| Basic Information | |
|---|---|
| Family ID | F082978 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 46 residues |
| Representative Sequence | FVKYTLSPAGLAQYKAGGFTLIPPTVTGSASSVPAAISSELGG |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 89.38 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.602 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (13.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.204 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.177 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.72% β-sheet: 2.82% Coil/Unstructured: 77.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 33.63 |
| PF00005 | ABC_tran | 9.73 |
| PF01381 | HTH_3 | 0.88 |
| PF07690 | MFS_1 | 0.88 |
| PF03061 | 4HBT | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.60 % |
| Unclassified | root | N/A | 35.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003368|JGI26340J50214_10062713 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300003368|JGI26340J50214_10062727 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005537|Ga0070730_10207875 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300005602|Ga0070762_10256740 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300005610|Ga0070763_10658580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Alicyclobacillaceae → Alicyclobacillus → Alicyclobacillus contaminans | 611 | Open in IMG/M |
| 3300005712|Ga0070764_10859030 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005952|Ga0080026_10040946 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005995|Ga0066790_10338677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300006176|Ga0070765_100632693 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300006893|Ga0073928_11134190 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009672|Ga0116215_1296684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
| 3300009698|Ga0116216_10064364 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300009698|Ga0116216_10255629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1070 | Open in IMG/M |
| 3300009698|Ga0116216_10806445 | Not Available | 563 | Open in IMG/M |
| 3300010048|Ga0126373_12703959 | Not Available | 554 | Open in IMG/M |
| 3300010343|Ga0074044_10469200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 823 | Open in IMG/M |
| 3300010343|Ga0074044_11015047 | Not Available | 544 | Open in IMG/M |
| 3300010360|Ga0126372_12017452 | Not Available | 624 | Open in IMG/M |
| 3300010376|Ga0126381_105138483 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010379|Ga0136449_100641022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1799 | Open in IMG/M |
| 3300010379|Ga0136449_103147275 | Not Available | 639 | Open in IMG/M |
| 3300010379|Ga0136449_104205381 | Not Available | 534 | Open in IMG/M |
| 3300010867|Ga0126347_1461046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum | 1924 | Open in IMG/M |
| 3300010876|Ga0126361_10828537 | Not Available | 511 | Open in IMG/M |
| 3300012361|Ga0137360_11354540 | Not Available | 614 | Open in IMG/M |
| 3300014493|Ga0182016_10796117 | Not Available | 526 | Open in IMG/M |
