NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083023

Metagenome / Metatranscriptome Family F083023

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083023
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 40 residues
Representative Sequence PAPVRAALAALGLSETLKVTYGRSPRLAAMLRTPRGIVTL
Number of Associated Samples 107
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.91 %
% of genes near scaffold ends (potentially truncated) 95.58 %
% of genes from short scaffolds (< 2000 bps) 93.81 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.646 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.850 % of family members)
Environment Ontology (ENVO) Unclassified
(34.513 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.363 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 13.24%    β-sheet: 11.76%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF14031D-ser_dehydrat 47.79
PF07883Cupin_2 7.08
PF05118Asp_Arg_Hydrox 4.42
PF03795YCII 3.54
PF04392ABC_sub_bind 2.65
PF08281Sigma70_r4_2 1.77
PF03640Lipoprotein_15 1.77
PF06629MipA 0.88
PF14342DUF4396 0.88
PF13489Methyltransf_23 0.88
PF00475IGPD 0.88
PF11845DUF3365 0.88
PF01520Amidase_3 0.88
PF03631Virul_fac_BrkB 0.88
PF13458Peripla_BP_6 0.88
PF07805Obsolete Pfam Family 0.88
PF02746MR_MLE_N 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG3555Aspartyl/asparaginyl beta-hydroxylase, cupin superfamilyPosttranslational modification, protein turnover, chaperones [O] 4.42
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 3.54
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.65
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 1.77
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.77
COG0131Imidazoleglycerol phosphate dehydratase HisBAmino acid transport and metabolism [E] 0.88
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 0.88
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.88
COG3713Outer membrane scaffolding protein for murein synthesis, MipA/OmpV familyCell wall/membrane/envelope biogenesis [M] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.65 %
UnclassifiedrootN/A20.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY01DGJU7All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria501Open in IMG/M
3300000559|F14TC_104336757Not Available660Open in IMG/M
3300001213|JGIcombinedJ13530_101715908All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300001664|P5cmW16_1004289All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2649Open in IMG/M
3300001991|JGI24743J22301_10003924All Organisms → cellular organisms → Bacteria → Proteobacteria2385Open in IMG/M
3300004479|Ga0062595_102601245All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005172|Ga0066683_10917334Not Available501Open in IMG/M
3300005177|Ga0066690_10920817Not Available556Open in IMG/M
3300005340|Ga0070689_101014951All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300005347|Ga0070668_101390129All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium640Open in IMG/M
3300005364|Ga0070673_101711788Not Available595Open in IMG/M
3300005367|Ga0070667_101365141All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae664Open in IMG/M
3300005450|Ga0066682_10455156All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria813Open in IMG/M
3300005546|Ga0070696_100020705All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae4457Open in IMG/M
3300005561|Ga0066699_10522172Not Available850Open in IMG/M
3300005563|Ga0068855_100740411All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300005618|Ga0068864_102259464All Organisms → cellular organisms → Bacteria → Proteobacteria550Open in IMG/M
