NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083006

Metagenome / Metatranscriptome Family F083006

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083006
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 42 residues
Representative Sequence MPTIEGKEGRLWIDAYVKKAGKLAGVAKAIRALVKKTAAG
Number of Associated Samples 102
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.23 %
% of genes near scaffold ends (potentially truncated) 95.58 %
% of genes from short scaffolds (< 2000 bps) 89.38 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.416 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.584 % of family members)
Environment Ontology (ENVO) Unclassified
(23.894 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.982 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.47%    β-sheet: 0.00%    Coil/Unstructured: 48.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF07690MFS_1 4.42
PF04405ScdA_N 3.54
PF08818DUF1801 2.65
PF12867DinB_2 2.65
PF064393keto-disac_hyd 2.65
PF04909Amidohydro_2 1.77
PF07883Cupin_2 1.77
PF08240ADH_N 1.77
PF07589PEP-CTERM 0.88
PF01797Y1_Tnp 0.88
PF03030H_PPase 0.88
PF13358DDE_3 0.88
PF13520AA_permease_2 0.88
PF13424TPR_12 0.88
PF00069Pkinase 0.88
PF12704MacB_PCD 0.88
PF06197DUF998 0.88
PF03960ArsC 0.88
PF12697Abhydrolase_6 0.88
PF13460NAD_binding_10 0.88
PF10091Glycoamylase 0.88
PF03372Exo_endo_phos 0.88
PF00005ABC_tran 0.88
PF04389Peptidase_M28 0.88
PF08327AHSA1 0.88
PF03781FGE-sulfatase 0.88
PF027395_3_exonuc_N 0.88
PF13561adh_short_C2 0.88
PF00891Methyltransf_2 0.88
PF05402PqqD 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.54
COG2846Iron-sulfur cluster repair protein YtfE, RIC family, contains ScdAN and hemerythrin domainsPosttranslational modification, protein turnover, chaperones [O] 3.54
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 2.65
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 2.65
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 2.65
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.88
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.88
COG1393Arsenate reductase or related protein, glutaredoxin familyInorganic ion transport and metabolism [P] 0.88
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.88
COG3371Uncharacterized membrane proteinFunction unknown [S] 0.88
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.42 %
UnclassifiedrootN/A18.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZN2CUW02GK2XPAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300002245|JGIcombinedJ26739_101339789All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005163|Ga0066823_10039533All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300005434|Ga0070709_10175600All Organisms → cellular organisms → Bacteria → Acidobacteria1500Open in IMG/M
3300005436|Ga0070713_101111680All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300005450|Ga0066682_10649391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300005471|Ga0070698_101287477Not Available681Open in IMG/M
3300005545|Ga0070695_100622613All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005764|Ga0066903_100014743All Organisms → cellular organisms → Bacteria7877Open in IMG/M