| 3300014501|Ga0182024_12611568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300015206|Ga0167644_1096226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 892 | Open in IMG/M |
| 3300017822|Ga0187802_10254990 | Not Available | 679 | Open in IMG/M |
| 3300017924|Ga0187820_1192889 | Not Available | 632 | Open in IMG/M |
| 3300017928|Ga0187806_1015848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. SM1 | 2144 | Open in IMG/M |
| 3300017928|Ga0187806_1031561 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300017928|Ga0187806_1147599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
| 3300017928|Ga0187806_1277930 | Not Available | 585 | Open in IMG/M |
| 3300017932|Ga0187814_10283761 | Not Available | 631 | Open in IMG/M |
| 3300017932|Ga0187814_10330486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
| 3300017937|Ga0187809_10371858 | Not Available | 540 | Open in IMG/M |
| 3300017942|Ga0187808_10370578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
| 3300017943|Ga0187819_10403908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 785 | Open in IMG/M |
| 3300017955|Ga0187817_10262779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1099 | Open in IMG/M |
| 3300017961|Ga0187778_11055229 | Not Available | 564 | Open in IMG/M |
| 3300017972|Ga0187781_11112075 | Not Available | 580 | Open in IMG/M |
| 3300018001|Ga0187815_10168702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 926 | Open in IMG/M |
| 3300018006|Ga0187804_10161036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 948 | Open in IMG/M |
| 3300018007|Ga0187805_10227479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 854 | Open in IMG/M |
| 3300018033|Ga0187867_10080932 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300018033|Ga0187867_10125355 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300018037|Ga0187883_10164562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1140 | Open in IMG/M |
| 3300018040|Ga0187862_10098390 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300018044|Ga0187890_10200108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
| 3300018058|Ga0187766_10324927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1002 | Open in IMG/M |
| 3300018058|Ga0187766_11180660 | Not Available | 553 | Open in IMG/M |
| 3300018060|Ga0187765_10471674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 789 | Open in IMG/M |
| 3300018085|Ga0187772_10160650 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300018085|Ga0187772_10745313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 704 | Open in IMG/M |
| 3300018085|Ga0187772_11342235 | Not Available | 530 | Open in IMG/M |
| 3300018086|Ga0187769_11278305 | Not Available | 555 | Open in IMG/M |
| 3300019887|Ga0193729_1122225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 969 | Open in IMG/M |
| 3300021181|Ga0210388_11233412 | Not Available | 633 | Open in IMG/M |
| 3300021401|Ga0210393_10122308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2081 | Open in IMG/M |
| 3300021403|Ga0210397_11400777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
| 3300021404|Ga0210389_10657083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 822 | Open in IMG/M |
| 3300021405|Ga0210387_10573146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1003 | Open in IMG/M |
