| Basic Information | |
|---|---|
| Family ID | F083023 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | PAPVRAALAALGLSETLKVTYGRSPRLAAMLRTPRGIVTL |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 95.58 % |
| % of genes from short scaffolds (< 2000 bps) | 93.81 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.646 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.850 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.513 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.363 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.24% β-sheet: 11.76% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF14031 | D-ser_dehydrat | 47.79 |
| PF07883 | Cupin_2 | 7.08 |
| PF05118 | Asp_Arg_Hydrox | 4.42 |
| PF03795 | YCII | 3.54 |
| PF04392 | ABC_sub_bind | 2.65 |
| PF08281 | Sigma70_r4_2 | 1.77 |
| PF03640 | Lipoprotein_15 | 1.77 |
| PF06629 | MipA | 0.88 |
| PF14342 | DUF4396 | 0.88 |
| PF13489 | Methyltransf_23 | 0.88 |
| PF00475 | IGPD | 0.88 |
| PF11845 | DUF3365 | 0.88 |
| PF01520 | Amidase_3 | 0.88 |
| PF03631 | Virul_fac_BrkB | 0.88 |
| PF13458 | Peripla_BP_6 | 0.88 |
| PF07805 | Obsolete Pfam Family | 0.88 |
| PF02746 | MR_MLE_N | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 4.42 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.54 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.65 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.77 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
| COG0131 | Imidazoleglycerol phosphate dehydratase HisB | Amino acid transport and metabolism [E] | 0.88 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.88 |
| COG3713 | Outer membrane scaffolding protein for murein synthesis, MipA/OmpV family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.65 % |
| Unclassified | root | N/A | 20.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01DGJU7 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
| 3300000559|F14TC_104336757 | Not Available | 660 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101715908 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300001664|P5cmW16_1004289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2649 | Open in IMG/M |
| 3300001991|JGI24743J22301_10003924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2385 | Open in IMG/M |
| 3300004479|Ga0062595_102601245 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005172|Ga0066683_10917334 | Not Available | 501 | Open in IMG/M |
| 3300005177|Ga0066690_10920817 | Not Available | 556 | Open in IMG/M |
| 3300005340|Ga0070689_101014951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300005347|Ga0070668_101390129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300005364|Ga0070673_101711788 | Not Available | 595 | Open in IMG/M |
| 3300005367|Ga0070667_101365141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 664 | Open in IMG/M |
| 3300005450|Ga0066682_10455156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 813 | Open in IMG/M |
| 3300005546|Ga0070696_100020705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 4457 | Open in IMG/M |
| 3300005561|Ga0066699_10522172 | Not Available | 850 | Open in IMG/M |