3300005718|Ga0068866_11290949All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300005764|Ga0066903_106445607All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria612Open in IMG/M
3300005834|Ga0068851_10409329All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300005842|Ga0068858_101452477All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium676Open in IMG/M
3300005889|Ga0075290_1069472All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006031|Ga0066651_10182400All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300006032|Ga0066696_10372164All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300006034|Ga0066656_11028550All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria529Open in IMG/M
3300006175|Ga0070712_101547951All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300006358|Ga0068871_101400449All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006844|Ga0075428_100543540All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300006854|Ga0075425_100932851All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300006930|Ga0079303_10427047All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria564Open in IMG/M
3300007076|Ga0075435_100769304All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300007076|Ga0075435_100858219All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium791Open in IMG/M
3300007076|Ga0075435_101361698All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300009111|Ga0115026_10070744All Organisms → cellular organisms → Bacteria → Proteobacteria2019Open in IMG/M
3300009137|Ga0066709_104194632All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010048|Ga0126373_10625348All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1131Open in IMG/M
3300010373|Ga0134128_12226820All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300010375|Ga0105239_11074977All Organisms → cellular organisms → Bacteria → Proteobacteria926Open in IMG/M
3300010396|Ga0134126_10468708All Organisms → cellular organisms → Bacteria → Proteobacteria1455Open in IMG/M
3300010396|Ga0134126_12044657All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300010397|Ga0134124_10845370All Organisms → cellular organisms → Bacteria → Proteobacteria918Open in IMG/M
3300010403|Ga0134123_10374391All Organisms → cellular organisms → Bacteria → Proteobacteria1295Open in IMG/M
3300010937|Ga0137776_1452914Not Available717Open in IMG/M
3300012200|Ga0137382_11014249Not Available595Open in IMG/M
3300012901|Ga0157288_10328553All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300012909|Ga0157290_10199268All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012951|Ga0164300_10119939All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300012957|Ga0164303_10723410All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300012971|Ga0126369_10269856All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1685Open in IMG/M
3300012984|Ga0164309_10505560All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300012986|Ga0164304_11383584Not Available577Open in IMG/M
3300013104|Ga0157370_11162157Not Available697Open in IMG/M
3300013503|Ga0120127_10047700All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300014324|Ga0075352_1238404Not Available555Open in IMG/M
3300014326|Ga0157380_10915160All Organisms → cellular organisms → Bacteria → Proteobacteria904Open in IMG/M
3300014497|Ga0182008_10462904All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300014968|Ga0157379_10336205All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300014969|Ga0157376_12025166All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300015201|Ga0173478_10544526All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300015372|Ga0132256_101486750All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300015373|Ga0132257_102113589All Organisms → cellular organisms → Bacteria → Proteobacteria728Open in IMG/M