| 3300021407|Ga0210383_11158119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
| 3300021420|Ga0210394_10577067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 989 | Open in IMG/M |
| 3300021433|Ga0210391_11237935 | Not Available | 577 | Open in IMG/M |
| 3300021474|Ga0210390_11207530 | Not Available | 610 | Open in IMG/M |
| 3300024176|Ga0224565_1046276 | Not Available | 510 | Open in IMG/M |
| 3300027504|Ga0209114_1035850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 847 | Open in IMG/M |
| 3300027517|Ga0209113_1039942 | Not Available | 670 | Open in IMG/M |
| 3300027817|Ga0209112_10178226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 723 | Open in IMG/M |
| 3300027817|Ga0209112_10227631 | Not Available | 647 | Open in IMG/M |
| 3300027824|Ga0209040_10224616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 958 | Open in IMG/M |
| 3300027824|Ga0209040_10224650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 958 | Open in IMG/M |
| 3300027829|Ga0209773_10254717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300027855|Ga0209693_10160326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1110 | Open in IMG/M |
| 3300027895|Ga0209624_10678433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300027908|Ga0209006_10468307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1054 | Open in IMG/M |
| 3300028742|Ga0302220_10375238 | Not Available | 512 | Open in IMG/M |
| 3300028765|Ga0302198_10523158 | Not Available | 528 | Open in IMG/M |
| 3300028879|Ga0302229_10400207 | Not Available | 611 | Open in IMG/M |
| 3300028879|Ga0302229_10549344 | Not Available | 509 | Open in IMG/M |
| 3300028906|Ga0308309_10637004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 926 | Open in IMG/M |
| 3300029910|Ga0311369_11226232 | Not Available | 578 | Open in IMG/M |
| 3300029951|Ga0311371_10326484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2142 | Open in IMG/M |
| 3300029951|Ga0311371_11165608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 895 | Open in IMG/M |
| 3300029951|Ga0311371_12013018 | Not Available | 612 | Open in IMG/M |
| 3300030056|Ga0302181_10470296 | Not Available | 533 | Open in IMG/M |
| 3300030399|Ga0311353_11468701 | Not Available | 553 | Open in IMG/M |
| 3300030503|Ga0311370_12028940 | Not Available | 573 | Open in IMG/M |
| 3300030524|Ga0311357_10982125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 744 | Open in IMG/M |
| 3300030575|Ga0210288_1228473 | Not Available | 535 | Open in IMG/M |
| 3300030617|Ga0311356_10069539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3727 | Open in IMG/M |
| 3300030730|Ga0307482_1069172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 905 | Open in IMG/M |
| 3300030739|Ga0302311_10781459 | Not Available | 623 | Open in IMG/M |
| 3300030740|Ga0265460_12991222 | Not Available | 508 | Open in IMG/M |
| 3300030815|Ga0265746_1027937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 715 | Open in IMG/M |
| 3300031234|Ga0302325_10072468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6652 | Open in IMG/M |
| 3300031525|Ga0302326_11993733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 750 | Open in IMG/M |
