| Basic Information | |
|---|---|
| Family ID | F083014 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MPFILGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.42 % |
| % of genes near scaffold ends (potentially truncated) | 30.09 % |
| % of genes from short scaffolds (< 2000 bps) | 85.84 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.106 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.929 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.558 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 77.36% β-sheet: 0.00% Coil/Unstructured: 22.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF04120 | Iron_permease | 50.44 |
| PF02586 | SRAP | 9.73 |
| PF02245 | Pur_DNA_glyco | 4.42 |
| PF03073 | TspO_MBR | 4.42 |
| PF13628 | DUF4142 | 1.77 |
| PF13586 | DDE_Tnp_1_2 | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF07992 | Pyr_redox_2 | 0.88 |
| PF06226 | DUF1007 | 0.88 |
| PF03631 | Virul_fac_BrkB | 0.88 |
| PF14023 | DUF4239 | 0.88 |
| PF00199 | Catalase | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 9.73 |
| COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 4.42 |
| COG3476 | Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog) | Signal transduction mechanisms [T] | 4.42 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.88 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.88 |
| COG3683 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.11 % |
| Unclassified | root | N/A | 23.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5V46DG04IMERR | Not Available | 521 | Open in IMG/M |
| 2088090014|GPIPI_16826685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1470 | Open in IMG/M |
| 2088090014|GPIPI_16995955 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| 2088090015|GPICI_8902690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5684 | Open in IMG/M |
| 2228664021|ICCgaii200_c1084909 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300000550|F24TB_10499994 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300000789|JGI1027J11758_13001811 | Not Available | 587 | Open in IMG/M |
| 3300000890|JGI11643J12802_10405115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2308 | Open in IMG/M |
| 3300000953|JGI11615J12901_10938143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300000955|JGI1027J12803_100000336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300004156|Ga0062589_102049523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 65-79 | 582 | Open in IMG/M |
| 3300004463|Ga0063356_100328799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1916 | Open in IMG/M |
| 3300004463|Ga0063356_102092593 | Not Available | 859 | Open in IMG/M |
| 3300004463|Ga0063356_102163238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300004479|Ga0062595_101342505 | Not Available | 647 | Open in IMG/M |
| 3300004480|Ga0062592_101343532 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300004643|Ga0062591_102186981 | Not Available | 575 | Open in IMG/M |
| 3300005093|Ga0062594_102481950 | Not Available | 569 | Open in IMG/M |
| 3300005295|Ga0065707_10353506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300005332|Ga0066388_100269302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2345 | Open in IMG/M |
| 3300005332|Ga0066388_102769697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 895 | Open in IMG/M |
| 3300005338|Ga0068868_102137962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300005339|Ga0070660_101543630 | Not Available | 565 | Open in IMG/M |
| 3300005367|Ga0070667_101569553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 65-79 | 618 | Open in IMG/M |
| 3300005435|Ga0070714_100552294 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300005436|Ga0070713_100201919 | Not Available | 1796 | Open in IMG/M |
| 3300005439|Ga0070711_100060581 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300005444|Ga0070694_100478653 | Not Available | 987 | Open in IMG/M |
| 3300005545|Ga0070695_100235164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
| 3300005563|Ga0068855_101704401 | Not Available | 642 | Open in IMG/M |