| 3300005563|Ga0068855_100740411 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005618|Ga0068864_102259464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300005718|Ga0068866_11290949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300005764|Ga0066903_106445607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 612 | Open in IMG/M |
| 3300005834|Ga0068851_10409329 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005842|Ga0068858_101452477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300005889|Ga0075290_1069472 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006031|Ga0066651_10182400 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300006032|Ga0066696_10372164 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300006034|Ga0066656_11028550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300006175|Ga0070712_101547951 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006358|Ga0068871_101400449 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006844|Ga0075428_100543540 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300006854|Ga0075425_100932851 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300006930|Ga0079303_10427047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 564 | Open in IMG/M |
| 3300007076|Ga0075435_100769304 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300007076|Ga0075435_100858219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300007076|Ga0075435_101361698 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009111|Ga0115026_10070744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2019 | Open in IMG/M |
| 3300009137|Ga0066709_104194632 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300010048|Ga0126373_10625348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1131 | Open in IMG/M |
| 3300010373|Ga0134128_12226820 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010375|Ga0105239_11074977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
| 3300010396|Ga0134126_10468708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300010396|Ga0134126_12044657 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300010397|Ga0134124_10845370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300010403|Ga0134123_10374391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1295 | Open in IMG/M |
| 3300010937|Ga0137776_1452914 | Not Available | 717 | Open in IMG/M |
| 3300012200|Ga0137382_11014249 | Not Available | 595 | Open in IMG/M |
| 3300012901|Ga0157288_10328553 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012909|Ga0157290_10199268 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012951|Ga0164300_10119939 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300012957|Ga0164303_10723410 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012971|Ga0126369_10269856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1685 | Open in IMG/M |
| 3300012984|Ga0164309_10505560 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300012986|Ga0164304_11383584 | Not Available | 577 | Open in IMG/M |
| 3300013104|Ga0157370_11162157 | Not Available | 697 | Open in IMG/M |
| 3300013503|Ga0120127_10047700 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300014324|Ga0075352_1238404 | Not Available | 555 | Open in IMG/M |