| 3300031708|Ga0310686_119783193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 819 | Open in IMG/M |
| 3300031715|Ga0307476_10224402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1368 | Open in IMG/M |
| 3300031879|Ga0306919_11340268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300031912|Ga0306921_11996291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300032059|Ga0318533_11304090 | Not Available | 531 | Open in IMG/M |
| 3300032089|Ga0318525_10636975 | Not Available | 543 | Open in IMG/M |
| 3300032160|Ga0311301_10052643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9236 | Open in IMG/M |
| 3300032896|Ga0335075_10137829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3081 | Open in IMG/M |
| 3300032896|Ga0335075_10515404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
| 3300032898|Ga0335072_10190160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2450 | Open in IMG/M |
| 3300032898|Ga0335072_11182659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300033158|Ga0335077_10054869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4830 | Open in IMG/M |
| 3300034199|Ga0370514_071845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 876 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 13.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.77% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.77% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.89% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030575 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26340J50214_100627132 | 3300003368 | Bog Forest Soil | KPTDAGVAFVKYTLSPAGLALYKAGGFTVLTPTVTGSTSSVPAAISSELGG* |
| JGI26340J50214_100627272 | 3300003368 | Bog Forest Soil | KPTDAGVAFVKYTLSPAGLALYKAGGFTVLTPTIIGSTSSVPAAISSELGG* |
| Ga0070730_102078753 | 3300005537 | Surface Soil | ISFVQYTLSRAGLAQYKAGGFTLLTPTVTGSASSVPSAISSELGG* |
| Ga0070762_102567401 | 3300005602 | Soil | YTLSPAGLAQYKAGGFKLITPTVVGDKSAVPSAVLSELGS* |
| Ga0070763_106585802 | 3300005610 | Soil | TSPGNAFIKYTLSPAGLAQYKQGGFTVLTPTVFGDKSAVPAAIQSELGS* |
| Ga0070764_108590302 | 3300005712 | Soil | IAFVKYTLSAAGLAEYKAGGFTLVPPKVTGSASAVPAAISSELGG* |
| Ga0080026_100409461 | 3300005952 | Permafrost Soil | AAIAFVKYTLSPAGLAQYKAGGFTLIPTAVTGSASSVPSAISSELGG* |
| Ga0066790_103386772 | 3300005995 | Soil | TPAAIAFVKYTLSQAGLAQYKTGGFTLLKPTITGTGVPAAISSELGG* |
| Ga0070765_1006326932 | 3300006176 | Soil | PTPAAIAFVKYTLSAAGLAQYKAGGFTLPTPTITGSASSVPTEISSELGG* |
| Ga0073928_111341902 | 3300006893 | Iron-Sulfur Acid Spring | AFVKYTLSPAGLAQYKQGGFTVLTPAVTGSTSSVPSAISSELGG* |
| Ga0116215_12966842 | 3300009672 | Peatlands Soil | AGLALYKAGGFTVLTPTITGSTSSVPSAISSELGG* |
| Ga0116216_100643644 | 3300009698 | Peatlands Soil | FVKYTLSPAGLAQYKQGGFSLPTPTVFGTASAVPSEISSELGG* |
| Ga0116216_102556292 | 3300009698 | Peatlands Soil | FVKYTLSPAGLAQYKQGGFSLPTPTVFGTASAVPAEITSELGG* |
| Ga0116216_108064452 | 3300009698 | Peatlands Soil | GKPTDAGVAFVKYTLSPAGLALYKAGGFTVLTPTITGSTSSVPSAISSELGG* |
| Ga0126373_127039591 | 3300010048 | Tropical Forest Soil | TAFVKFTLSPAGLALYKAGGYALIKPTVSGTTSAVPAAISSELG* |
| Ga0074044_104692001 | 3300010343 | Bog Forest Soil | AFVKYTLSPAGLALYKQGGFKVLTPTVFGTTSAVPSAISSELGS* |
| Ga0074044_110150472 | 3300010343 | Bog Forest Soil | VAFVKYTLSPAGLALYKAGGFTVLTPTIIGSTSSVPAAISSELGG* |