| 3300005577|Ga0068857_101434646 | Not Available | 672 | Open in IMG/M |
| 3300005614|Ga0068856_100985033 | Not Available | 861 | Open in IMG/M |
| 3300005616|Ga0068852_102348576 | Not Available | 554 | Open in IMG/M |
| 3300005764|Ga0066903_100136512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3470 | Open in IMG/M |
| 3300005764|Ga0066903_100464768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2123 | Open in IMG/M |
| 3300005764|Ga0066903_102084375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
| 3300005764|Ga0066903_105389627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300006028|Ga0070717_12163728 | Not Available | 500 | Open in IMG/M |
| 3300006049|Ga0075417_10138936 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300006175|Ga0070712_101811474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300006806|Ga0079220_10458371 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300006845|Ga0075421_100750650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
| 3300006852|Ga0075433_10559681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1005 | Open in IMG/M |
| 3300006852|Ga0075433_11329513 | Not Available | 622 | Open in IMG/M |
| 3300006854|Ga0075425_100301486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1844 | Open in IMG/M |
| 3300006904|Ga0075424_100200086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2122 | Open in IMG/M |
| 3300006954|Ga0079219_10251759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1051 | Open in IMG/M |
| 3300007076|Ga0075435_100627157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 933 | Open in IMG/M |
| 3300009092|Ga0105250_10476936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300009100|Ga0075418_11335864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300009156|Ga0111538_10316693 | Not Available | 1974 | Open in IMG/M |
| 3300009156|Ga0111538_10864125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1145 | Open in IMG/M |
| 3300009162|Ga0075423_11158576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300009162|Ga0075423_11199319 | Not Available | 810 | Open in IMG/M |
| 3300010375|Ga0105239_12014546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300010376|Ga0126381_101065382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1167 | Open in IMG/M |
| 3300010399|Ga0134127_11866032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 65-79 | 678 | Open in IMG/M |
| 3300010403|Ga0134123_13044255 | Not Available | 538 | Open in IMG/M |
| 3300012885|Ga0157287_1097139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 541 | Open in IMG/M |
| 3300012891|Ga0157305_10117913 | Not Available | 676 | Open in IMG/M |
| 3300012903|Ga0157289_10080631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 893 | Open in IMG/M |
| 3300012906|Ga0157295_10223160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300012910|Ga0157308_10021050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1465 | Open in IMG/M |
| 3300012911|Ga0157301_10159281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri | 726 | Open in IMG/M |
| 3300012914|Ga0157297_10140791 | Not Available | 775 | Open in IMG/M |
| 3300012957|Ga0164303_11035112 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012957|Ga0164303_11533083 | Not Available | 505 | Open in IMG/M |
| 3300012971|Ga0126369_12028236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300012985|Ga0164308_11173535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 692 | Open in IMG/M |
| 3300012988|Ga0164306_10503651 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300013096|Ga0157307_1118458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300013100|Ga0157373_10407865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
| 3300013296|Ga0157374_11396655 | Not Available | 723 | Open in IMG/M |
| 3300013297|Ga0157378_10391060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1368 | Open in IMG/M |
| 3300013306|Ga0163162_10702425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300013307|Ga0157372_13434333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 65-79 | 504 | Open in IMG/M |