3300006052|Ga0075029_101062289Not Available561Open in IMG/M
3300006176|Ga0070765_100035122All Organisms → cellular organisms → Bacteria3951Open in IMG/M
3300006797|Ga0066659_11243307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300006854|Ga0075425_102860532Not Available530Open in IMG/M
3300007265|Ga0099794_10335540Not Available785Open in IMG/M
3300009174|Ga0105241_12342916All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009545|Ga0105237_10919462All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300010326|Ga0134065_10200123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300010358|Ga0126370_10524916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1006Open in IMG/M
3300010359|Ga0126376_12779300All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300010360|Ga0126372_10661501All Organisms → cellular organisms → Bacteria → Acidobacteria1013Open in IMG/M
3300010362|Ga0126377_10215506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1849Open in IMG/M
3300010362|Ga0126377_11286601All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300010366|Ga0126379_10839022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans1019Open in IMG/M
3300010379|Ga0136449_104034778All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300010398|Ga0126383_13556016All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300012202|Ga0137363_10141333All Organisms → cellular organisms → Bacteria1881Open in IMG/M
3300012357|Ga0137384_10007057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9052Open in IMG/M
3300012362|Ga0137361_11840422All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300012685|Ga0137397_11239307All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300012917|Ga0137395_11277799All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300012923|Ga0137359_10097319All Organisms → cellular organisms → Bacteria2597Open in IMG/M
3300012930|Ga0137407_11981784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300012944|Ga0137410_11056498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300012948|Ga0126375_11817008Not Available532Open in IMG/M
3300012971|Ga0126369_11430546Not Available781Open in IMG/M
3300012971|Ga0126369_12078562All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300012986|Ga0164304_11730428All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300013307|Ga0157372_11435000All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300014166|Ga0134079_10394548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300015052|Ga0137411_1299152All Organisms → cellular organisms → Bacteria → Acidobacteria1216Open in IMG/M
3300015241|Ga0137418_10393416All Organisms → cellular organisms → Bacteria → Acidobacteria1132Open in IMG/M
3300015264|Ga0137403_10925778All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300016270|Ga0182036_10058730All Organisms → cellular organisms → Bacteria → Acidobacteria2454Open in IMG/M
3300016270|Ga0182036_10809333All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300016357|Ga0182032_10045340All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium EW112812Open in IMG/M