| 3300014326|Ga0157380_10915160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300014497|Ga0182008_10462904 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300014968|Ga0157379_10336205 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300014969|Ga0157376_12025166 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300015201|Ga0173478_10544526 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300015372|Ga0132256_101486750 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300015373|Ga0132257_102113589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300017792|Ga0163161_10375984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
| 3300017792|Ga0163161_11006923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
| 3300017927|Ga0187824_10276737 | Not Available | 589 | Open in IMG/M |
| 3300018476|Ga0190274_10604307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300018476|Ga0190274_13122879 | Not Available | 557 | Open in IMG/M |
| 3300021344|Ga0193719_10423868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus stipitatus | 545 | Open in IMG/M |
| 3300021602|Ga0194060_10072715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1942 | Open in IMG/M |
| 3300022213|Ga0224500_10060004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1501 | Open in IMG/M |
| 3300024055|Ga0247794_10276123 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300025903|Ga0207680_10777666 | Not Available | 686 | Open in IMG/M |
| 3300025911|Ga0207654_10760150 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300025912|Ga0207707_10915234 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300025916|Ga0207663_10363800 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300025917|Ga0207660_11446602 | Not Available | 556 | Open in IMG/M |
| 3300025921|Ga0207652_10275020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1519 | Open in IMG/M |
| 3300025926|Ga0207659_10749869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300025941|Ga0207711_11141963 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300025944|Ga0207661_10414843 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300025960|Ga0207651_11882247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus stipitatus | 538 | Open in IMG/M |
| 3300025981|Ga0207640_10425323 | Not Available | 1088 | Open in IMG/M |
| 3300025981|Ga0207640_11204843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300026035|Ga0207703_11264423 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300026041|Ga0207639_10943221 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300026089|Ga0207648_10635262 | Not Available | 986 | Open in IMG/M |
| 3300026118|Ga0207675_101315694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300026281|Ga0209863_10067078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1061 | Open in IMG/M |
| 3300026547|Ga0209156_10090916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1531 | Open in IMG/M |
| 3300027715|Ga0208665_10244588 | Not Available | 564 | Open in IMG/M |
| 3300027775|Ga0209177_10229359 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027897|Ga0209254_10296416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 1240 | Open in IMG/M |
| 3300027902|Ga0209048_10166916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum | 1628 | Open in IMG/M |