| 3300014325|Ga0163163_10326448 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300014325|Ga0163163_12154518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300014969|Ga0157376_10065138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3076 | Open in IMG/M |
| 3300015201|Ga0173478_10025650 | Not Available | 1730 | Open in IMG/M |
| 3300015371|Ga0132258_10300567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3947 | Open in IMG/M |
| 3300017792|Ga0163161_10324597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1218 | Open in IMG/M |
| 3300017792|Ga0163161_10594313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300018028|Ga0184608_10008107 | All Organisms → cellular organisms → Bacteria | 3493 | Open in IMG/M |
| 3300018072|Ga0184635_10185542 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300019356|Ga0173481_10037761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1592 | Open in IMG/M |
| 3300019361|Ga0173482_10178135 | Not Available | 852 | Open in IMG/M |
| 3300019361|Ga0173482_10282729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300021560|Ga0126371_10261964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1846 | Open in IMG/M |
| 3300021560|Ga0126371_10494261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1371 | Open in IMG/M |
| 3300022756|Ga0222622_10901799 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300022880|Ga0247792_1092863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium albiziae | 612 | Open in IMG/M |
| 3300022883|Ga0247786_1049176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 852 | Open in IMG/M |
| 3300025901|Ga0207688_10691633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300025904|Ga0207647_10043716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2801 | Open in IMG/M |
| 3300025914|Ga0207671_11325069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300025914|Ga0207671_11329227 | Not Available | 559 | Open in IMG/M |
| 3300025915|Ga0207693_10054368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3141 | Open in IMG/M |
| 3300025921|Ga0207652_10997530 | Not Available | 736 | Open in IMG/M |
| 3300025929|Ga0207664_10079868 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
| 3300025929|Ga0207664_10180552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1811 | Open in IMG/M |
| 3300025933|Ga0207706_10075884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2957 | Open in IMG/M |
| 3300025942|Ga0207689_10961344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 721 | Open in IMG/M |
| 3300027036|Ga0207467_1009359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 740 | Open in IMG/M |
| 3300027424|Ga0209984_1059457 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027907|Ga0207428_10483269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
| 3300027909|Ga0209382_11538669 | Not Available | 661 | Open in IMG/M |
| 3300028592|Ga0247822_11039073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300028809|Ga0247824_11067561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300028828|Ga0307312_10512870 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300031740|Ga0307468_101166624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300033475|Ga0310811_11299357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 580 | Open in IMG/M |
| 3300033551|Ga0247830_10060024 | All Organisms → cellular organisms → Bacteria | 2539 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027036 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_00282000 | 2067725004 | Soil | MPFILGVLIAIGLSATLVAVMLENTFGGQPMFVALGHMLAILGAAIFAWWLGR |
| GPIPI_01331820 | 2088090014 | Soil | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFSWWLGR |
| GPIPI_02537380 | 2088090014 | Soil | MPFILGVXIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR |
| GPICI_03513080 | 2088090015 | Soil | MPFILGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR |
| ICCgaii200_10849092 | 2228664021 | Soil | MPFIFGVLIAIGLSATVISITLGDIFGETPLFVALGQCLAILGAAAFAWWLAR |
| F24TB_104999942 | 3300000550 | Soil | MPFILGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR* |
