| Basic Information | |
|---|---|
| Family ID | F082964 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ARDFGSLRTSQFHLIESKLKPSGAEYTTLESFPFAAEA |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 89.38 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.230 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.239 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.283 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.177 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.82% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF02660 | G3P_acyltransf | 77.88 |
| PF01210 | NAD_Gly3P_dh_N | 7.96 |
| PF07479 | NAD_Gly3P_dh_C | 7.96 |
| PF02743 | dCache_1 | 1.77 |
| PF00456 | Transketolase_N | 0.88 |
| PF07690 | MFS_1 | 0.88 |
| PF12704 | MacB_PCD | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0344 | Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase | Lipid transport and metabolism [I] | 77.88 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 7.96 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 1.77 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.88 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.23 % |
| Unclassified | root | N/A | 1.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1009587 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300001593|JGI12635J15846_10166431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1494 | Open in IMG/M |
| 3300003370|JGI26337J50220_1016203 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005435|Ga0070714_102068952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300005439|Ga0070711_101032930 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005445|Ga0070708_101321177 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005602|Ga0070762_11144770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300005712|Ga0070764_10509394 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006032|Ga0066696_10148080 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300006176|Ga0070765_101204355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300006176|Ga0070765_102194141 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300007258|Ga0099793_10019618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2760 | Open in IMG/M |
| 3300007265|Ga0099794_10479087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300007788|Ga0099795_10486873 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009038|Ga0099829_11285236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300009090|Ga0099827_11656999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300009521|Ga0116222_1117547 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300009645|Ga0116106_1230383 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009839|Ga0116223_10211286 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300010043|Ga0126380_11267806 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010046|Ga0126384_10758772 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300010339|Ga0074046_10835742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300010359|Ga0126376_11191697 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010361|Ga0126378_12800292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300010398|Ga0126383_11727512 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300010398|Ga0126383_13149441 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300011269|Ga0137392_10639666 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300011269|Ga0137392_11321480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300011269|Ga0137392_11333358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300011269|Ga0137392_11507680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012096|Ga0137389_10101044 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