3300016357|Ga0182032_10551377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans954Open in IMG/M
3300016371|Ga0182034_10351883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae1196Open in IMG/M
3300017961|Ga0187778_10182237All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300018433|Ga0066667_11655121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300018482|Ga0066669_10169192All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300018482|Ga0066669_10680890All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300020583|Ga0210401_11535272Not Available523Open in IMG/M
3300021181|Ga0210388_10597352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium965Open in IMG/M
3300021403|Ga0210397_11258379All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300021406|Ga0210386_11251403Not Available626Open in IMG/M
3300021407|Ga0210383_11071675All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300021420|Ga0210394_11645637Not Available539Open in IMG/M
3300021478|Ga0210402_11666908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300021559|Ga0210409_10620273Not Available951Open in IMG/M
3300021560|Ga0126371_10177057All Organisms → cellular organisms → Bacteria2214Open in IMG/M
3300024290|Ga0247667_1053771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300024347|Ga0179591_1025487All Organisms → cellular organisms → Bacteria3882Open in IMG/M
3300025911|Ga0207654_11136056All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300025915|Ga0207693_11346647Not Available532Open in IMG/M
3300025926|Ga0207659_11914904All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300026328|Ga0209802_1215586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300026800|Ga0207742_114363All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300026833|Ga0207728_118202Not Available633Open in IMG/M
3300026953|Ga0207835_1027687All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes726Open in IMG/M
3300026990|Ga0207824_1021273All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300027460|Ga0207506_1013883All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300027765|Ga0209073_10517488All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300027869|Ga0209579_10410604All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300027894|Ga0209068_10636764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300027910|Ga0209583_10382878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300028145|Ga0247663_1036821All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300028800|Ga0265338_10147226All Organisms → cellular organisms → Bacteria1835Open in IMG/M
3300029636|Ga0222749_10783253All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031231|Ga0170824_106872781All Organisms → cellular organisms → Bacteria1952Open in IMG/M
3300031561|Ga0318528_10450685Not Available691Open in IMG/M
3300031679|Ga0318561_10326362All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes841Open in IMG/M
3300031719|Ga0306917_10087762All Organisms → cellular organisms → Bacteria → Acidobacteria2202Open in IMG/M
3300031719|Ga0306917_11165394Not Available599Open in IMG/M
3300031744|Ga0306918_10131728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31825Open in IMG/M