3300017792|Ga0163161_10375984All Organisms → cellular organisms → Bacteria → Proteobacteria1134Open in IMG/M
3300017792|Ga0163161_11006923All Organisms → cellular organisms → Bacteria → Proteobacteria712Open in IMG/M
3300017927|Ga0187824_10276737Not Available589Open in IMG/M
3300018476|Ga0190274_10604307All Organisms → cellular organisms → Bacteria → Proteobacteria1124Open in IMG/M
3300018476|Ga0190274_13122879Not Available557Open in IMG/M
3300021344|Ga0193719_10423868All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus stipitatus545Open in IMG/M
3300021602|Ga0194060_10072715All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1942Open in IMG/M
3300022213|Ga0224500_10060004All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1501Open in IMG/M
3300024055|Ga0247794_10276123All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300025903|Ga0207680_10777666Not Available686Open in IMG/M
3300025911|Ga0207654_10760150All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300025912|Ga0207707_10915234All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300025916|Ga0207663_10363800All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300025917|Ga0207660_11446602Not Available556Open in IMG/M
3300025921|Ga0207652_10275020All Organisms → cellular organisms → Bacteria → Proteobacteria1519Open in IMG/M
3300025926|Ga0207659_10749869All Organisms → cellular organisms → Bacteria → Proteobacteria837Open in IMG/M
3300025941|Ga0207711_11141963All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300025944|Ga0207661_10414843All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300025960|Ga0207651_11882247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus stipitatus538Open in IMG/M
3300025981|Ga0207640_10425323Not Available1088Open in IMG/M
3300025981|Ga0207640_11204843All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
3300026035|Ga0207703_11264423All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300026041|Ga0207639_10943221All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300026089|Ga0207648_10635262Not Available986Open in IMG/M
3300026118|Ga0207675_101315694All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium743Open in IMG/M
3300026281|Ga0209863_10067078All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1061Open in IMG/M
3300026547|Ga0209156_10090916All Organisms → cellular organisms → Bacteria → Proteobacteria1531Open in IMG/M
3300027715|Ga0208665_10244588Not Available564Open in IMG/M
3300027775|Ga0209177_10229359All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300027897|Ga0209254_10296416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-41240Open in IMG/M
3300027902|Ga0209048_10166916All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum1628Open in IMG/M
3300028381|Ga0268264_11099726All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300031834|Ga0315290_11624299All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria521Open in IMG/M
3300031854|Ga0310904_10264508Not Available1072Open in IMG/M
3300031859|Ga0318527_10331179All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria649Open in IMG/M
3300031873|Ga0315297_10483416All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300031890|Ga0306925_11401705All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria689Open in IMG/M
3300031918|Ga0311367_10815282Not Available943Open in IMG/M
3300031996|Ga0308176_11267003All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300031997|Ga0315278_11128461All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300032275|Ga0315270_10225289All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300032342|Ga0315286_12210441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium506Open in IMG/M