| Ga0126372_120174522 | 3300010360 | Tropical Forest Soil | SQAALAFVKYTLSKAGLTLYKAGGFSLPPLTATGTTTAIPAAISSELGT* |
| Ga0126381_1051384832 | 3300010376 | Tropical Forest Soil | PSSAREAYVKYVLSPAGLALYKKGGYTVLKPTAFGTSSAIPSSIRSELG* |
| Ga0136449_1006410221 | 3300010379 | Peatlands Soil | TDAGVAFVKYTLSPAGLALYKAGGFTVLTPTITGSTSSVPAAISSELGG* |
| Ga0136449_1031472752 | 3300010379 | Peatlands Soil | IAFVKYTLSAAGLAQYKQGGFTLPTPTIVGSTSAVPAEISSELGG* |
| Ga0136449_1042053812 | 3300010379 | Peatlands Soil | IGKPTDAGVAFVKYTLSPAGLALYKAGGFTVLTPTLTGSTSSVPAAISSELGG* |
| Ga0126347_14610461 | 3300010867 | Boreal Forest Soil | IIGKPTPAAIAFVKYTLSPAGLAQYKTGGFTLLTPAVTGSSSAVPAAISSELGG* |
| Ga0126361_108285372 | 3300010876 | Boreal Forest Soil | IGTPTPAAIAFVKYTLSAAGLAQYKAGGFTLPTPTIVGTASSVPTEISSELGG* |
| Ga0137360_113545402 | 3300012361 | Vadose Zone Soil | PTPAAIAFVKYVLSPAGLAVYKQGGYTLLKPTLTGSGAPSAVTGELGG* |
| Ga0182016_107961172 | 3300014493 | Bog | TPAGIAFIKYTLSAAGLAEYKAGGFSLITPKVVGDASAVPADIASELGS* |
| Ga0182024_126115681 | 3300014501 | Permafrost | KYTLSPAGLAQYKQGGFTLITPTVTGDSSAVPSAVTSELGG* |
| Ga0167644_10962261 | 3300015206 | Glacier Forefield Soil | GTPTPAGNAFIAYTLSPAGLAQYKAGGFKLITPTVVGDKSAVPSAVLSELGS* |
| Ga0187802_102549902 | 3300017822 | Freshwater Sediment | FVKYTLSPAGLAQYKQGGFSLPTPTVFGTASAVPSEISSELGG |
| Ga0187820_11928892 | 3300017924 | Freshwater Sediment | SPAGLALYKQGGFTVLTPTVTGDASAVPSAISSELGT |
| Ga0187806_10158481 | 3300017928 | Freshwater Sediment | PAGLAQYKQGGFSLPTPTVFGTASAVPAEISSELGG |
| Ga0187806_10315611 | 3300017928 | Freshwater Sediment | IIGTPTPAGIAFVKYTLSPAGLALYKQGGFSLPPPTVFGTASAVPSEISSELGG |
| Ga0187806_11475991 | 3300017928 | Freshwater Sediment | PTDPGIAFDKYTLSPAGLNLYKQGGFTVLTPTVTGNASAVPSAISSELGT |
| Ga0187806_12779301 | 3300017928 | Freshwater Sediment | TPAGEAFVAYTLSQEGLAQYKAGGFSMITPTVVGDKSAVPAAILSELGS |
| Ga0187814_102837611 | 3300017932 | Freshwater Sediment | TIGKPSNAGTAFVKYTLSPAGLAQYKAGGFTLIKPTAFGTTGAIPSAISSELG |
| Ga0187814_103304862 | 3300017932 | Freshwater Sediment | LSSTGLAQYKQGGFTVLTPTLFGSKSDVPASIASELGT |
| Ga0187809_103718582 | 3300017937 | Freshwater Sediment | IAFVKYTLSAAGLAQYKQGGFTLPTPTIVGSASAVPSEISSELGG |
| Ga0187808_103705782 | 3300017942 | Freshwater Sediment | MDITTIGKADPAAIEFVKYTLSKAGQAQYKQGGFTLLTPTGYGTGIPAAIQSELGS |
| Ga0187819_104039082 | 3300017943 | Freshwater Sediment | TPAGIAFVKYALSPAGLALYKQGGFSLPPPTVFGTASAVPSEISSELGG |
| Ga0187817_102627793 | 3300017955 | Freshwater Sediment | VKYTLSPAGLALYKQGGFSLPPPTVFGTASAVPAEISSELGG |
| Ga0187778_110552291 | 3300017961 | Tropical Peatland | PAGLTLYKQGGFTVLTPTVTGDMSAVPSAISSELGS |
| Ga0187781_111120751 | 3300017972 | Tropical Peatland | PTPAGISFVKYTLSPTGLAQYKAGGFSLPTPTVFGSAGSVPSEISSELGT |
| Ga0187815_101687022 | 3300018001 | Freshwater Sediment | GIAFVKYTLSPAGLAQYKQGGFSLPTPTVFGTASAVPAEISSELGG |
| Ga0187804_101610362 | 3300018006 | Freshwater Sediment | AEAFVAYTLSPAGVAQYKAGGFTILKPQLFGSMSDVPAPIASELGS |
| Ga0187805_102274791 | 3300018007 | Freshwater Sediment | PAAIAFVKYTLSAAGLAQYKQGGFTLPTPTIVGSASAVPSEISSELGG |
| Ga0187867_100809321 | 3300018033 | Peatland | GTPTPAGIAFVKYTLSPTGLAQYKAGGFTVLTPTVFGDSSAVPVAIKSELGG |