| JGI1027J11758_130018111 | 3300000789 | Soil | MQFILGVVIDIGLSVTLVSVVLGNTFGDHPMFVALGQTLAILGAAIFAWWLGR* |
| JGI11643J12802_104051152 | 3300000890 | Soil | MQFILGVLIDIGLSVTLVSVVLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR* |
| JGI11615J12901_109381432 | 3300000953 | Soil | MQFVLGVLIAIALVAVSLMLGSIFGDDPMFVALGQTLAIVGAATFAGGLEDRL |
| JGI1027J12803_1000003361 | 3300000955 | Soil | MQFILGVLIDIGLSVTLVSVVLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR |
| Ga0062589_1020495232 | 3300004156 | Soil | MPFILGVLIAIGLSATLVAVMLENTFGGQPMFVALGQTLAILGAAIFAWWLGR* |
| Ga0063356_1003287991 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPFVLGVLIAIGLTATAISLTLDIFGEAPIFVALGQCPAILGAAAFAW* |
| Ga0063356_1020925931 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MQFVLGVLIAIALVATLVSLMLGSVFGDDPMFVALGQTLAIVGAATFAWWLGK* |
| Ga0063356_1021632381 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MQFILGVLIAIGLSVTLVSVVLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR* |
| Ga0062595_1013425052 | 3300004479 | Soil | MPFIFGVLIAIGLSATVISITLGDIFGEAPLFVALGQCLAILGAAAFAWWLAR* |
| Ga0062592_1013435322 | 3300004480 | Soil | MPFILGVLIAIGLSATLVSVMLGNTFGDHAMFVALGQTLAILGAAFFAWWLGK* |
| Ga0062591_1021869811 | 3300004643 | Soil | MQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAWWLGR* |
| Ga0062594_1024819501 | 3300005093 | Soil | RMQFVLGVLIAIALVATLMSLMLGSIFGDDPMFVALGQTLAIAGAATFAWWLGK* |
| Ga0065707_103535063 | 3300005295 | Switchgrass Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAF |
| Ga0066388_1002693023 | 3300005332 | Tropical Forest Soil | MPFIFGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAVLGAAFFAWWLGR* |
| Ga0066388_1027696972 | 3300005332 | Tropical Forest Soil | MPFILGMLIAIGLSATLISVTLGNTFGDHPAFMALGQTLAILGAAFFAWWLGR* |
| Ga0068868_1021379621 | 3300005338 | Miscanthus Rhizosphere | MLRFVLGVLIASALAAILVSLALGSIFSSDPMFVALGQTIAILGAATFAWWLGRQDCKRRSS* |
| Ga0070660_1015436301 | 3300005339 | Corn Rhizosphere | MQFVLGVLIAIALVATLMSLMLGSIFGDDPMFVALGQTLAIAGAATFAWWLGK* |
| Ga0070667_1015695532 | 3300005367 | Switchgrass Rhizosphere | MQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAWWLGK* |
| Ga0070714_1005522942 | 3300005435 | Agricultural Soil | MQFVLDVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFSWWLGR* |
| Ga0070713_1002019193 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFAWWLGR* |
| Ga0070711_1000605813 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFSWWLGR* |
| Ga0070694_1004786533 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFVLGVLIAIALVATLVSLMLGRIFGDDPMCVALGQTLAIVGAATFAWWLGK* |
| Ga0070695_1002351642 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFVLGVLIAIALVATLVCLMLGSIFGDDPMFVALGQTLAIVGAATFAWWLGK* |
| Ga0068855_1017044013 | 3300005563 | Corn Rhizosphere | VLIAIALVATLVSLTLRSIFGDDPMFVALGQTLAIAGAATFAWWLGK* |
| Ga0068857_1014346463 | 3300005577 | Corn Rhizosphere | AIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAWWLGK* |
| Ga0068856_1009850331 | 3300005614 | Corn Rhizosphere | QGRMQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAWWLGK* |
| Ga0068852_1023485761 | 3300005616 | Corn Rhizosphere | LGQGRMQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAWWLGK* |
| Ga0066903_1001365126 | 3300005764 | Tropical Forest Soil | MPFILGVLVAIGISATLVSVTLGNTFGNHPVFMALGQTLAILGAAFFVWWLGR* |
| Ga0066903_1004647683 | 3300005764 | Tropical Forest Soil | MPFILGVLIAIGLSATLVSVVLGNTFGDHPMFVVFGQTLAILGAAFFAWWLKR* |
| Ga0066903_1020843752 | 3300005764 | Tropical Forest Soil | MPFIFGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR* |
| Ga0066903_1053896272 | 3300005764 | Tropical Forest Soil | NSGINTPESHMPFILGVLIAIGLSATLVAVMLENSFGDQPIFVVLGQTLAILGAAVFAWWLGR* |
| Ga0070717_121637282 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFILGVLVAIGLSATLVSVMLGNTFGDHPIFAALGQTLAILGAAIFAWWLGR* |
| Ga0075417_101389361 | 3300006049 | Populus Rhizosphere | RRLLWHKTPESHMQFILGVLLAIGLSATLVSVVLGNTFGDNPMFVALGQTLAILGAAFFAWWLGR* |
| Ga0070712_1018114741 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATF |
| Ga0079220_104583712 | 3300006806 | Agricultural Soil | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAATFAWWLGR* |