3300031879|Ga0306919_10219657All Organisms → cellular organisms → Bacteria → Acidobacteria1419Open in IMG/M
3300031894|Ga0318522_10349279All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300031896|Ga0318551_10455959All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes731Open in IMG/M
3300031942|Ga0310916_10377276All Organisms → cellular organisms → Bacteria → Acidobacteria1206Open in IMG/M
3300031945|Ga0310913_10277949All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300031954|Ga0306926_10678718All Organisms → cellular organisms → Bacteria → Acidobacteria1251Open in IMG/M
3300031962|Ga0307479_10047411All Organisms → cellular organisms → Bacteria4130Open in IMG/M
3300032001|Ga0306922_11972816Not Available569Open in IMG/M
3300032035|Ga0310911_10241630All Organisms → cellular organisms → Bacteria → Acidobacteria1033Open in IMG/M
3300032076|Ga0306924_10260525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31991Open in IMG/M
3300032076|Ga0306924_10445556All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1479Open in IMG/M
3300032174|Ga0307470_10312999All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300032180|Ga0307471_101915691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300032205|Ga0307472_100822297All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300032261|Ga0306920_100286675All Organisms → cellular organisms → Bacteria → Acidobacteria2454Open in IMG/M
3300032261|Ga0306920_100437710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin3451943Open in IMG/M
3300032261|Ga0306920_101673668All Organisms → cellular organisms → Bacteria → Terrabacteria group902Open in IMG/M
3300032783|Ga0335079_12238112Not Available521Open in IMG/M
3300032805|Ga0335078_11567502All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300032805|Ga0335078_12717762Not Available504Open in IMG/M
3300032893|Ga0335069_10949915Not Available957Open in IMG/M
3300032897|Ga0335071_11850303Not Available547Open in IMG/M
3300032955|Ga0335076_10341144All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300033004|Ga0335084_10337554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1555Open in IMG/M
3300033289|Ga0310914_10108095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2404Open in IMG/M
3300033289|Ga0310914_10384812All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300033290|Ga0318519_10814312Not Available575Open in IMG/M
3300033412|Ga0310810_11251930Not Available592Open in IMG/M
3300033486|Ga0316624_12272441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.16%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.54%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026800Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes)EnvironmentalOpen in IMG/M
3300026833Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes)EnvironmentalOpen in IMG/M
3300026953Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes)EnvironmentalOpen in IMG/M
3300026990Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes)EnvironmentalOpen in IMG/M
3300027460Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_031267302170459003Grass SoilMPTIEGKEGRLWIDAYVKKAGKFSGVMKAVRALVKKAAANCEEYVSPWKT