| Ga0187867_101253553 | 3300018033 | Peatland | GTPTPAGIAFVKYTLSPTGLAQYKAGGFTVLTPTVFGDSSAVPAAIKSELGG |
| Ga0187883_101645622 | 3300018037 | Peatland | AGLAQYKQGGFTLITPTVTGDASAVPSAVKSELGG |
| Ga0187862_100983901 | 3300018040 | Peatland | TTIGTPTAAGTAFIKYTLSSAGLAQYKQGGFTLITPTVFGDSSAVPAAIKSELGG |
| Ga0187890_102001081 | 3300018044 | Peatland | TLSPAGLAQYKAGGFKLITPTVVGDKSAVPADILSELGS |
| Ga0187766_103249272 | 3300018058 | Tropical Peatland | FVKYTLSAAGLAQYKQGGFTLPTPTIVGSASAVPSQISSELGS |
| Ga0187766_111806601 | 3300018058 | Tropical Peatland | AGVAQYKAGGFMILTPTLFGPKSAVPSAVASELGG |
| Ga0187765_104716742 | 3300018060 | Tropical Peatland | IAFVKYTLSSAGLAQYKTGGFTLITPTVVGDSSAVPAAVRSELGG |
| Ga0187772_101606503 | 3300018085 | Tropical Peatland | AFVKYTLSPAGLTLYKQGGFTVLTPTVTGDASAVPSAISSELGS |
| Ga0187772_107453131 | 3300018085 | Tropical Peatland | GISFVKYTLSPTGLAQYKAGGFSLPTPTVFGSAGSVPSEISSELGT |
| Ga0187772_113422352 | 3300018085 | Tropical Peatland | SPAGLAQYKAGGFTVLTPTVIGTASAVPAAISSELGT |
| Ga0187769_112783052 | 3300018086 | Tropical Peatland | FTLSPAGMAIYKAGGFTVLTPTLFGTKSDVPSAVASELGG |
| Ga0193729_11222252 | 3300019887 | Soil | SAGLAQYKQGGFTLVTPTVTGDSSAVPSAVKSELGG |
| Ga0210388_112334121 | 3300021181 | Soil | FIAYTLSPAGLAQYKAGGFTLLTPTVVGDKTAVPAAVASELPSS |
| Ga0210393_101223081 | 3300021401 | Soil | TLSAAGLAQYKAGGFTLPTPTITGSASSVPTEISSELGG |
| Ga0210397_114007772 | 3300021403 | Soil | AGTAFVKYTLSPAGLAQYKQGGFTLITPTVTGDASAVPSAVTSELGG |
| Ga0210389_106570831 | 3300021404 | Soil | PTPAAIAFVKYTLSQAGLAQYKTGGFTLLAPAASGTTSAIPTAISSELGG |
| Ga0210387_105731461 | 3300021405 | Soil | KYTLYPAGLAQYKQGGFTLITPTVTGDASAVPSAVTSELGG |
| Ga0210383_111581191 | 3300021407 | Soil | VKYTLSPAGLAQYKQGGFTLITPTVTGDASAVPSAVTSELGG |
| Ga0210394_105770671 | 3300021420 | Soil | TAFVKYTLSPAGLALYKQGGFKVLTPTVFGTASTVPSAISSELGS |
| Ga0210391_112379351 | 3300021433 | Soil | KPTPAAIAFVKYTLSPAGLALYKTGGFRLATPVVTGDSSAIPAAIKSELGS |
| Ga0210390_112075302 | 3300021474 | Soil | YTLSPAGLAQYKQGGFTVLTPTLFGSKSDVPASVASELGS |
| Ga0224565_10462761 | 3300024176 | Plant Litter | TAFVKYTLSPAGLAQYKQGGFKVLTPTVFGTASSVPSAISSELGS |
| Ga0209114_10358502 | 3300027504 | Forest Soil | LSPAGLAQYKKGGFTLITPTVFGDKSAVPAAIQSELGS |
| Ga0209113_10399421 | 3300027517 | Forest Soil | TAFIKYTLSPAGLAQYKQGGFTVLTPTVFGDKTAVPAAIQSELGS |
| Ga0209112_101782261 | 3300027817 | Forest Soil | PPAAIAFVKYTLSPAGLAEYKTGGFSLPKVTVFGTASAVPSAISSELGS |
| Ga0209112_102276312 | 3300027817 | Forest Soil | ITSIGTPTAAGTAFIKYTLSPAGLAQYKKGGFTLITPTVFGDKSAVPAAIQSELGS |
| Ga0209040_102246161 | 3300027824 | Bog Forest Soil | KPTDAGVAFVKYTLSPAGLALYKAGGFTVLTPTVTGSTSSVPAAISSELGG |
| Ga0209040_102246502 | 3300027824 | Bog Forest Soil | KPTDAGVAFVKYTLSPAGLALYKAGGFTVLTPTIIGSTSSVPAAISSELGG |
| Ga0209773_102547171 | 3300027829 | Bog Forest Soil | AKYTLSPTGLALYKAGGFTLFPLTVTGDASAIPAAVKSELGG |
| Ga0209693_101603261 | 3300027855 | Soil | PTPAGTAFIQYTLSPTGLAQYKAGGFTLITPTVVGDKSAVPSAVLSELGS |
| Ga0209624_106784331 | 3300027895 | Forest Soil | SPTGLAQYKAGGFKLITPTVVGDKSAVPAAVLSELGS |
| Ga0209006_104683072 | 3300027908 | Forest Soil | TAFVKYTLSPAGLTLYKTGGFTVLTPTVVGDKSAVPAAITSELGT |
| Ga0302220_103752382 | 3300028742 | Palsa | TAIGTPTPAAIAFIKYTLSPAGLAQYKAGGFKLITPTVVGDKSAVPADILSELGS |
| Ga0302198_105231582 | 3300028765 | Bog | PTPAGIAFVKYTLSPTGLAQYKAGGFTVLTPTVFGDSSAVPVAIKSELGG |