| 3300012096|Ga0137389_11293339 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012206|Ga0137380_10690426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300012363|Ga0137390_10534288 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300012925|Ga0137419_10762212 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012977|Ga0134087_10016737 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
| 3300012977|Ga0134087_10061706 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300014165|Ga0181523_10034110 | All Organisms → cellular organisms → Bacteria | 3255 | Open in IMG/M |
| 3300016294|Ga0182041_12312460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300016319|Ga0182033_11718912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300016357|Ga0182032_11439754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300017933|Ga0187801_10272453 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300017943|Ga0187819_10842436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300017955|Ga0187817_10811868 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017972|Ga0187781_10102535 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300017974|Ga0187777_10035304 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
| 3300018032|Ga0187788_10143609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300018090|Ga0187770_11465935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300018482|Ga0066669_12213333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300018482|Ga0066669_12429807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300020581|Ga0210399_10081160 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
| 3300020581|Ga0210399_11511939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300020581|Ga0210399_11526218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300021168|Ga0210406_10578635 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300021170|Ga0210400_11585407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300021180|Ga0210396_10196916 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300021384|Ga0213876_10091653 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300021402|Ga0210385_11005472 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300021402|Ga0210385_11364125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300021404|Ga0210389_11031556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300021405|Ga0210387_11523294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300021420|Ga0210394_11067870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300021420|Ga0210394_11604242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300021420|Ga0210394_11836544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300021477|Ga0210398_10979998 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300021478|Ga0210402_11045346 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300021478|Ga0210402_11860853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300021559|Ga0210409_10860399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300022533|Ga0242662_10120965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300022563|Ga0212128_10257398 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300025477|Ga0208192_1010343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2734 | Open in IMG/M |