3300032516|Ga0315273_12622344All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria577Open in IMG/M
3300032782|Ga0335082_10341762All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300033413|Ga0316603_10159861All Organisms → cellular organisms → Bacteria1876Open in IMG/M
3300033418|Ga0316625_101454949All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria645Open in IMG/M
3300033480|Ga0316620_12150041All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300033482|Ga0316627_101627789Not Available658Open in IMG/M
3300034176|Ga0364931_0026538All Organisms → cellular organisms → Bacteria1669Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.08%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.42%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.65%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.77%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.77%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.77%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.89%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.89%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.89%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027715Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_010026802170459010Grass SoilREPAEIRAALHALGLDGAVPVSYARETRFAAMLRTPRGLVTLSSDR
F14TC_10433675723300000559SoilAALAALGLSDVLKVTYGRYPRLAAMIRTPRGVVTL*
JGIcombinedJ13530_10171590813300001213WetlandGALAALELGTVLPVTYDRDARLAAMLRTPRGIVTL*
P5cmW16_100428913300001664PermafrostALAALALSETLKVTFDAAPRLAAMLTTRRGSVTL*
JGI24743J22301_1000392413300001991Corn, Switchgrass And Miscanthus RhizosphereEHPEPAPVREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI*
Ga0062595_10260124523300004479SoilPEPALIRAALASLGPDLDLPVTYDRDARLAAMLRTPRGIVTL*
Ga0066683_1091733423300005172SoilGAHPEPASIRAPLAALGLTGTLPVTYNKTPRLAAMLRTPRGVVTL*
Ga0066690_1092081713300005177SoilHPDPAPIRAALVALGLTDTLKVTYAQYARLAAMLRMPRGIVTL*
Ga0070689_10101495113300005340Switchgrass RhizosphereASHPEPALIRAALASLGPDLDLPVTYDRDARLAAMLRTPRGIVTL*
Ga0070668_10139012923300005347Switchgrass RhizosphereAPIRAALAALDLSDTLKVTYGRYPRLAAMIRTRRGIVAL*
Ga0070673_10171178813300005364Switchgrass RhizospherePDAVRKEIAALCLADTLKVTYAKSPRLAAMIRTPRGVATL*
Ga0070667_10136514123300005367Switchgrass RhizosphereAHPEPASMRAVLGALGLSETLKVTFDAAARLAAMLSTRRGTVTL*
Ga0066682_1045515613300005450SoilPDERIELTALAATHPAPAPIRATLAKLGLSETLKVSYDARPRLAAMFSTPRGPVTL*
Ga0070696_10002070563300005546Corn, Switchgrass And Miscanthus RhizospherePAPVRAALAALGLSETLKVTYGRSPRLAAMLRTPRGIVTL*
Ga0066699_1052217213300005561SoilAPIRAALAALGLADTLKVTYAQYARLAAMLRTPRGIVTL*
Ga0068855_10074041113300005563Corn RhizosphereRALSALGLSEALKVTYGGVPRLAAMLRTPRGTVTI*
Ga0068864_10225946423300005618Switchgrass RhizosphereTHPEPAPIRAALTSLRLNDAIQVTYDRDTRLAAMLRTPRGVVTL*
Ga0068866_1129094913300005718Miscanthus RhizosphereASHPEPETIRASLKALGLGETLHVTYDSSPRLAAMLRTPRGLVTL*
Ga0066903_10644560723300005764Tropical Forest SoilPVRAALAALGLSEVLKVSYNATARLAAMIATPRGPASL*
Ga0068851_1040932913300005834Corn RhizosphereEPAPIRAALKALGQDEVMHVTYDRDMRLGAMLQTPRGIVTL*
Ga0068858_10145247723300005842Switchgrass RhizosphereDPAPVRAALAALGLGDTLKVTYGRHPRLAAMIRTPRGVVTL*
Ga0075290_106947213300005889Rice Paddy SoilEHPEPAPVRDALAALGLSETLKVTYGRTPRLAAMLRTPRGTVTL*
Ga0066651_1018240013300006031SoilVRAALAALGLADIVPVTYDRETRLAAMLQTPRGLVTL*
Ga0066696_1037216413300006032SoilAIASLGLSETLKVTYGRHPRLAAMLRTPRGIVTL*
Ga0066656_1102855013300006034SoilTHPAPAPIRATLAKLGLSETLKVSYDARPRLAAMFSTPRGPVTL*
Ga0070712_10154795113300006175Corn, Switchgrass And Miscanthus RhizosphereAALAALGLSETLKVTYGRSPRLAAMLRTPRGIVTI*
Ga0068871_10140044913300006358Miscanthus RhizosphereDALAGLGLSETLKVTYGRTPRLAAMLRTPRGVVTL*
