMRRI* |
| Ga0070712_1012887881 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VADVSLKDADLILGIDFLGSRRIWLSYGSQQIFLLRPT* |
| Ga0070712_1019123012 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRS* |
| Ga0066665_109717991 | 3300006796 | Soil | VVRNPELIVTDFKLNDADLLIWIDILSSRRIWLSYGSQQIFLSHRV* |
| Ga0079220_117632241 | 3300006806 | Agricultural Soil | LRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRN* |
| Ga0126373_101826801 | 3300010048 | Tropical Forest Soil | PQVVRNPELIVTDIRLNDADIVLGIDFLRSQRIWMSYGSEQIFLMRR* |
| Ga0126373_119082651 | 3300010048 | Tropical Forest Soil | VVRNPEIIVTDVRLNDADLVLGIDLMRSQRVWLSYGSRQIFLMRR* |
| Ga0074044_101405263 | 3300010343 | Bog Forest Soil | VTDVRLSDADLVLGIDFLKSRRIWLSYGSQQIFLLRRT* |
| Ga0126376_118135262 | 3300010359 | Tropical Forest Soil | VADVSIKDADLVLGFDFLSARRLWLSYGSQQIFLTRRG* |
| Ga0126372_123521331 | 3300010360 | Tropical Forest Soil | TIRNPEIIVTDVTLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRT* |
| Ga0126381_1003934693 | 3300010376 | Tropical Forest Soil | GGDIFIRNPEIDVADIRLSEADLVLGIDFLSSRRIWMSYGSQQIFLWGRT* |
| Ga0126383_133676291 | 3300010398 | Tropical Forest Soil | QLQIGPEVIRNPQLIVTDIRLNDADVVLGIDLLKSQRVWMSYGSQQIFLMRR* |
| Ga0126383_134489001 | 3300010398 | Tropical Forest Soil | GAETIRNPEIIVTDVTLSDADLVLGIDFLKPRRIWFSYGSQQIFIMRRT* |
| Ga0137363_108153392 | 3300012202 | Vadose Zone Soil | LRNPEIVVADVKLGDADLVLGIDFLISRRIWLSYGSEQIFLSRRG* |
| Ga0137378_102596541 | 3300012210 | Vadose Zone Soil | EILRNPEIVVADVKLGDADLVLGIDFLISRRIWLSYGSERIFLSRRT* |
| Ga0137378_110071882 | 3300012210 | Vadose Zone Soil | TLRDADLVLGVDFVRSRRIWFSYRSRQIFLRRATR* |
| Ga0137378_117065181 | 3300012210 | Vadose Zone Soil | DFKLNDADLLIGIDILSSRRIWLSYGSQQIFLSHRV* |
| Ga0126369_108445062 | 3300012971 | Tropical Forest Soil | IVTDIRLNDADIVLGIDFLRSQRIWMSYGSQQIFLARR* |
| Ga0182008_107150152 | 3300014497 | Rhizosphere | VTNLRLQDADVVLGVDFLRSRRVWLSYGSHQIFLAHPA* |
| Ga0182008_109916131 | 3300014497 | Rhizosphere | VTGNPEIGVTDLRLSDADLVLGVDFLRSRRVWMSYGSQLIFLSRRI* |
| Ga0137409_105376541 | 3300015245 | Vadose Zone Soil | RVHPVGEAIRNPEIIVADLNLSDADLVLGIDIVRPWRIWLSYGVQKIFLLRRT* |
| Ga0182036_103174923 | 3300016270 | Soil | VTDVMLSDADLVLGIDFLKSRRLWLSYGSQQLFLSRRT |
| Ga0182036_113988821 | 3300016270 | Soil | NPEIIVTDVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0182041_118439181 | 3300016294 | Soil | LIIADVSLKDADLVLGIDFLGSRRVWLSYGSQQIFLARRT |
| Ga0182032_103094203 | 3300016357 | Soil | EIVVTDVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0182032_111643981 | 3300016357 | Soil | DVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA |
| Ga0182040_103488331 | 3300016387 | Soil | ELIVADVSLKDADLILGIDFLSSRRLWLSYGAQQIFLSRRS |
| Ga0182040_104684232 | 3300016387 | Soil | GTVAIRSPEMIVTELRLSDADLVLGIDFLRSRRIWLSYGSGQIFLLHST |
| Ga0182039_118854951 | 3300016422 | Soil | IIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0179592_100775771 | 3300020199 | Vadose Zone Soil | IIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT |
| Ga0210401_112603921 | 3300020583 | Soil | TEINLNDADFVLGIDFLGSQRVWISYGSQQLFLMRRI |
| Ga0210408_110787551 | 3300021178 | Soil | VKLGDADLVLGIDFLISRRIWLSYGSVQIFLSRRG |
| Ga0210393_107673971 | 3300021401 | Soil | NPEIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT |
| Ga0210383_114979921 | 3300021407 | Soil | EVIRDPEIGVTDLRLSDANLVLGVDFLQSRRVWMSYGSQQIFLSRRS |
| Ga0210384_111264713 | 3300021432 | Soil | EIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT |
| Ga0210390_113577161 | 3300021474 | Soil | ADVSLRDADLVLGIDFLASRRIWLSYGSQQIFLSRRT |
| Ga0210402_104888051 | 3300021478 | Soil | DLKLSDADLVLGIDFLRPRRVWLSYGSQQLFLLRRI |
| Ga0126371_115320641 | 3300021560 | Tropical Forest Soil | EVGGEVVHNPELIVADVSLKDADLVLGIDFLSARRLWLSYGSQQIFLTRRG |
| Ga0222729_10131391 | 3300022507 | Soil | IGGEAMRNPEIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT |
| Ga0242656_10135701 | 3300022525 | Soil | LNLSDADLVLGIDMVRSWRIWLSYGAQKIFLLRRT |
| Ga0242660_10924022 | 3300022531 | Soil | ADVSLKDADLVLGIDFLGSRRIWLSYGSQQIFLSRRT |
| Ga0242677_10346631 | 3300022713 | Soil | DVSLRDAELFLGIDFLGSRRIWLSYGSQQIFLSRRT |
| Ga0242654_102031261 | 3300022726 | Soil | IRNPEIIVAGLNLSDADLVVGIDIVRSWRIWVSYGAQKIFLLRRT |
| Ga0207665_103816844 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ADVSLKDADLILGIDFLGSRRIWLSYGSQQIFLSRPT |
| Ga0209474_102680581 | 3300026550 | Soil | GEVVRNPALIVADVSLKDGDLVLGIDFIAARRIWLSYGSQQIFLSRRT |
| Ga0179587_109548011 | 3300026557 | Vadose Zone Soil | IIVADLNLSDADLVLGIDIVRPWRIWLSYGVQKIFLLRRT |
| Ga0209446_10957291 | 3300027698 | Bog Forest Soil | VADVSLRDADLVLGIDFLGSRRIWLSYGSQQIFLSRRT |
| Ga0209073_102533751 | 3300027765 | Agricultural Soil | LRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRN |
| Ga0209488_100321771 | 3300027903 | Vadose Zone Soil | PEIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT |
| Ga0209526_104484481 | 3300028047 | Forest Soil | ADVKLSDADLVLGIDFLISRRIWLSYGSAQIFLSRRG |
| Ga0170819_108152682 | 3300031469 | Forest Soil | VADLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRI |
| Ga0318541_106607301 | 3300031545 | Soil | PDFIVADVKLSDADLVLGIDFLGSRRVWWSYGSQKIFLSRRN |
| Ga0318571_102642891 | 3300031549 | Soil | VMLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRPT |
| Ga0318573_100140611 | 3300031564 | Soil | VTDVTLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRT |
| Ga0318542_106038722 | 3300031668 | Soil | VTDIRLNDADIVLGIDFLGSQRIWMSYGSQQIFLMRR |
| Ga0318500_105757251 | 3300031724 | Soil | NPEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0307468_1013268292 | 3300031740 | Hardwood Forest Soil | GEAIHNSEIIVADLNLSDADLVLGIDILRSWRIWLSYGAQKVFLLRRN |
| Ga0306918_101979312 | 3300031744 | Soil | AETIRDPEIIVTDVTLNDADLVMGIDFLRPRRIWLSYGSQQIFIMHRA |
| Ga0318492_101183611 | 3300031748 | Soil | VRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0318535_100367701 | 3300031764 | Soil | IIRTPELIVTDIRLNDADIVLGIDFLRSQRMWMSYGSQQIFLMRR |
| Ga0318521_103539621 | 3300031770 | Soil | IVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0318546_104753763 | 3300031771 | Soil | IMTDLRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0318543_102978851 | 3300031777 | Soil | IIVNDLRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0318529_101010202 | 3300031792 | Soil | TPELIVTNIRLNDADIVLGIDFLRSQRMWMSYGSQQIFLMRR |
| Ga0318503_100330393 | 3300031794 | Soil | PEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0318557_101155951 | 3300031795 | Soil | IVTDVRLSDADLVLGIDFLRPRRIWLSYGSQQIFIMRRV |