| 3300025905|Ga0207685_10035054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1828 | Open in IMG/M |
| 3300025906|Ga0207699_10890481 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300026295|Ga0209234_1101131 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300026318|Ga0209471_1337541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300026320|Ga0209131_1234602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300026335|Ga0209804_1054487 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300026528|Ga0209378_1300551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300026536|Ga0209058_1270428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300026551|Ga0209648_10283809 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300026552|Ga0209577_10264257 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300026555|Ga0179593_1078892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2495 | Open in IMG/M |
| 3300026854|Ga0207727_116859 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300027109|Ga0208603_1005795 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
| 3300027109|Ga0208603_1030714 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300027497|Ga0208199_1103190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300027616|Ga0209106_1077808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 743 | Open in IMG/M |
| 3300027678|Ga0209011_1067205 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300027783|Ga0209448_10123868 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300027884|Ga0209275_10066102 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300027884|Ga0209275_10695601 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027889|Ga0209380_10127143 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300028047|Ga0209526_10233425 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300030659|Ga0316363_10114964 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300031668|Ga0318542_10633913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031720|Ga0307469_11662337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300031768|Ga0318509_10738185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300031820|Ga0307473_11300652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300031912|Ga0306921_10015772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8192 | Open in IMG/M |
| 3300031941|Ga0310912_11341248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300031945|Ga0310913_10553374 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300031946|Ga0310910_10704047 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031962|Ga0307479_10198930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1973 | Open in IMG/M |
| 3300031962|Ga0307479_11186146 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300032076|Ga0306924_10347777 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300032174|Ga0307470_10422537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 949 | Open in IMG/M |
| 3300032180|Ga0307471_100450309 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300032180|Ga0307471_102671214 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300032205|Ga0307472_100408647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1138 | Open in IMG/M |
| 3300032954|Ga0335083_10306477 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300033289|Ga0310914_11791087 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10095873 | 3300001154 | Forest Soil | MQQNMARESGLLKTNEFHLIESKLKPSGAEYTRLASFSFAAAEN* |