JGIcombinedJ26739_10133978923300002245Forest SoilMPTIEGKQARLWIDGYVKKAGKLEGVTRAVRALVKKTVKGSEEYVNPW
Ga0066823_1003953313300005163SoilMPTIEGKEGLLWIDAYVKKAGKLAGVARAVRTLVKKSAAD
Ga0070709_1017560013300005434Corn, Switchgrass And Miscanthus RhizosphereMPTIEGKQAAIWIADYVNKAGEFESVLKAVRTLVKKSVKG
Ga0070713_10111168013300005436Corn, Switchgrass And Miscanthus RhizosphereMPTIEGKQAGIWITNYVNKAGKLEGVSKEVRALVKKAVKG
Ga0066682_1064939123300005450SoilMPTVEGREARVWIDEYVKKAGKLSGVAKMVRALVKKAVAGCEEYVNPWKI
Ga0070698_10128747713300005471Corn, Switchgrass And Miscanthus RhizosphereMPTVEGREARVWIDEYVKKAGELSGVAKMVRALVKKAVAGCEEYVNPW
Ga0070695_10062261313300005545Corn, Switchgrass And Miscanthus RhizosphereMPTIEGKEARVWIDKYVNKAGKVPGVAKAVRALVKKTVAGCQ
Ga0066903_10001474393300005764Tropical Forest SoilMPTIEGKQGRVWIDGYVSKAGKLSGVAKAVRALVKKAVSGCEEYVN
Ga0075029_10106228923300006052WatershedsMATIEGKEGRVWIDEYVEKAGKLKSVVKGLRALVKRTLAGCEEYVNPWK
Ga0070765_10003512253300006176SoilMPTIEGKQAQAWIDAYVRKAGKLEGVTKAVRALLKK
Ga0066659_1124330723300006797SoilMPTVEGREARVWIDEYVNKAGKLSGVAKMVRALVKKAVA
Ga0075425_10286053213300006854Populus RhizosphereMPTIEGKEGRLWIDAYVRKAGELAGVARAVRTLVKK
Ga0099794_1033554013300007265Vadose Zone SoilMPTIEGKEGRAWIDEYVEKAGKLKGVMKGLRALVKKTLGGSEEYV
Ga0105241_1234291623300009174Corn RhizosphereMPTVEGKEARVWIDKYVNKAGKVPGVAKAVRALVKKTVAGC
Ga0105237_1091946213300009545Corn RhizosphereMPTIEGKQAAIWINDYVKTAGKLEGVAKAVRTLVKKAVKG
Ga0134065_1020012323300010326Grasslands SoilMPTIEGKEGRLWIDAYVKKAGEFSGVMKAVRALVKKTAADC
Ga0126370_1052491613300010358Tropical Forest SoilMPTIEGKEGKLWIDAYVKEAGKLGGVAKAVRALVKKTAAGCEEY
Ga0126376_1277930013300010359Tropical Forest SoilMPTIEGKEARVWIDEYLNKAGKLSRVAKAVRALVKKTVTGCE
Ga0126372_1066150113300010360Tropical Forest SoilMPTVEGREACVWIDKYVRKSGKLSRVARAVRALVKNVVAGSEE
Ga0126377_1021550633300010362Tropical Forest SoilMPTIEGKEAEVWIDGYVKKAGKLESVTKAVRALVKKTVKKN
Ga0126377_1128660123300010362Tropical Forest SoilMEMEADVPTMEGREARVWIDQYVRNAGKLSGVASALRSFVKRTVT
Ga0126379_1083902213300010366Tropical Forest SoilMPTIEGKQAGVWIDGYVKKAGKLEGVTKAVRALVKKTVK
Ga0136449_10403477823300010379Peatlands SoilMPTIEGKEGRLWIDAYVKKSGKFSGVMKAVRALVKRTA
Ga0126383_1355601613300010398Tropical Forest SoilMPTIEGKQGRVWIDGYVSKAGKLSGVAKAVRALVKKAVSGCEEY
Ga0137363_1014133323300012202Vadose Zone SoilMPTIEGKEGRLWIDAYVRKAGRFSGVMKAVRALVKKTAADCEEYVSPWKT
Ga0137384_1000705723300012357Vadose Zone SoilMPTIEGREGRLWIDAYVKKAGKFSGVMKAVRALVKKTAADCE*
Ga0137361_1184042213300012362Vadose Zone SoilMPTVEGREARVWIDEYVKKAGKLSGVAKMVRALVKKAVAGCEEYV
Ga0137397_1123930713300012685Vadose Zone SoilCKIPIIEGKEGRLWIDAYVREAGRFSGVMNAVRELVKKTAAD*
Ga0137395_1127779923300012917Vadose Zone SoilMPTVEGREARVWIDEYVNKAGKLSGVAKMVRALVKKAVAGCEEYVNPW
Ga0137359_1009731913300012923Vadose Zone SoilMPTVEGKEARVWIDEYVNKGGKVPGVAKAVRALVKKTV
Ga0137407_1198178413300012930Vadose Zone SoilMPTIEGKEGRLWIDAYVKKAGRFSGVMKAVRALVKKTAADCEEYV
Ga0137410_1105649823300012944Vadose Zone SoilMPTIEGKAGRLWIDAYVKKVGELAGVAKAVRALVKKTAA
Ga0126375_1181700823300012948Tropical Forest SoilMPTIEGKQAEVWIDGYVKKAGKLERVTKAVRALVKKTVKED
Ga0126369_1143054623300012971Tropical Forest SoilMPTIEGKDGRLWIDAYVKKAGNLEAVAKAVRALVKKTAPA