| 3300028381|Ga0268264_11099726 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031834|Ga0315290_11624299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
| 3300031854|Ga0310904_10264508 | Not Available | 1072 | Open in IMG/M |
| 3300031859|Ga0318527_10331179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 649 | Open in IMG/M |
| 3300031873|Ga0315297_10483416 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300031890|Ga0306925_11401705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 689 | Open in IMG/M |
| 3300031918|Ga0311367_10815282 | Not Available | 943 | Open in IMG/M |
| 3300031996|Ga0308176_11267003 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031997|Ga0315278_11128461 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300032275|Ga0315270_10225289 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300032342|Ga0315286_12210441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 506 | Open in IMG/M |
| 3300032516|Ga0315273_12622344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300032782|Ga0335082_10341762 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300033413|Ga0316603_10159861 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300033418|Ga0316625_101454949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 645 | Open in IMG/M |
| 3300033480|Ga0316620_12150041 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300033482|Ga0316627_101627789 | Not Available | 658 | Open in IMG/M |
| 3300034176|Ga0364931_0026538 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.77% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.77% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.89% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.89% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.89% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_01002680 | 2170459010 | Grass Soil | REPAEIRAALHALGLDGAVPVSYARETRFAAMLRTPRGLVTLSSDR |
| F14TC_1043367572 | 3300000559 | Soil | AALAALGLSDVLKVTYGRYPRLAAMIRTPRGVVTL* |
| JGIcombinedJ13530_1017159081 | 3300001213 | Wetland | GALAALELGTVLPVTYDRDARLAAMLRTPRGIVTL* |
| P5cmW16_10042891 | 3300001664 | Permafrost | ALAALALSETLKVTFDAAPRLAAMLTTRRGSVTL* |
| JGI24743J22301_100039241 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | EHPEPAPVREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI* |
| Ga0062595_1026012452 | 3300004479 | Soil | PEPALIRAALASLGPDLDLPVTYDRDARLAAMLRTPRGIVTL* |
| Ga0066683_109173342 | 3300005172 | Soil | GAHPEPASIRAPLAALGLTGTLPVTYNKTPRLAAMLRTPRGVVTL* |
| Ga0066690_109208171 | 3300005177 | Soil | HPDPAPIRAALVALGLTDTLKVTYAQYARLAAMLRMPRGIVTL* |
| Ga0070689_1010149511 | 3300005340 | Switchgrass Rhizosphere | ASHPEPALIRAALASLGPDLDLPVTYDRDARLAAMLRTPRGIVTL* |
| Ga0070668_1013901292 | 3300005347 | Switchgrass Rhizosphere | APIRAALAALDLSDTLKVTYGRYPRLAAMIRTRRGIVAL* |
| Ga0070673_1017117881 | 3300005364 | Switchgrass Rhizosphere | PDAVRKEIAALCLADTLKVTYAKSPRLAAMIRTPRGVATL* |
| Ga0070667_1013651412 | 3300005367 | Switchgrass Rhizosphere | AHPEPASMRAVLGALGLSETLKVTFDAAARLAAMLSTRRGTVTL* |
| Ga0066682_104551561 | 3300005450 | Soil | PDERIELTALAATHPAPAPIRATLAKLGLSETLKVSYDARPRLAAMFSTPRGPVTL* |
| Ga0070696_1000207056 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PAPVRAALAALGLSETLKVTYGRSPRLAAMLRTPRGIVTL* |