| JGI12635J15846_101664311 | 3300001593 | Forest Soil | QNMARESGLLKTNEFHLIESKLKPSGAEYTRLASFSFAAAEN* |
| JGI26337J50220_10162031 | 3300003370 | Bog Forest Soil | KDGEREFGEFHTREFHLIESKLKPEGAEYTTLRSFPFVAES* |
| Ga0070714_1020689521 | 3300005435 | Agricultural Soil | SKENATRSFGSLTSREFHLIESKLKSTGAEYTTLHSFPFVAEA* |
| Ga0070711_1010329301 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SDRFGEFTTAGFQLIESQLKTAGAEYTTLRSFTFVSEGKDS* |
| Ga0070708_1013211772 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ENAQNRSFGKQIVRDFRLIESNLKSTGAEYTTLRSFPFAAEGNNP* |
| Ga0070762_111447702 | 3300005602 | Soil | ENATREFGSLAAQEFHLIESQLKPSGAEYTTLESFPFVMAEA* |
| Ga0070764_105093941 | 3300005712 | Soil | NFGSLVTTQFQLFESKLKPSGAEYTSLETFQFAKA* |
| Ga0066696_101480803 | 3300006032 | Soil | AARELGSLRTSQFHLIESKLQPSGAEYTTLEGLPFVAEA* |
| Ga0075028_1006280162 | 3300006050 | Watersheds | HPTGGLRDAIERNKALEFGAFRSAEFHLIESKLKPAGAEYTTVQSFPFVSEN* |
| Ga0070765_1012043552 | 3300006176 | Soil | SLRTNQYHLIESKLKPSGAEYTTLESFPFVAAEA* |
| Ga0070765_1021941411 | 3300006176 | Soil | RNFGELHASEFHLIESKLKPSGAEYTTLQSFPFVSKD* |
| Ga0099793_100196184 | 3300007258 | Vadose Zone Soil | AAREFGPLRTNQFHLIESKLKLSGAEYTTVESFSFAAAEA* |
| Ga0099794_104790871 | 3300007265 | Vadose Zone Soil | SLRISQFHLIESKLKPSGAEYTTVASFPFAAAEA* |
| Ga0099795_104868732 | 3300007788 | Vadose Zone Soil | ILRTGEFHLIESKTHPAGAEYTRLSSFAFAKAEA* |
| Ga0099829_112852362 | 3300009038 | Vadose Zone Soil | SLRTNQFHLIESKLKSSGAEYTTVETFPFAAAEA* |
| Ga0099827_116569992 | 3300009090 | Vadose Zone Soil | ARDFGSLRTSQFHLIESKLKPSGAEYTTLESFPFAAEA* |
| Ga0116222_11175471 | 3300009521 | Peatlands Soil | HGLPSFGSLSAREFHLIESRPKPTGAEYSTVQSFPFVTET* |
| Ga0116106_12303832 | 3300009645 | Peatland | SREFGSLTTREFHLIESKLKPSGAEYTTLHSYPFVSEA* |
| Ga0116223_102112861 | 3300009839 | Peatlands Soil | ERSARDFGSLVARDFHLIESKLKPAGAEYTTLQSFPFVAEV* |
| Ga0126380_112678061 | 3300010043 | Tropical Forest Soil | AYAANAIRDFGILHTGKFHLIESKLKPSGAQYTTLRSFVFAPEP* |
| Ga0126384_107587721 | 3300010046 | Tropical Forest Soil | AQSFGSLTTSEFHLIESQLKPTGAEYTTVQTVRFAPGA* |
| Ga0074046_108357422 | 3300010339 | Bog Forest Soil | SAAEERSSREFGSLTAREFHLIESKLKPSGAEYTTLHSFPFVTEA* |
| Ga0126376_111916972 | 3300010359 | Tropical Forest Soil | VAKYATHEFGAAHVAEFHLIESKLKPSGAEYTTLQSFPFAAEA* |
| Ga0126378_128002922 | 3300010361 | Tropical Forest Soil | TAVKANLAREFGSLAAQEFHLIESKLKRSGAEYTTIQSFPFVPGT* |
| Ga0126383_117275121 | 3300010398 | Tropical Forest Soil | ASEENATRSVGSLSSGEFHLIESKLKSTGAEYTTLHSFPFVAEA* |
| Ga0126383_131494411 | 3300010398 | Tropical Forest Soil | ENARREFGTAHAREFYLMQSKLKPTGAEYTCLEAFPFVAEA* |
| Ga0137392_106396661 | 3300011269 | Vadose Zone Soil | ENAPRDFGSLCTRQFHLIESELKSGGAEYTTLASFSFATAEA* |
| Ga0137392_113214802 | 3300011269 | Vadose Zone Soil | RDFGSLRTNQFHLIESKLKPSGAEYTTVESFSFAAAEA* |
| Ga0137392_113333582 | 3300011269 | Vadose Zone Soil | FGSVRTGEFHLIESKLKSTGAEYTTLQTFRFATEV* |
| Ga0137392_115076802 | 3300011269 | Vadose Zone Soil | SAHSFGSLRTGEFHLIESKLKSTGAEYTTLQTFRFAAEA* |
| Ga0137389_101010443 | 3300012096 | Vadose Zone Soil | NAAREFGSLRTNQYHLIESKLKPSGAEYTTLESFPFVAAEA* |
| Ga0137389_112933392 | 3300012096 | Vadose Zone Soil | EFGSVAAREFHLIESKLKPGGAEYTTLETFPFVEAEV* |
| Ga0137380_106904261 | 3300012206 | Vadose Zone Soil | REFGSFRTNQYLLIESKLKPSGAGYTTLESFPFAAAEA* |
| Ga0137390_105342883 | 3300012363 | Vadose Zone Soil | FGSLRANQFHLIQSKLKPTGAEYTTLESFPFAAAEV* |
| Ga0137419_107622122 | 3300012925 | Vadose Zone Soil | FGSVAAGEFHLIESKLKPGGAQYTTVEAFPFVVAKA* |
| Ga0134087_100167371 | 3300012977 | Grasslands Soil | NAKRDFGSLHSGKFHLIESKLKPSGAEYTTVESFSFAAAEV* |