Ga0126369_1207856223300012971Tropical Forest SoilMPTIEGKQAAVWIDAYVKKAGKLEAVAKAVRALLKGTVKGGEEYVSP*
Ga0164304_1173042823300012986SoilMPTIEGKQARVWIDAYVKKAGKLAGVTKAVRALVKKT
Ga0157372_1143500013300013307Corn RhizosphereMPTIEGKEARVWIDNYVKGAGELEKIAKAVRALVTKTVKG
Ga0134079_1039454823300014166Grasslands SoilMPTIEGKEGRLWIDAYVKKAGEFSGVMKAVRALVKKTAADCEEYVS
Ga0137411_129915223300015052Vadose Zone SoilMPTIEGKEGRAWIDEYVEKAGKQKGVVKGLRALVKKTLGEARSM*
Ga0137418_1039341623300015241Vadose Zone SoilMPTIEGKEGRLWIDAYVRKAGRFSGVMKAVRALVK
Ga0137403_1092577823300015264Vadose Zone SoilMPTVEGREARVWIDEYVNKAGKLSGVAKMVRALVKK
Ga0182036_1005873043300016270SoilMPTVEGKEARVWIDEYVRNAGKLSGVAKAVRALVKK
Ga0182036_1080933313300016270SoilMPTIEGKQAGVWIDGYVKKSGKLEGVTKAVRALVKKTVKGSEGT
Ga0182032_1004534043300016357SoilMPTIAGKQAKVWIDGYVKKAGKLESVTKAVRALMKKTVKR
Ga0182032_1055137723300016357SoilMPTIEGKQAGVWIDGYVKKAGKLEGVTKVVRALVK
Ga0182034_1035188323300016371SoilMPTIEGTDGRLWIDAYVRGAGKLEQVAKSVSALVMKT
Ga0187778_1018223733300017961Tropical PeatlandMPTIEGKPAQVWIDAYVKKAGKLEGVAKAVRALVKKTVRGSE
Ga0066667_1165512123300018433Grasslands SoilVPTIEGKAGKLWIDAYVKKAGKVAGVAKAVRTLVKKTAAGCEEYVSPWKTP
Ga0066669_1016919233300018482Grasslands SoilMPTVEGREARVWIDEYVNKAGKLSGVAKMVRALVKKAVAGCE
Ga0066669_1068089023300018482Grasslands SoilMPTIEGKEGRLWIDAYVKKAGEFSGVMKAVRALVKKTAADCEEYVSPWK
Ga0210401_1153527223300020583SoilMPTIEGKEGRAWIDEYVAKAGKQKGVVKGLRSLVKRTL
Ga0210388_1059735223300021181SoilVPTIEGKAGRLWIDAYVKKAGKLRGVAKSVRALVKKTAAGCEEYVSAW
Ga0210397_1125837923300021403SoilMPTVEGREARVWIDEYVKKAGKLSGVAKTLRTLVKKTVAGCE
Ga0210386_1125140323300021406SoilMPTIEGKEGRAWIDEYVAKAGKQRDVVKSLRALVKKTIAGCEEYV
Ga0210383_1107167513300021407SoilMPTVEGREARVWIDEYVKKAGKLSGVAKTVRAFVKKAVAGCEEYV
Ga0210394_1164563723300021420SoilMPTIEGKEGRAWIDKYVAKAGKQKDVVKGLRSLVKRTLAGC
Ga0210402_1166690823300021478SoilMPTIEGKDSGIWINDYVNKAGEFAGVIRAVRALLKK
Ga0210409_1062027313300021559SoilMPTIEGKAGRAWIDEYVEKAGKQKDVVKGLRALVKRTLAGCEEYVNPWKIP
Ga0126371_1017705713300021560Tropical Forest SoilMPTIEGKEGRLWIDAYVKKAGKLASVARAVRTLVKKTA
Ga0247667_105377113300024290SoilMPTIEGKAGKLWIDAYVKTAGKLVGVTKAVRVLVKKTAAGC
Ga0179591_102548753300024347Vadose Zone SoilMPTIEGKEGRAWIDEYVEKAGKQKGVVKGLRALVKKTLGEARSM
Ga0207654_1113605613300025911Corn RhizosphereMPTVEGKEARVWIDKYVNKAGKVPGVAKAVRALVKKTVAGCQEYVNP
Ga0207693_1134664713300025915Corn, Switchgrass And Miscanthus RhizosphereMPTIEGKDGRLWIDAYVRGAGKLEQVAKSVRALVMKT
Ga0207659_1191490423300025926Miscanthus RhizosphereMPTIEGKEAGIWINDYVRKAGEFEGVAKAVRALMKNTVKG
Ga0209802_121558623300026328SoilMPTIEGKEGRLWIDAYVRKAGRFSGVMKAVRALVKKTAAD
Ga0207742_11436323300026800Tropical Forest SoilMPTIEGKPAKVWIDAYVKKAGKLEGVSKAIRGLLKRT
Ga0207728_11820223300026833Tropical Forest SoilMPTIEGKQATIWIADYVSKAGEFEGVAKAVRALVKK
Ga0207835_102768713300026953Tropical Forest SoilMPTVEGKEARVWVNEYIKKAGKLSGVAKAVRALVKKTVAGCEEYVNPWKIP
Ga0207824_102127323300026990Tropical Forest SoilMPTIEGKQATIWIADYVSKAGEFEGVAKAVRALVKKS
Ga0207506_101388313300027460SoilMPTIEGKQAQVWIDAYVKKAGKLEGVTKAVRALVKKTLK
Ga0209073_1051748823300027765Agricultural SoilMPTIEGKDGRLWIDAYVNKAGKLAGVAKAVRTLVKKTAAGCEEYVSP
Ga0209579_1041060413300027869Surface SoilMPTIEGKEGKLWIDAYVKKAGELAGVAKTVRALVKKTA
Ga0209068_1063676423300027894WatershedsMPTIEGKAGRLWIDAYVKKAGKLAGVAKSVRALVKKTAAGCEEY