| Ga0075421_1007506502 | 3300006845 | Populus Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFGDHAMFVALGQTLAILEAAFFAWWLGR* |
| Ga0075433_105596811 | 3300006852 | Populus Rhizosphere | MPFILGVLIAIGLSATLVSVKLGNTFGDHAMFVALGQTLAILGAAFFAWW |
| Ga0075433_113295131 | 3300006852 | Populus Rhizosphere | ESHMPFVLGVLIAIGLTATAISLTLDIFGEAPIFVALGQCPAILGAAAFAW* |
| Ga0075425_1003014864 | 3300006854 | Populus Rhizosphere | VLIAIGLSVTLVSVVLGNTFGDHPMFVALGQTLAIFGAAFFAWWLGR* |
| Ga0075424_1002000864 | 3300006904 | Populus Rhizosphere | MQFILGVLIAIGLSVTLVSVVLGNTFGDHPMFVALGQTLAIFGAAFFAWWLGR* |
| Ga0079219_102517593 | 3300006954 | Agricultural Soil | MQFELGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFAWWLGR* |
| Ga0075435_1006271572 | 3300007076 | Populus Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFGDHAMFVALGQTLAILGAAFFAWWLGR* |
| Ga0105250_104769361 | 3300009092 | Switchgrass Rhizosphere | MPFILGVLIAIGLSATLVSLMLGNTFGDHAMFVALGQTLAILGAAFFAWWLGK* |
| Ga0075418_113358642 | 3300009100 | Populus Rhizosphere | MPFILGVLIAIGLSATLVSVKLGNTFGDHAMFVALGQTLAILGAAFFAWWLGK* |
| Ga0111538_103166931 | 3300009156 | Populus Rhizosphere | YSDVSTPESHMPFILGVLIAIGLSATLVSVKPGNTFGDHAMFVALGQTLAILGAAFFAWWLGK* |
| Ga0111538_108641252 | 3300009156 | Populus Rhizosphere | MQFILGVLLAIGLSATLVSVVLGNTFGDNPMFVALGQTLAILGAAFFAWWLGR* |
| Ga0075423_111585762 | 3300009162 | Populus Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFGDHALFVALGQTLAILEAAFFAWWLGR* |
| Ga0075423_111993193 | 3300009162 | Populus Rhizosphere | FILGVLIAIGLSATLVSVKLGNTFGDHAMFVALGQTLAILGAAFFAWWLGK* |
| Ga0105239_120145461 | 3300010375 | Corn Rhizosphere | MPFILGVLIAIGLSATLVSLMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR* |
| Ga0126381_1010653822 | 3300010376 | Tropical Forest Soil | MPFILGVLIAIGLSATLVSVTLGNTFGDHPMFVVLGQTLAILGAAFFAWWLKR* |
| Ga0134127_118660322 | 3300010399 | Terrestrial Soil | MPFILGVLIAIGLSATLVSVKLGNTFGDHAMFVALGQTLAILGAAFFAWWLGR* |
| Ga0134123_130442552 | 3300010403 | Terrestrial Soil | AIGLSATLVSVKLGNTFGDHAMFVALGQTLAILGAAFFAWWLGK* |
| Ga0157287_10971392 | 3300012885 | Soil | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAMVGAAAFSWWLGR* |
| Ga0157305_101179131 | 3300012891 | Soil | PCISTREGYVPFILGVLIAIGLSATLVAVMLGNTFGGQPMFVALGQTLAILGAAFFAWWLGR* |
| Ga0157289_100806311 | 3300012903 | Soil | MQFVLGVLIVIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAATFAWWLGR* |
| Ga0157295_102231602 | 3300012906 | Soil | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFSGGLEDRTF* |
| Ga0157308_100210504 | 3300012910 | Soil | MPFILGVLIAIGLSATLVAVMLENSFGGQPMFVALGQTLAILGAAIFAWWLGR* |
| Ga0157301_101592811 | 3300012911 | Soil | AVRVGSADRYALTATLVSVTLGSIFGDDLMFLALGQTLAIIGTATFAWWLGR* |
| Ga0157297_101407911 | 3300012914 | Soil | MPFILGVLIAIGLSATLVAVMLGNTFGGQPMFVALGQTLAILGAAIFAWWLGR* |
| Ga0164303_110351121 | 3300012957 | Soil | MQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAW |
| Ga0164303_115330832 | 3300012957 | Soil | PFIIGVLIAIALSATVISITLGDIFGEAPLFVALGQCLAILGAAAFAWWLAR* |
| Ga0126369_120282361 | 3300012971 | Tropical Forest Soil | MPFIFGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLKR* |
| Ga0164308_111735351 | 3300012985 | Soil | VRQGRMLRFVLGVLIASALAAILVSLALGSIFSSVPMFVALGQTIAILGAATFAWWLGRQDFKRRSS* |
| Ga0164306_105036512 | 3300012988 | Soil | MPFIIGVLIAIALSATVISITLGDIFGEAPLFVALGQCLAILGAAAFAWWLAR* |
| Ga0157307_11184581 | 3300013096 | Soil | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAATFAWWLGK* |
| Ga0157373_104078651 | 3300013100 | Corn Rhizosphere | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFAWW |
| Ga0157374_113966551 | 3300013296 | Miscanthus Rhizosphere | KLGQGRMQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAWWLGK* |
| Ga0157378_103910603 | 3300013297 | Miscanthus Rhizosphere | MLRFVLGVLIASALAAILVSLALGSIFSSDPMFVALGQTIAILGAATFAWWLG |
| Ga0163162_107024252 | 3300013306 | Switchgrass Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGK* |
| Ga0157372_134343331 | 3300013307 | Corn Rhizosphere | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIAGAATFAWWLGK* |
| Ga0163163_103264482 | 3300014325 | Switchgrass Rhizosphere | MQFVLDVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFAWWLGR* |