| Ga0066699_105221721 | 3300005561 | Soil | APIRAALAALGLADTLKVTYAQYARLAAMLRTPRGIVTL* |
| Ga0068855_1007404111 | 3300005563 | Corn Rhizosphere | RALSALGLSEALKVTYGGVPRLAAMLRTPRGTVTI* |
| Ga0068864_1022594642 | 3300005618 | Switchgrass Rhizosphere | THPEPAPIRAALTSLRLNDAIQVTYDRDTRLAAMLRTPRGVVTL* |
| Ga0068866_112909491 | 3300005718 | Miscanthus Rhizosphere | ASHPEPETIRASLKALGLGETLHVTYDSSPRLAAMLRTPRGLVTL* |
| Ga0066903_1064456072 | 3300005764 | Tropical Forest Soil | PVRAALAALGLSEVLKVSYNATARLAAMIATPRGPASL* |
| Ga0068851_104093291 | 3300005834 | Corn Rhizosphere | EPAPIRAALKALGQDEVMHVTYDRDMRLGAMLQTPRGIVTL* |
| Ga0068858_1014524772 | 3300005842 | Switchgrass Rhizosphere | DPAPVRAALAALGLGDTLKVTYGRHPRLAAMIRTPRGVVTL* |
| Ga0075290_10694721 | 3300005889 | Rice Paddy Soil | EHPEPAPVRDALAALGLSETLKVTYGRTPRLAAMLRTPRGTVTL* |
| Ga0066651_101824001 | 3300006031 | Soil | VRAALAALGLADIVPVTYDRETRLAAMLQTPRGLVTL* |
| Ga0066696_103721641 | 3300006032 | Soil | AIASLGLSETLKVTYGRHPRLAAMLRTPRGIVTL* |
| Ga0066656_110285501 | 3300006034 | Soil | THPAPAPIRATLAKLGLSETLKVSYDARPRLAAMFSTPRGPVTL* |
| Ga0070712_1015479511 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AALAALGLSETLKVTYGRSPRLAAMLRTPRGIVTI* |
| Ga0068871_1014004491 | 3300006358 | Miscanthus Rhizosphere | DALAGLGLSETLKVTYGRTPRLAAMLRTPRGVVTL* |
| Ga0074054_113530631 | 3300006579 | Soil | ATLAAAHPDPDRMRRVLTALGLGATLPITFAAKIRLAAMLRTPRGTVTL* |
| Ga0075428_1005435403 | 3300006844 | Populus Rhizosphere | HPEPASIRAALASLGQEGVLPVTYDRDARLAAMLRTPRGLVTF* |
| Ga0075425_1009328512 | 3300006854 | Populus Rhizosphere | HPDPAFVRAALADLGLADVLKVTFDRDARLAAMLRTPRGLATL* |
| Ga0079303_104270472 | 3300006930 | Deep Subsurface | DPAAVRAALDALGLAATIHVTYDRETRLAAMLRTSRGTVTLSS* |
| Ga0075435_1007693041 | 3300007076 | Populus Rhizosphere | REALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI* |
| Ga0075435_1008582193 | 3300007076 | Populus Rhizosphere | ALAALGLSDTLKVTFGRYPRLAAMIRTPRGLVTL* |
| Ga0075435_1013616981 | 3300007076 | Populus Rhizosphere | RATLADLGLADVLKVTFDRDARLAAMLRTPRGLATL* |
| Ga0115026_100707443 | 3300009111 | Wetland | LKALGLGDALSVTYDRETRLAAMLQTPRGIVTLSS* |
| Ga0066709_1041946321 | 3300009137 | Grasslands Soil | PDVVRAAIVALDLSSTIKTSYAPTPRLAAMIRTPRGTVTL* |
| Ga0126373_106253483 | 3300010048 | Tropical Forest Soil | IRAALAALGLSDVLRVSYDRAPRLAAMLSTPRGPITV* |
| Ga0134128_122268201 | 3300010373 | Terrestrial Soil | AQVRAALAALSLSETLKVTYGRSPRLAAMLRTPRGVVTL* |
| Ga0105239_110749773 | 3300010375 | Corn Rhizosphere | ALAALGLAGVLPVTYDPYARLAAMLRTPRGIVTL* |
| Ga0134126_104687083 | 3300010396 | Terrestrial Soil | RNALARLGLGDDVKVTYGQSPRLAAMIRTSRGIVTI* |
| Ga0134126_120446572 | 3300010396 | Terrestrial Soil | ALAALGLGECLKVTYGRTPRLAAMLRTPRGVVTL* |
| Ga0134124_108453703 | 3300010397 | Terrestrial Soil | AIRAALAALGLDGVLPVTYDRDARLAVMLRTPRGIVTL* |
| Ga0134123_103743913 | 3300010403 | Terrestrial Soil | AALASLGQDSALPVTYDRDVRLAAMLRTPRGIVTL* |
| Ga0137776_14529142 | 3300010937 | Sediment | ALAALGLGDDVKVTFSATPRLVAMLNTRRGAVTL* |
| Ga0137382_110142491 | 3300012200 | Vadose Zone Soil | PAPIRAGLAALGLSETLKVTYERHARLAAMLRTPRGLVTL* |
| Ga0157288_103285532 | 3300012901 | Soil | ASHPEPALIRAALASLGQDSALPVTYDRDVRLAAMLRTPRGIVTL* |
| Ga0157290_101992681 | 3300012909 | Soil | EPAPVREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI* |