Ga0074054_1135306313300006579SoilATLAAAHPDPDRMRRVLTALGLGATLPITFAAKIRLAAMLRTPRGTVTL*
Ga0075428_10054354033300006844Populus RhizosphereHPEPASIRAALASLGQEGVLPVTYDRDARLAAMLRTPRGLVTF*
Ga0075425_10093285123300006854Populus RhizosphereHPDPAFVRAALADLGLADVLKVTFDRDARLAAMLRTPRGLATL*
Ga0079303_1042704723300006930Deep SubsurfaceDPAAVRAALDALGLAATIHVTYDRETRLAAMLRTSRGTVTLSS*
Ga0075435_10076930413300007076Populus RhizosphereREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI*
Ga0075435_10085821933300007076Populus RhizosphereALAALGLSDTLKVTFGRYPRLAAMIRTPRGLVTL*
Ga0075435_10136169813300007076Populus RhizosphereRATLADLGLADVLKVTFDRDARLAAMLRTPRGLATL*
Ga0115026_1007074433300009111WetlandLKALGLGDALSVTYDRETRLAAMLQTPRGIVTLSS*
Ga0066709_10419463213300009137Grasslands SoilPDVVRAAIVALDLSSTIKTSYAPTPRLAAMIRTPRGTVTL*
Ga0126373_1062534833300010048Tropical Forest SoilIRAALAALGLSDVLRVSYDRAPRLAAMLSTPRGPITV*
Ga0134128_1222682013300010373Terrestrial SoilAQVRAALAALSLSETLKVTYGRSPRLAAMLRTPRGVVTL*
Ga0105239_1107497733300010375Corn RhizosphereALAALGLAGVLPVTYDPYARLAAMLRTPRGIVTL*
Ga0134126_1046870833300010396Terrestrial SoilRNALARLGLGDDVKVTYGQSPRLAAMIRTSRGIVTI*
Ga0134126_1204465723300010396Terrestrial SoilALAALGLGECLKVTYGRTPRLAAMLRTPRGVVTL*
Ga0134124_1084537033300010397Terrestrial SoilAIRAALAALGLDGVLPVTYDRDARLAVMLRTPRGIVTL*
Ga0134123_1037439133300010403Terrestrial SoilAALASLGQDSALPVTYDRDVRLAAMLRTPRGIVTL*
Ga0137776_145291423300010937SedimentALAALGLGDDVKVTFSATPRLVAMLNTRRGAVTL*
Ga0137382_1101424913300012200Vadose Zone SoilPAPIRAGLAALGLSETLKVTYERHARLAAMLRTPRGLVTL*
Ga0157288_1032855323300012901SoilASHPEPALIRAALASLGQDSALPVTYDRDVRLAAMLRTPRGIVTL*
Ga0157290_1019926813300012909SoilEPAPVREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI*
Ga0164300_1011993923300012951SoilAPVREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI*
Ga0164303_1072341013300012957SoilHPEPGSMRAVLAALDLSETLKVTFDAAPRLAAMLSTRRGTVTL*
Ga0126369_1026985613300012971Tropical Forest SoilALAALGLSDVLRVSYDRAPRVAAMLSTPRGPITL*
Ga0164309_1050556013300012984SoilLSAAHPEPRLKRAVPAALDLSETLKVTFDAAPRLAAMLSTRRGTVTL*
Ga0164304_1138358423300012986SoilAAAHPEPGSMRAVLAALGLSETLKVTFDAAPRLAAMLATRRGTVTL*
Ga0157370_1116215723300013104Corn RhizosphereAAIARLGLADDVKVTYGQSPRLAAMVRTPRGIVTF*
Ga0120127_1004770023300013503PermafrostVTLALGLGDTLKVTFNAAPRLAAMLSTKRGTVTL*
Ga0075352_123840423300014324Natural And Restored WetlandsLIRSALAALGLEHALPTTYDRDARLAAMLRTPRGIVTL*
Ga0157380_1091516033300014326Switchgrass RhizosphereAASHPEPAPIRAALSSLGLNDVIQVTYDRDTRLAAMLRTPRGVVTL*
Ga0182008_1046290423300014497RhizosphereRAALAALALSDTLKVSYGRTPRLAAMLRTPRGTVTL*
Ga0157379_1033620533300014968Switchgrass RhizosphereSTPIRDALMRLGLTDTLKVTYGRTPRLAAMLRTPRGVITL*
Ga0157376_1202516623300014969Miscanthus RhizosphereGAVRADIAALGLSDFLKVTYAKSPRLAAMIRTPRGVATI*
Ga0173478_1054452613300015201SoilALIRAALASLGPDLDLPVTYDRDARLAAMLRTPRGIVTL*
Ga0137412_1055211423300015242Vadose Zone SoilPEPGRIRSALAALGLGETLQVTFAGKIRLAAMLHTPRGLVTL*
Ga0132256_10148675013300015372Arabidopsis RhizosphereHPEPAPVRAALAALSLSETLKVTYGQSPRLAAMLRSPRGTVTL*
Ga0132257_10211358913300015373Arabidopsis RhizosphereAAIRAALAALGLDGVLPVTYDRDARLAVMLRTPRGIVTL*
Ga0163161_1037598433300017792Switchgrass RhizosphereHPEPALIRAALASLGQDSALPVTYDRDVRLAAMLRTPRGIVTL
Ga0163161_1100692313300017792Switchgrass RhizosphereTHPEPAAVRAALASLKLPDQLTVTYDRQTRLAAMLRTPRGVLTL
Ga0187824_1027673713300017927Freshwater SedimentDALAALGLSDTLKVTYGRAPRLAAMLRTPRGIVTL
Ga0190274_1060430713300018476SoilDAVRAPLAALGLSEMLKVTYAKSPRLAAMIRTARGVATL
Ga0190274_1312287923300018476SoilEPGAMRAVLAALGLSETLKVTFDAAPRLAAMLSTRGGTVTL
Ga0193719_1042386813300021344SoilEEIRDALAALGLSGVLPVTYDPYARLAAMLRTPRGVVTL
Ga0194060_1007271543300021602Anoxic Zone FreshwaterTDPEPAPIRAALKALGLGDTLAVTYDRETRLAAMLSTPRGIVTLSS