| Ga0318557_103583753 | 3300031795 | Soil | VTDVMLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0318576_104917321 | 3300031796 | Soil | VTDVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0318523_103142263 | 3300031798 | Soil | VRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA |
| Ga0318568_106854771 | 3300031819 | Soil | VVRNPELIVADVSLKDADLILGIDFLSSRRLWLSYGAQQIFLSRRS |
| Ga0307478_101244213 | 3300031823 | Hardwood Forest Soil | NPDIIVTDVRLSDADLVLGIDFLRPRRIWLSYGSQQIFIMRRA |
| Ga0318564_103613403 | 3300031831 | Soil | TDVRLSDADLVLGIDFLRPRRVWLSYGSQQIFIMRRA |
| Ga0310917_110052942 | 3300031833 | Soil | TIRNPEIVVTDVRLSDADLVLGVDFLRSRRIWLSYGSQQIFIKH |
| Ga0318517_101587561 | 3300031835 | Soil | PELIVADVSLKDADLILGIDFLSSRRLWLSYGAQQIFLSRRS |
| Ga0318517_105191301 | 3300031835 | Soil | GTEVLRNPEIIVTDLRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0318527_100364931 | 3300031859 | Soil | RNPEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0318536_104467043 | 3300031893 | Soil | VTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA |
| Ga0318551_104151653 | 3300031896 | Soil | PELIVADVSLKDADLVLGVDFLASRRIWLSYGSQQIFLSRRT |
| Ga0318520_109703901 | 3300031897 | Soil | IIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA |
| Ga0306923_103361133 | 3300031910 | Soil | VTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0310912_110318211 | 3300031941 | Soil | PEIIVTDVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0310916_115181141 | 3300031942 | Soil | IRNPEIVVTDVRLSDADLVLGVDFLRSRRIWLSYGSQQIFIKH |
| Ga0310913_107011503 | 3300031945 | Soil | ADVKLSDADLVLGIDFLGSRRVWWSYGSQKIFLSRRN |
| Ga0310910_106371941 | 3300031946 | Soil | PEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA |
| Ga0310909_101895183 | 3300031947 | Soil | IRNPEIIVTDVMLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRPT |
| Ga0318531_100396091 | 3300031981 | Soil | VRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0306922_102420461 | 3300032001 | Soil | RMEVGGEVVRNPELIVADVSLKDADLILGIDFLSSRRLWLSYGAQQIFLSRRS |
| Ga0306922_105857951 | 3300032001 | Soil | DVTLNDADLVIGIDFLRPRRIWLSYGSQQIFIMRRA |
| Ga0306922_110744213 | 3300032001 | Soil | NPEIVVTDVMLSDADLVLGIDFLKSRRLWLSYGSQQLFLSRRT |
| Ga0318507_100365043 | 3300032025 | Soil | IRNPEIIVTDVGLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0318507_104933072 | 3300032025 | Soil | IVTDLRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS |
| Ga0310911_103016431 | 3300032035 | Soil | VGTEVLRNPEIIVTDVRLSDADLVLGIDFLRARRIWFSYGSRQVFIMRRA |
| Ga0310911_103267173 | 3300032035 | Soil | TETIRNPEIIVTDVRLSDADLVLGIDFLRPRRIWLSYGSQQIFIMRRV |
| Ga0318532_102054273 | 3300032051 | Soil | IRDPEIIVTDVTLNDADLVMGIDFLRPRRIWLSYGSQQIFIMHRA |
| Ga0318513_101256612 | 3300032065 | Soil | PELIVTNIRLNDADIVLGIDFLRSQRMWMSYGSQQIFLMRR |
| Ga0318513_105830992 | 3300032065 | Soil | TDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0318540_103096033 | 3300032094 | Soil | GAETIRDPEIIVTDVTLNDADLVMGIDFLRPRRIWLSYGSQQIFIMHRA |
| Ga0306920_1001286791 | 3300032261 | Soil | FIVADVKLSDADLVLGIDFLGSRRVWWSYGSQKIFLSRRS |
| Ga0306920_1012224081 | 3300032261 | Soil | IRNPEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA |
| Ga0348332_117987733 | 3300032515 | Plant Litter | VRLSDADLVLGIDFLRPRRIWLSYGSQQIFIMHRA |
| Ga0335069_119145672 | 3300032893 | Soil | EVGSVTVRDPEVVVADIQLRDADIVLGADFLSARRIWLSYASFQIFLSER |
| ⦗Top⦘ |