| Ga0164300_101199392 | 3300012951 | Soil | APVREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI* |
| Ga0164303_107234101 | 3300012957 | Soil | HPEPGSMRAVLAALDLSETLKVTFDAAPRLAAMLSTRRGTVTL* |
| Ga0126369_102698561 | 3300012971 | Tropical Forest Soil | ALAALGLSDVLRVSYDRAPRVAAMLSTPRGPITL* |
| Ga0164309_105055601 | 3300012984 | Soil | LSAAHPEPRLKRAVPAALDLSETLKVTFDAAPRLAAMLSTRRGTVTL* |
| Ga0164304_113835842 | 3300012986 | Soil | AAAHPEPGSMRAVLAALGLSETLKVTFDAAPRLAAMLATRRGTVTL* |
| Ga0157370_111621572 | 3300013104 | Corn Rhizosphere | AAIARLGLADDVKVTYGQSPRLAAMVRTPRGIVTF* |
| Ga0120127_100477002 | 3300013503 | Permafrost | VTLALGLGDTLKVTFNAAPRLAAMLSTKRGTVTL* |
| Ga0075352_12384042 | 3300014324 | Natural And Restored Wetlands | LIRSALAALGLEHALPTTYDRDARLAAMLRTPRGIVTL* |
| Ga0157380_109151603 | 3300014326 | Switchgrass Rhizosphere | AASHPEPAPIRAALSSLGLNDVIQVTYDRDTRLAAMLRTPRGVVTL* |
| Ga0182008_104629042 | 3300014497 | Rhizosphere | RAALAALALSDTLKVSYGRTPRLAAMLRTPRGTVTL* |
| Ga0157379_103362053 | 3300014968 | Switchgrass Rhizosphere | STPIRDALMRLGLTDTLKVTYGRTPRLAAMLRTPRGVITL* |
| Ga0157376_120251662 | 3300014969 | Miscanthus Rhizosphere | GAVRADIAALGLSDFLKVTYAKSPRLAAMIRTPRGVATI* |
| Ga0173478_105445261 | 3300015201 | Soil | ALIRAALASLGPDLDLPVTYDRDARLAAMLRTPRGIVTL* |
| Ga0137412_105521142 | 3300015242 | Vadose Zone Soil | PEPGRIRSALAALGLGETLQVTFAGKIRLAAMLHTPRGLVTL* |
| Ga0132256_1014867501 | 3300015372 | Arabidopsis Rhizosphere | HPEPAPVRAALAALSLSETLKVTYGQSPRLAAMLRSPRGTVTL* |
| Ga0132257_1021135891 | 3300015373 | Arabidopsis Rhizosphere | AAIRAALAALGLDGVLPVTYDRDARLAVMLRTPRGIVTL* |
| Ga0163161_103759843 | 3300017792 | Switchgrass Rhizosphere | HPEPALIRAALASLGQDSALPVTYDRDVRLAAMLRTPRGIVTL |
| Ga0163161_110069231 | 3300017792 | Switchgrass Rhizosphere | THPEPAAVRAALASLKLPDQLTVTYDRQTRLAAMLRTPRGVLTL |
| Ga0187824_102767371 | 3300017927 | Freshwater Sediment | DALAALGLSDTLKVTYGRAPRLAAMLRTPRGIVTL |
| Ga0190274_106043071 | 3300018476 | Soil | DAVRAPLAALGLSEMLKVTYAKSPRLAAMIRTARGVATL |
| Ga0190274_131228792 | 3300018476 | Soil | EPGAMRAVLAALGLSETLKVTFDAAPRLAAMLSTRGGTVTL |
| Ga0193719_104238681 | 3300021344 | Soil | EEIRDALAALGLSGVLPVTYDPYARLAAMLRTPRGVVTL |
| Ga0194060_100727154 | 3300021602 | Anoxic Zone Freshwater | TDPEPAPIRAALKALGLGDTLAVTYDRETRLAAMLSTPRGIVTLSS |
| Ga0224500_100600041 | 3300022213 | Sediment | IRAALAALGLDGALPVTYDREARLAAMLRTPRGIVTL |
| Ga0247794_102761232 | 3300024055 | Soil | PAPVREALAGLGLSDALKVTYGRTPRLAAMLRTPRGVVTI |
| Ga0207680_107776662 | 3300025903 | Switchgrass Rhizosphere | PAPVRSALAALGLSDMLKVTYGRHPRLAAMIRTPRGLVTL |
| Ga0207654_107601502 | 3300025911 | Corn Rhizosphere | AAHPEPGSMRAVLAALDLSETLKVTFDAAPRLAAMLSTRRGTVTL |
| Ga0207707_109152342 | 3300025912 | Corn Rhizosphere | APVRAALAALGLSETLKVTYGRSPRLAAMLRTPRGIVTL |
| Ga0207663_103638002 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SALAAAHPEPGSMRAALAALGLSETLKVTFDAAPRLAAMLTTRRGTVTL |
| Ga0207660_114466022 | 3300025917 | Corn Rhizosphere | RTVLAALGLSETLKVTFDAAPRLAAMLTTRRGTVTL |
| Ga0207652_102750203 | 3300025921 | Corn Rhizosphere | AHPEPGSMRAVLAALGLSETLKVTFDAAPRLAAMLNTRRGTVTL |
| Ga0207659_107498691 | 3300025926 | Miscanthus Rhizosphere | ASHPEPALIRAALASLGPDLDLPVTYDRDARLAAMLRTPRGIVTL |