Ga0209583_1038287823300027910WatershedsMPTIEGKEGRLWIDAYVKKAGRFSGVMKAVRALVKKTAADCEEYVS
Ga0247663_103682113300028145SoilMPTVEGKEARVWIDEYVKKAGKLSGVAKMVRALVK
Ga0265338_1014722613300028800RhizosphereMPTIEGKDAKNWIDDYVKSAGEHEGVAKAVRALVKKAVKG
Ga0222749_1078325323300029636SoilMPTIEGKQGRLWINVYVKKAGKFSGVMKAVRALVKKTAADCEE
Ga0170824_10687278113300031231Forest SoilMPTIEGKEGRAWIDEYVAKAGKMQGVLKGLRALVKKTIAGCEEY
Ga0318528_1045068513300031561SoilMPTIEGKQAGIWISDYVKKAGKSEGVAKAVRALVKKEV
Ga0318561_1032636213300031679SoilMPTIEGKEARVWIDEYVKKAGRLSGVAKAVRALVKKSVG
Ga0306917_1008776243300031719SoilMPTVEGKEARVWIDEYVRNAGKLSGVAKAVRALVKKTV
Ga0306917_1116539413300031719SoilMPTIEGKKGRLWIDAYVKKAGKLASVARAARTLVKKTAAGCEEYV
Ga0306918_1013172833300031744SoilMPTVEGKEARVWIDEYVRNAGKLSGVAKAVRALVK
Ga0306919_1021965713300031879SoilMPTVEGKEARVWIDEYVRNAGKLSGVAKAVRALVKKTVAGCEEYVN
Ga0318522_1034927913300031894SoilMPTVEGKEARVWIDEYVRNAGKLSGVAKAVRALVKKTVAGCEEYVNP
Ga0318551_1045595923300031896SoilMPTIEGKEARVWIDEYVKKAGRLSGVAKAVRALVKKSVGECEE
Ga0310916_1037727613300031942SoilMPTIEGKQAGVWIDTYVKKAGKLGGVTKAVRVLVKKTVRGGEEYV
Ga0310913_1027794923300031945SoilMPTIEGKEGRLWIDAYVKKAGKLASVARAVRTLVKKTAAGCEE
Ga0306926_1067871813300031954SoilMPTVEGKEARVWIDEYVRNAGKLSGVAKAVRALVKKTVAGCE
Ga0307479_1004741113300031962Hardwood Forest SoilMPTIEGREGRVWIDAYVKKAGKLAGVARAVRGLVKKTAAGCEEYVS
Ga0306922_1197281613300032001SoilMPTIEGKQAGVWINAYVKKAGKFEGVAKAVRALVKKTLKG
Ga0310911_1024163013300032035SoilMPTIEGKQAGVWIDTYVKKAGKLGGVTKAVRVLVKKTV
Ga0306924_1026052513300032076SoilMPTVEGKEARVWIDEYVRNAGKLSGVAKAVRALVKKT
Ga0306924_1044555613300032076SoilMPTIEGKQAGVWIDTYVKKAGKLGGVTKAVRVLVKKTVKGGEEYV
Ga0307470_1031299933300032174Hardwood Forest SoilMPTVEGKEARVWIDKYVNKAGKMPGVAKAVRAFVKKTVAGCQ
Ga0307471_10191569113300032180Hardwood Forest SoilMPTIEGKEGRLWIDAYVNKAGKFSGVMKAVRALVKKTAADCEEYVSPWKTPAF
Ga0307472_10082229713300032205Hardwood Forest SoilMPTIEGKKGRLWIDAYVRKAGRFSGVMKAVRALVKKTAADCEE
Ga0306920_10028667533300032261SoilMPTVEGKEARVWIDEYVRNAGKLSGVAKAVRALVKKTVAG
Ga0306920_10043771013300032261SoilMPTIEGKEGRLWIDAYVKKAGKLAGIARAVRTLVKKTA
Ga0306920_10167366813300032261SoilMPTIEGKQAKVWIDGYVQKAGKLESVTKAVRALMKKTIKGV
Ga0335079_1223811213300032783SoilMPTIEGKQAEIWIADYVKKAEKFEAVTKALRALMKKAVKGVEEY
Ga0335078_1156750213300032805SoilMEGGGSMPTIEGKDAKVWIDAYVSEAGKLAPVAKAVRALVKKA
Ga0335078_1271776223300032805SoilMPTIEGKEGKLWIDAYVKKAGKFSGVMKAVRALVKETADGCEEYVS
Ga0335069_1094991523300032893SoilMPTMEGKEGKLWIDAYVKNAGTFSGVMKAVRALVKETAAGCEEYVSPWK
Ga0335071_1185030313300032897SoilMPTIEGKQAGIWIADYVNKAGKLEGVAQAVRTLVKKSVKG
Ga0335076_1034114413300032955SoilMPTMEGKEGKLWIDAYVKNAGTLSGVMKAVRALVKETAA
Ga0335084_1033755413300033004SoilMPTIEGKEGRLWIDAYVKKAGKLAGVAKAIRALVKKTAAG
Ga0310914_1010809513300033289SoilMPTIEGKEARVWIDEYLKKAGKLSRVAKVVRALVKKTVTGCEEYVN
Ga0310914_1038481233300033289SoilMPTVEGKEASVWVDEYVKKAGNLSGVAKAVRALVKKTVAGCEEYVNPWKIP
Ga0318519_1081431213300033290SoilMPTIEGTDGRLWIDAYVRGAGKLEQVAKSVRALVMKTAMGCEEY
Ga0310810_1125193013300033412SoilMPTIEGKEGRLWIDAYVKKAGKLAGLARAVRTLVKKTAAG
Ga0316624_1227244123300033486SoilMPTIEGKEGRLWIDGYVKKAGKLAGVARAVRALVKKTAAGCE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.