| Ga0302229_104002071 | 3300028879 | Palsa | TIGTPTPAGIAFIKYTLSPTGLAQYKAGGFKLITPTVVGDKSAVPADILSELGS |
| Ga0302229_105493441 | 3300028879 | Palsa | AFVKYTLSAAGLAQYKAGGFTLITPTVVGTGAPSAITSELGS |
| Ga0308309_106370041 | 3300028906 | Soil | AAIAFVKYTLSPAGLALYKTGGFTVLTPTVVGDKSAVPAAITSELGT |
| Ga0311369_112262321 | 3300029910 | Palsa | LSPTGLAQYKAGGFKLITPTVVGDKTAVPADILSELGS |
| Ga0311371_103264843 | 3300029951 | Palsa | TIGTPTPAAIAFIKYTLSPAGLAQYKAGGFKLITPTVVGDKSAVPADILSELGS |
| Ga0311371_111656082 | 3300029951 | Palsa | GKPTPAAIAFVKYTLSKAGLAEYKAGGFALFTPAATGTGVPAGVQSELGG |
| Ga0311371_120130182 | 3300029951 | Palsa | GIAFIKYTLSPTGLAQYKAGGFKLITPTVVGDKTAVPADILSELGS |
| Ga0302181_104702961 | 3300030056 | Palsa | IIGKPTPAAIAFVKYTLSKAGLAEYKAGGFALFTPAATGTGVPAGVQSELGG |
| Ga0311353_114687011 | 3300030399 | Palsa | ITTIGKPTSAAIAFIKYTLSSTGMAQYKQGGFALLKPTLYGPASAVPAAIRSELGS |
| Ga0311370_120289402 | 3300030503 | Palsa | IKYTLSPAGLAQYKAGGFKLITPTVVGDKSAVPADILSELGS |
| Ga0311357_109821251 | 3300030524 | Palsa | SPAGLAQYKAGGFTLIPPTVTGSASSVPAAISSELGG |
| Ga0210288_12284732 | 3300030575 | Soil | QIGTPTPAGTAFIAYTLSPAGLAQYKAGGFKLITPTVVGDKSSVPSAILSELGS |
| Ga0311356_100695391 | 3300030617 | Palsa | FIAYTLSPAGLAQYKAGGFQLITPTVVGDKSSVPAAILSELGS |
| Ga0307482_10691721 | 3300030730 | Hardwood Forest Soil | PTPAAIAFIKYTLSPAGLAQYKAGGFTTITPTLTGSKSDVPSDIASELGA |
| Ga0302311_107814592 | 3300030739 | Palsa | IGTPTPAAIAFIKYTLSPAGLAQYKAGGFKLITPTVVGDKSAVPADILSELGS |
| Ga0265460_129912221 | 3300030740 | Soil | TPTPAGTAFIAYTLSPAGLAQYKAGGFKLITPTVVGDKSSVPSAILSELGS |
| Ga0265746_10279372 | 3300030815 | Soil | SAPGLALYKQGGFTVLTPTLFGSKSDVPASIASELGT |
| Ga0302325_1007246810 | 3300031234 | Palsa | FVKYTLSPAGLAQYKAGGFTLIPPTVTGSASSVPAAISSELGG |
| Ga0302326_119937332 | 3300031525 | Palsa | GTPTPAAIAFVKYTLSPAGLAQYKAGGFTLIPPTVTGSASSVPAAISSELGG |
| Ga0310686_1197831932 | 3300031708 | Soil | AGLAQYKQGGFSLPTPTVFGTASAVPSEISSELGT |
| Ga0307476_102244021 | 3300031715 | Hardwood Forest Soil | YTLSPAGLALYKQGGFSLPTPTVFGTASAVPSEISSELGT |
| Ga0306919_113402681 | 3300031879 | Soil | VKYTLSAAGMALYKAGGFTMITPKLTGSMSDVPADIASELGG |
| Ga0306921_119962911 | 3300031912 | Soil | YTLSPTGLAQYKEGGFSLPTRQVFGSASSVPSEISSELGT |
| Ga0306926_125255591 | 3300031954 | Soil | PAGLALYKAGGFTLIKPTVSGTTSAVPSSISSELG |
| Ga0318533_113040901 | 3300032059 | Soil | IAPPSSAGTAYVKYVLSPAGLALYKKGGYIVLKPTAFGTTSAVPSSISSELG |
| Ga0318525_106369751 | 3300032089 | Soil | IIGTPTPAAIAFVKYTLSAAGMALYKAGGFTMITPKLTGSMSDVPADIASELGG |
| Ga0311301_1005264313 | 3300032160 | Peatlands Soil | TDAGVAFVKYTLSPAGLALYKAGGFTVLTPTITGSTSSVPAAISSELGG |
| Ga0335075_101378294 | 3300032896 | Soil | TDAGTAFIAYTLSPAGLAQYKAGGFTLITPTVVGDKTAVPSAITSELGS |
| Ga0335075_105154041 | 3300032896 | Soil | TDAGTAFIAYTLSPAGLAQYKAGGFTLITPTVVGDKTAVPSAVTSELGS |
| Ga0335072_101901604 | 3300032898 | Soil | YTLSPAGLAQYKAGGFTLITPTVVGDKTAVPSAITSELGS |
| Ga0335072_111826591 | 3300032898 | Soil | IGTPTPAGTAFVKYTLSAAGLAQYKAGGFSLLTPTVVGDASAVPADISSELGT |
| Ga0335077_100548697 | 3300033158 | Soil | AFVKYTLSPAGLAQYKQGGFSLPTPTVFGSASSVPSEISSELGG |
| Ga0370514_071845_2_157 | 3300034199 | Untreated Peat Soil | KPTPAGIAFVKYTLSPAGLAQYKQGGFTLITPTVTGDSSAVPSAVRSELGG |
| ⦗Top⦘ |