| Ga0207711_111419632 | 3300025941 | Switchgrass Rhizosphere | VRDALAGLGLSETLKVTYGRTPRLAAMLRTPRGVVTL |
| Ga0207661_104148431 | 3300025944 | Corn Rhizosphere | LAAAHPEPGSMRAALAALGLSETLKVTFDAAPRLAAMLTTRRGTVTL |
| Ga0207651_118822472 | 3300025960 | Switchgrass Rhizosphere | RSALAALGLAGALPVTYDPYARLAAMLRTPGGVVTI |
| Ga0207640_104253231 | 3300025981 | Corn Rhizosphere | PAPVRAAIARLGLADDVKVTYGQSPRLAAMVRTPRGIVTF |
| Ga0207640_112048431 | 3300025981 | Corn Rhizosphere | RAALGSLGLSESLRVTYDRETRLAAMLRTPQGYATLTSS |
| Ga0207703_112644232 | 3300026035 | Switchgrass Rhizosphere | IRGALAALGLAGVLPVTYDPYARLAAMLRTPRGIVTL |
| Ga0207639_109432212 | 3300026041 | Corn Rhizosphere | HPEPAPVRAALAALSLSETLKVTYGQSPRLAAMLRSPRGTVTL |
| Ga0207648_106352621 | 3300026089 | Miscanthus Rhizosphere | PEPDAVRKEIAALGLADTLKVTYAKSPRLAAMIRTPRGVATL |
| Ga0207675_1013156943 | 3300026118 | Switchgrass Rhizosphere | PVRAALAALGLGDTLKVTYGRHPRLAAMIRTPRGVVTL |
| Ga0209863_100670782 | 3300026281 | Prmafrost Soil | PAQMRAALAALGLSETLQVTFNATPRLAALVRTPQGTVAL |
| Ga0209156_100909161 | 3300026547 | Soil | RATLAKLGLSETLKVSYDARPRLAAMFSTPRGPVTL |
| Ga0208665_102445881 | 3300027715 | Deep Subsurface | DPAAVRAALDALGLAATIHVTYDRETRLAAMLRTSRGTVTLSS |
| Ga0209177_102293592 | 3300027775 | Agricultural Soil | LAAAHPEPGSMRAVLAALGLSETLKVTFDAAPRLAAMLTTRRGTVTL |
| Ga0209254_102964161 | 3300027897 | Freshwater Lake Sediment | LRAALAALGLEGTIAISYDRELRIAAMLRTPRGMVTL |
| Ga0209048_101669161 | 3300027902 | Freshwater Lake Sediment | DPREIRNALAALGVDAVLPVTYDRHARLAAMLRTPRGIVTL |
| Ga0268264_110997262 | 3300028381 | Switchgrass Rhizosphere | PEPAPAREALAGLGLSDTLKVTYGRTPRLAAMLRTPRGVVTI |
| Ga0311364_116222982 | 3300031521 | Fen | RISTLAAAHPEPDRMRAVLAALGLGATLPITFAAKIRLAAMLHTPRGTVTL |
| Ga0315290_116242992 | 3300031834 | Sediment | SDPAPVRAALAALGLDGTLAVTFDRETRLAAMLRTPRGIVTLSS |
| Ga0310904_102645082 | 3300031854 | Soil | VRKEIAALGLADTLKVTYAKSPRLAAMIRTPRGVATL |
| Ga0318527_103311792 | 3300031859 | Soil | THPTPGPIRAALAALGLSDVLKVSYDRAPRLAAMLSTPRGPVTL |
| Ga0315297_104834162 | 3300031873 | Sediment | RGVLATLDLGDVLPVTYDREARFAAMLRTPRGIVTL |
| Ga0306925_114017052 | 3300031890 | Soil | SALAATHPTPGPIRAALAALGLSDVLKVSYDRAPRLAAMLSTPRGPVTL |
| Ga0311367_108152821 | 3300031918 | Fen | AVRAELAALGLSDTLKVTYARSPRVAAMIRTPRGVATL |
| Ga0308176_112670031 | 3300031996 | Soil | PDPDAIRQALARMGLDGSMRVAFDRETRLAAMLRTPRGLVTLAS |
| Ga0315278_111284612 | 3300031997 | Sediment | AIRAALAALSLDGVLPVTYDREPRLAAMLRTPRGIVTL |
| Ga0315270_102252892 | 3300032275 | Sediment | PDPAEIRGALAVLGLDGILPTTYDREPRLAAMLRTPRGIVTL |
| Ga0315286_122104411 | 3300032342 | Sediment | PAAIRAALAALSLDGVLPVTYDREPRLAAMLRTPRGIVTL |
| Ga0315273_126223441 | 3300032516 | Sediment | HPDPTIIRKALQALGLEGALAVTYAREPRLAAMLRTPRGIVTLG |
| Ga0335082_103417621 | 3300032782 | Soil | LAKLDLEGAVRVSYDRETRLAAMLRTPRGVVTLST |
| Ga0316603_101598613 | 3300033413 | Soil | PDPAPVRAALAALGLGDVLKVTFATSPRLAAMLRTPRGLVTL |
| Ga0316625_1014549491 | 3300033418 | Soil | PAPIRAALAALGLGETLAVTYDRETRVAAMLQTPRGIVTLSS |
| Ga0316620_121500411 | 3300033480 | Soil | SVRKALEALGLSEILKVSYGRSPRLAAMLRTPRGVATL |
| Ga0316627_1016277891 | 3300033482 | Soil | DANPVRASLTRLGLADDIHVTYDRVTRLAALLRTPRGRVAL |
| Ga0364931_0026538_24_146 | 3300034176 | Sediment | MIRAALKALGLGDTLAVTYDRDTRLAAMLRTPRGPVTLSS |
| ⦗Top⦘ |