Ga0224500_1006000413300022213SedimentIRAALAALGLDGALPVTYDREARLAAMLRTPRGIVTL
Ga0247794_1027612323300024055SoilPAPVREALAGLGLSDALKVTYGRTPRLAAMLRTPRGVVTI
Ga0207680_1077766623300025903Switchgrass RhizospherePAPVRSALAALGLSDMLKVTYGRHPRLAAMIRTPRGLVTL
Ga0207654_1076015023300025911Corn RhizosphereAAHPEPGSMRAVLAALDLSETLKVTFDAAPRLAAMLSTRRGTVTL
Ga0207707_1091523423300025912Corn RhizosphereAPVRAALAALGLSETLKVTYGRSPRLAAMLRTPRGIVTL
Ga0207663_1036380023300025916Corn, Switchgrass And Miscanthus RhizosphereSALAAAHPEPGSMRAALAALGLSETLKVTFDAAPRLAAMLTTRRGTVTL
Ga0207660_1144660223300025917Corn RhizosphereRTVLAALGLSETLKVTFDAAPRLAAMLTTRRGTVTL
Ga0207652_1027502033300025921Corn RhizosphereAHPEPGSMRAVLAALGLSETLKVTFDAAPRLAAMLNTRRGTVTL
Ga0207659_1074986913300025926Miscanthus RhizosphereASHPEPALIRAALASLGPDLDLPVTYDRDARLAAMLRTPRGIVTL
Ga0207711_1114196323300025941Switchgrass RhizosphereVRDALAGLGLSETLKVTYGRTPRLAAMLRTPRGVVTL
Ga0207661_1041484313300025944Corn RhizosphereLAAAHPEPGSMRAALAALGLSETLKVTFDAAPRLAAMLTTRRGTVTL
Ga0207651_1188224723300025960Switchgrass RhizosphereRSALAALGLAGALPVTYDPYARLAAMLRTPGGVVTI
Ga0207640_1042532313300025981Corn RhizospherePAPVRAAIARLGLADDVKVTYGQSPRLAAMVRTPRGIVTF
Ga0207640_1120484313300025981Corn RhizosphereRAALGSLGLSESLRVTYDRETRLAAMLRTPQGYATLTSS
Ga0207703_1126442323300026035Switchgrass RhizosphereIRGALAALGLAGVLPVTYDPYARLAAMLRTPRGIVTL
Ga0207639_1094322123300026041Corn RhizosphereHPEPAPVRAALAALSLSETLKVTYGQSPRLAAMLRSPRGTVTL
Ga0207648_1063526213300026089Miscanthus RhizospherePEPDAVRKEIAALGLADTLKVTYAKSPRLAAMIRTPRGVATL
Ga0207675_10131569433300026118Switchgrass RhizospherePVRAALAALGLGDTLKVTYGRHPRLAAMIRTPRGVVTL
Ga0209863_1006707823300026281Prmafrost SoilPAQMRAALAALGLSETLQVTFNATPRLAALVRTPQGTVAL
Ga0209156_1009091613300026547SoilRATLAKLGLSETLKVSYDARPRLAAMFSTPRGPVTL
Ga0208665_1024458813300027715Deep SubsurfaceDPAAVRAALDALGLAATIHVTYDRETRLAAMLRTSRGTVTLSS
Ga0209177_1022935923300027775Agricultural SoilLAAAHPEPGSMRAVLAALGLSETLKVTFDAAPRLAAMLTTRRGTVTL
Ga0209254_1029641613300027897Freshwater Lake SedimentLRAALAALGLEGTIAISYDRELRIAAMLRTPRGMVTL
Ga0209048_1016691613300027902Freshwater Lake SedimentDPREIRNALAALGVDAVLPVTYDRHARLAAMLRTPRGIVTL
Ga0268264_1109972623300028381Switchgrass RhizospherePEPAPAREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI
Ga0311364_1162229823300031521FenRISTLAAAHPEPDRMRAVLAALGLGATLPITFAAKIRLAAMLHTPRGTVTL
Ga0315290_1162429923300031834SedimentSDPAPVRAALAALGLDGTLAVTFDRETRLAAMLRTPRGIVTLSS
Ga0310904_1026450823300031854SoilVRKEIAALGLADTLKVTYAKSPRLAAMIRTPRGVATL
Ga0318527_1033117923300031859SoilTHPTPGPIRAALAALGLSDVLKVSYDRAPRLAAMLSTPRGPVTL
Ga0315297_1048341623300031873SedimentRGVLATLDLGDVLPVTYDREARFAAMLRTPRGIVTL
Ga0306925_1140170523300031890SoilSALAATHPTPGPIRAALAALGLSDVLKVSYDRAPRLAAMLSTPRGPVTL
Ga0311367_1081528213300031918FenAVRAELAALGLSDTLKVTYARSPRVAAMIRTPRGVATL
Ga0308176_1126700313300031996SoilPDPDAIRQALARMGLDGSMRVAFDRETRLAAMLRTPRGLVTLAS
Ga0315278_1112846123300031997SedimentAIRAALAALSLDGVLPVTYDREPRLAAMLRTPRGIVTL
Ga0315270_1022528923300032275SedimentPDPAEIRGALAVLGLDGILPTTYDREPRLAAMLRTPRGIVTL
Ga0315286_1221044113300032342SedimentPAAIRAALAALSLDGVLPVTYDREPRLAAMLRTPRGIVTL
Ga0315273_1262234413300032516SedimentHPDPTIIRKALQALGLEGALAVTYAREPRLAAMLRTPRGIVTLG
Ga0335082_1034176213300032782SoilLAKLDLEGAVRVSYDRETRLAAMLRTPRGVVTLST
Ga0316603_1015986133300033413SoilPDPAPVRAALAALGLGDVLKVTFATSPRLAAMLRTPRGLVTL
Ga0316625_10145494913300033418SoilPAPIRAALAALGLGETLAVTYDRETRVAAMLQTPRGIVTLSS
Ga0316620_1215004113300033480SoilSVRKALEALGLSEILKVSYGRSPRLAAMLRTPRGVATL
Ga0316627_10162778913300033482SoilDANPVRASLTRLGLADDIHVTYDRVTRLAALLRTPRGRVAL
Ga0364931_0026538_24_1463300034176SedimentMIRAALKALGLGDTLAVTYDRDTRLAAMLRTPRGPVTLSS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.