| Ga0134087_100617061 | 3300012977 | Grasslands Soil | REFGSLRTSEFHLIQSKLKPSGAEYTALTSFPFAPSVE* |
| Ga0181523_100341104 | 3300014165 | Bog | RSFGSLSTREFHLIESRLKSTGAEYTTVQSFPFVTET* |
| Ga0182041_123124602 | 3300016294 | Soil | FGSLTATEFQLIESKLKPTGAEYTTLKSFPFVSET |
| Ga0182033_117189122 | 3300016319 | Soil | RTLDSFGSLTATEFHLIESKLKPAGAEYTTVQTVRFAPGG |
| Ga0182032_114397542 | 3300016357 | Soil | SRGFGSLTAAEFQLIESKLKPSGAEYTTLQSFPFVSEN |
| Ga0187801_102724531 | 3300017933 | Freshwater Sediment | ENASSGFGTFCTREFHLIESKLKPTGAEYTNLQSFPFVAEK |
| Ga0187819_108424361 | 3300017943 | Freshwater Sediment | NMAREFGAFETGQFHLIESKLKPSGAEYTTLQSFSFVAEA |
| Ga0187817_108118681 | 3300017955 | Freshwater Sediment | VRENMAREFGAFETGQFHLIESKLKPSGAEYTTLQSFPFVAEA |
| Ga0187781_101025353 | 3300017972 | Tropical Peatland | FGSLTARAFHLIESKLKPGGAEYTTLKSFPFVAGT |
| Ga0187777_100353041 | 3300017974 | Tropical Peatland | QTFGIMTTREFHLIESKLKPAGAEYTTLRSFPFAAEI |
| Ga0187788_101436091 | 3300018032 | Tropical Peatland | TADRAVRDFGALRTAEFRLIESKLKPTGAEYTTLQNFAFASEN |
| Ga0187770_114659352 | 3300018090 | Tropical Peatland | AAQEAASRDLGSLIARKFHLIESKLKPAGAEYTTLQSFPFVAEV |
| Ga0066669_122133332 | 3300018482 | Grasslands Soil | ENAARELGSLRTSQFHLIESKLQPSGAEYTTLESLPFVAEA |
| Ga0066669_124298071 | 3300018482 | Grasslands Soil | LGSLRTSQFHLIESKLQPSGAEYTTLESLPFVAEA |
| Ga0210399_100811601 | 3300020581 | Soil | AQTFGCLLTREIHLIESKLKPTGAEYTTVQTFRFATEA |
| Ga0210399_115119392 | 3300020581 | Soil | PQPFGSLRTGEFHLIESKLKTTGAEYTTVQTFRFATEA |
| Ga0210399_115262182 | 3300020581 | Soil | AFGSLRAGEFHLIESKLKPTGAEYTTVQTFRFATEA |
| Ga0210406_105786351 | 3300021168 | Soil | IQEKIAQSFGSLQTGQFHLIESKLKPAGAEYTTVQSFRFAAEA |
| Ga0210400_115854071 | 3300021170 | Soil | RDFGVLHTSEFHLIESKLKPMGAEYTTLQSFSFVSKD |
| Ga0210396_101969161 | 3300021180 | Soil | SLGSLATRQFHLIESKLKPTGAEYTTVQSFHFASEA |
| Ga0213876_100916533 | 3300021384 | Plant Roots | HQATRDFGELHTSEFHLIESKLKPTGAEYTTLQSFPFVSKD |
| Ga0210385_110054722 | 3300021402 | Soil | KSGEREFGSFQTREFHLIESKLKPSGAEYTTLASFPFSLEA |
| Ga0210385_113641251 | 3300021402 | Soil | RDFGELRTGQFHLIESKLKASGAEYTTLQSFVFAAEA |
| Ga0210389_110315562 | 3300021404 | Soil | QSFGSLRTQEFHLIESKLKPTGAEYTTLQTFRFATEA |
| Ga0210387_115232942 | 3300021405 | Soil | ERDSARDFGGLRTTQFHLIESKLKASGAEYTTLQSFVFAAEA |
| Ga0210394_110678702 | 3300021420 | Soil | SSQPFGSLRAGEFHLIESKLKPSGAEYTTVQTFRFATEA |
| Ga0210394_116042421 | 3300021420 | Soil | MLSTVAHENAARSFGSFTAREFHLIESKLKPSGAEYTTLQSFTFVAEA |
| Ga0210394_118365442 | 3300021420 | Soil | EKSGQSLGSLATRQFHLIESKLKPTGAEYTTVQSFHFASEA |
| Ga0210398_109799981 | 3300021477 | Soil | FGSFQTREFHLIESKLKPSGAEYTTLASFPFTLEA |
| Ga0210402_110453461 | 3300021478 | Soil | EAIERNASHEFGTFQTAEFHLIESKLKPAGAEYTSLQSFSFVSES |
| Ga0210402_118608531 | 3300021478 | Soil | AERDSARDFGELRTNAFHLIESKLKASGAEYTTLQSFVFAAEA |
| Ga0210409_108603992 | 3300021559 | Soil | GQSLGSLATRQFHLIESKLKPTGAEYTTVQSFHFASEA |
| Ga0242662_101209651 | 3300022533 | Soil | KNAQSFGSLRTQEFHLIESKLKPTGAEYTTLQTFRLATEA |
| Ga0212128_102573983 | 3300022563 | Thermal Springs | RRGALEFGEMRADEFHLYESRLKPSGAEYVKLATFSCAEAAR |
| Ga0208192_10103434 | 3300025477 | Peatland | EDASREFGSLIAREFHLIESKLKPAGAEYTTLQSFPFVAEV |
| Ga0207685_100350543 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AASKENATRSFGSLTSREFHLIESKLKSTGAEYTTLHSFPFVAEA |
| Ga0207699_108904811 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | NATRAFGTLHAGTFHLIQSKLKTSGAEYTTLRSFPFAAED |
| Ga0209234_11011311 | 3300026295 | Grasslands Soil | EKLRAAVHENGAESFGDLHTHEFHLIESKLKPSGAEYVSLHSFLFAEA |