| Ga0163163_121545181 | 3300014325 | Switchgrass Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFADHAMFVALGQTLAILGAA |
| Ga0157376_100651386 | 3300014969 | Miscanthus Rhizosphere | MQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAAAFAWWLGR* |
| Ga0173478_100256502 | 3300015201 | Soil | MPFILGVLIAIGLSATLVAVMLENTFGGQPMFVALGHTLAILGAAIFAWWLGR* |
| Ga0132258_103005675 | 3300015371 | Arabidopsis Rhizosphere | MLRFVLGVLIASALAAILVSLALGSIFSSDPMFVALGQTIAILGAATFAWWLGRQYFKRRSS* |
| Ga0163161_103245972 | 3300017792 | Switchgrass Rhizosphere | MPFIIGVLIAIALSATVISITLDDIFGEAPLFVALGQCLAILGAAAFAWWLAR |
| Ga0163161_105943132 | 3300017792 | Switchgrass Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGK |
| Ga0184608_100081072 | 3300018028 | Groundwater Sediment | MPFIIGVLIAIALSATVISITLGDIFGEAPLFVALGQCLAILGAAAFAWWLAR |
| Ga0184635_101855421 | 3300018072 | Groundwater Sediment | MQFIIGVLIAIALSATVISITLGDIFGEAPLFVALGQCLAILGAAAFAWWLAK |
| Ga0173481_100377612 | 3300019356 | Soil | MPFILGVLIAIGLSATLVSVTLGNTFGDHPVFVALGQTLAILGAAFFAWWLGR |
| Ga0173482_101781352 | 3300019361 | Soil | MPFILGVLIAIGLSATLVAVMLENTFGGQPMFVALGQTLAILGAAIFAWWLGR |
| Ga0173482_102827291 | 3300019361 | Soil | MRFVLGALIAIALASTLVSLMLGSIFGNNPMFAALGQTLVIVGAATFAWWLGRNVH |
| Ga0126371_102619643 | 3300021560 | Tropical Forest Soil | MPFILGVLIAIGLSATLVAVMLENSFGDQPIFVVLGQTLAMLGAAVFAWWLGR |
| Ga0126371_104942612 | 3300021560 | Tropical Forest Soil | MPFILGVLVAIGISATLVSVTLGNTFGDHPMFVALGQTLAVLGAAFFAWWLGR |
| Ga0222622_109017992 | 3300022756 | Groundwater Sediment | MPFIFGVLIAISLLATVISITLGDIFGEVPLFVALGQCLAILGAATFAWWLAR |
| Ga0247792_10928632 | 3300022880 | Soil | MPFILGVLIAIGLSATLVAVMLENTFGGQPMFVALGQTLAILGAAIFAWW |
| Ga0247786_10491761 | 3300022883 | Soil | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAATFAWWLGR |
| Ga0207688_106916332 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFGDHAMFVALGQTLAILGAAFFAWWLGK |
| Ga0207647_100437166 | 3300025904 | Corn Rhizosphere | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFSW |
| Ga0207671_113250691 | 3300025914 | Corn Rhizosphere | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFAWWL |
| Ga0207671_113292272 | 3300025914 | Corn Rhizosphere | MQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAWWLGK |
| Ga0207693_100543683 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFLALGQTLAIVGAAAFSWWLGR |
| Ga0207652_109975301 | 3300025921 | Corn Rhizosphere | MQFVLGVLIAIALVATLVSLMLGSIFGDDPMFVALGQTLAIVGAATFAWWL |
| Ga0207664_100798682 | 3300025929 | Agricultural Soil | MPFILGVLVAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR |
| Ga0207664_101805523 | 3300025929 | Agricultural Soil | MQFVLDVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFSWWLGR |
| Ga0207706_100758844 | 3300025933 | Corn Rhizosphere | MQFVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIAGAATFAWWLGR |
| Ga0207689_109613442 | 3300025942 | Miscanthus Rhizosphere | MQLVLGVLIAIALVATLVSLTLRSIFGDDLMFVALGQTLAIVGAAAFAWWLGR |
| Ga0207467_10093592 | 3300027036 | Soil | IGLSATLVSVMLGNTFGDHPMFVALGQTLAIVGAAAFSWWLGR |
| Ga0209984_10594571 | 3300027424 | Arabidopsis Thaliana Rhizosphere | MQFILGVLIAIGLSVTLVSVVLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR |
| Ga0207428_104832693 | 3300027907 | Populus Rhizosphere | MPFILGVLIAIGLSATLVSVKLGNTFGDHAMFVALGQTLAILGAAFFAWWLGK |
| Ga0209382_115386692 | 3300027909 | Populus Rhizosphere | MPFILGVLIAIGLSATLVSVMLGNTFGDHAMFVALGQTLAILEAAFFAWWLGR |
| Ga0247822_110390731 | 3300028592 | Soil | MPFIIGVLIAIALSATVISITLGDIFGEAPLFVALGQCLAILGAAVFAWWLAR |
| Ga0247824_110675611 | 3300028809 | Soil | MPFIIGVLIAIALSATVISITLGDIFGEAPLFVALGQCLAILG |
| Ga0307312_105128702 | 3300028828 | Soil | MPFIFGVLIAIALSATVISITLGDIFGEAPLFVALGQCLAILGAAAFAWWLAR |
| Ga0307468_1011666242 | 3300031740 | Hardwood Forest Soil | MPFIIGVLIAIGLSATVISITLGDIFGDAPVFVALGQCLAILGAAVFAWWLAR |
| Ga0310811_112993571 | 3300033475 | Soil | MPFILGVLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFA |
| Ga0247830_100600242 | 3300033551 | Soil | VLIAIGLSATLVSVMLGNTFGDHPMFVALGQTLAILGAAFFAWWLGR |
| ⦗Top⦘ |