| Ga0209471_13375411 | 3300026318 | Soil | FGSLRTSQFHLIESKLKSSGAEYTTVESFSFAAAEA |
| Ga0209131_12346022 | 3300026320 | Grasslands Soil | FGSLCTGEFHLIESKLKPTGAEYTTVQTFHFATEA |
| Ga0209804_10544873 | 3300026335 | Soil | AARELGSLRTSQFHLIESKLKPSGAEYTTLESLPFVAEA |
| Ga0209378_13005511 | 3300026528 | Soil | FGSLRAGKFHLIESKLKPSGAEYTTVESFSFAAAEV |
| Ga0209058_12704281 | 3300026536 | Soil | AARDFGSLRTNQFHLIENKLKRCGAEYTTLESFPFAAAEA |
| Ga0209648_102838093 | 3300026551 | Grasslands Soil | EFGSLRTSEFHLIESKLKPSGAEYTRLASFSFAEAKT |
| Ga0209577_102642573 | 3300026552 | Soil | REFGSFRTSQYQLIESKLKPSGAEYTTLESFPFAAAEA |
| Ga0179593_10788924 | 3300026555 | Vadose Zone Soil | SGSLRTNQYHLIESKLKPSGAEYTTLESFPFTAAEA |
| Ga0207727_1168591 | 3300026854 | Tropical Forest Soil | FGSLTAAEFQLIESKLKPSGAEYTTLQSFPFVSEN |
| Ga0208603_10057951 | 3300027109 | Forest Soil | QVNAARDFGSLRTSQFHLIESKLKPSGAEYTTLESFSFSVAEA |
| Ga0208603_10307142 | 3300027109 | Forest Soil | IQKSGAREFGSFQTREFYLIESKLKPSGAEYTTLASYPFTLEA |
| Ga0208199_11031902 | 3300027497 | Peatlands Soil | QAIGHDFGSLRTNQFHLIESKLKPSGAEYTTVESFSFAAAEA |
| Ga0209106_10778081 | 3300027616 | Forest Soil | AREFGSFRTNQCHLIESKLKPSGAEYTTLESFPFVAAEA |
| Ga0209011_10672051 | 3300027678 | Forest Soil | VVRENAKRDFGALRADEFHLIESKLKPGGAEYTTLETFPFVVAEV |
| Ga0209448_101238681 | 3300027783 | Bog Forest Soil | EREFGEFHTREFHLIESKLKPEGAEYTTLRSFPFVAES |
| Ga0209180_105333781 | 3300027846 | Vadose Zone Soil | QENPARDFGSLRTNQFQLIESKLKSSGAEYTTVETFPFAAAEA |
| Ga0209275_100661023 | 3300027884 | Soil | EKSGQPFGSLSTQQFHLIESKLKPTGAEYTTLQTFRFATEA |
| Ga0209275_106956012 | 3300027884 | Soil | TRDFGELHTSEFHLIESKLKPSGAEYTTLQSFPFVSEV |
| Ga0209380_101271431 | 3300027889 | Soil | FGSLAAQEFHLIESQLKPSGAEYTTLESFPFVMAEA |
| Ga0209526_102334251 | 3300028047 | Forest Soil | AIEKDTARDLGAFTTNQFHLIESQLKPTGAEYTTLQSFVFSAEG |
| Ga0316363_101149643 | 3300030659 | Peatlands Soil | HEFGSLVTREFRLIESKLKPAGAEYTTLQSFPFVAEV |
| Ga0318542_106339131 | 3300031668 | Soil | VKENATRKFGSLATSEFHLIESKLKPAGAEYTTVQSFPFVVEA |
| Ga0307469_116623372 | 3300031720 | Hardwood Forest Soil | AMNDKSGQPFGSLRTPDFHLIESKLKPTGAEYTTLQTFHFATEA |
| Ga0318509_107381851 | 3300031768 | Soil | AAEQHAPRVFGSLIAREFHLIESRLKPAGAEYTTLQSFPLAPEK |
| Ga0307473_113006522 | 3300031820 | Hardwood Forest Soil | FGSLRTDEFHLIESKLKPSGAEYTTLESFRFARAEA |
| Ga0306921_100157721 | 3300031912 | Soil | TAVKANLAREFGSLAAQEFHLIESKLKRSGAEYTTIQSFPFVPGT |
| Ga0310912_113412482 | 3300031941 | Soil | ENATRKFGSLATSEFHLIESKLKPAGAEYTTVQSFPFVVEA |
| Ga0310913_105533742 | 3300031945 | Soil | QQNQSRGFGSLTAAEFQLIESKLKPSGAEYTTLQSFPFVSEN |
| Ga0310910_107040472 | 3300031946 | Soil | VQQNQSRGFGSLTAAEFQLIESKLKPSGAEYTTLQSFPFVSEN |
| Ga0307479_101989304 | 3300031962 | Hardwood Forest Soil | GSLPTSEFHLIESKLKPSGAEYTRLASISFAETET |
| Ga0307479_111861461 | 3300031962 | Hardwood Forest Soil | TREFGAVETNQFHLIESKLKPSGAEYTTLQSLSFVSGR |
| Ga0306924_103477773 | 3300032076 | Soil | GFGSLTAAEFQLIESKLKPSGAEYTTLQSFPFVSEN |
| Ga0307470_104225371 | 3300032174 | Hardwood Forest Soil | EKSSQTFGSLNTREFHLIESKLKPTGAEYTTVQSFHFAPEA |
| Ga0307471_1004503091 | 3300032180 | Hardwood Forest Soil | ENARREFGSVATEEFHLIESKLKPGGAEYTTLETFPFVVAEA |
| Ga0307471_1026712141 | 3300032180 | Hardwood Forest Soil | LGSFSTHEFQLIESKLKSTGAEYTTLQSFSFVTEA |
| Ga0307472_1004086471 | 3300032205 | Hardwood Forest Soil | MCKVVERNATRAFGTLRAGAFHLMLSKLKPAGAEYTTLRSFPFAAEA |
| Ga0335083_103064771 | 3300032954 | Soil | GKNARREFGTIMTREFRLIESRLKAGGAEYTTVQQFQFATEF |
| Ga0310914_117910871 | 3300033289 | Soil | REFGSLRTGEFHLMQSKLKPSGAEYTTLKTFPFSTSVE |
| ⦗Top⦘ |