Basic Information | |
---|---|
Family ID | F082941 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 40 residues |
Representative Sequence | QATINMDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 95.58 % |
% of genes from short scaffolds (< 2000 bps) | 92.92 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.265 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.088 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.628 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.018 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF04273 | BLH_phosphatase | 66.37 |
PF01411 | tRNA-synt_2c | 7.08 |
PF00154 | RecA | 3.54 |
PF00072 | Response_reg | 0.88 |
PF00106 | adh_short | 0.88 |
PF07238 | PilZ | 0.88 |
PF03358 | FMN_red | 0.88 |
PF04185 | Phosphoesterase | 0.88 |
PF13342 | Toprim_Crpt | 0.88 |
PF13649 | Methyltransf_25 | 0.88 |
PF13817 | DDE_Tnp_IS66_C | 0.88 |
PF01872 | RibD_C | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 66.37 |
COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 7.08 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 3.54 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.88 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.88 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.27 % |
Unclassified | root | N/A | 9.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100746218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 858 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101662793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300004091|Ga0062387_100512681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 840 | Open in IMG/M |
3300004092|Ga0062389_104128617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 546 | Open in IMG/M |
3300005171|Ga0066677_10349805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
3300005439|Ga0070711_101769814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 542 | Open in IMG/M |
3300005456|Ga0070678_101059749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 747 | Open in IMG/M |
3300005529|Ga0070741_10561046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
3300005552|Ga0066701_10556219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 704 | Open in IMG/M |
3300005575|Ga0066702_10311617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 959 | Open in IMG/M |
3300005764|Ga0066903_107773844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 551 | Open in IMG/M |
3300005901|Ga0075274_1093440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 505 | Open in IMG/M |
3300006028|Ga0070717_11102064 | Not Available | 723 | Open in IMG/M |
3300006176|Ga0070765_102206643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 513 | Open in IMG/M |
3300007265|Ga0099794_10686915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
3300009038|Ga0099829_10658661 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300009038|Ga0099829_10750702 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300009089|Ga0099828_10199665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1785 | Open in IMG/M |
3300009143|Ga0099792_11054841 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300009824|Ga0116219_10006597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 8107 | Open in IMG/M |
3300010038|Ga0126315_11146607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
3300010048|Ga0126373_12964164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300010337|Ga0134062_10664636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
3300010343|Ga0074044_10434822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 859 | Open in IMG/M |
3300010361|Ga0126378_10508591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1320 | Open in IMG/M |
3300010361|Ga0126378_10836071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1029 | Open in IMG/M |
3300010366|Ga0126379_10990986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 945 | Open in IMG/M |
3300010863|Ga0124850_1081041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
3300010880|Ga0126350_10086743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300012199|Ga0137383_10562582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
3300012203|Ga0137399_10495509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
3300012203|Ga0137399_11362730 | Not Available | 595 | Open in IMG/M |
3300012208|Ga0137376_10917446 | Not Available | 752 | Open in IMG/M |
3300012209|Ga0137379_10548748 | Not Available | 1063 | Open in IMG/M |
3300012210|Ga0137378_10665960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 951 | Open in IMG/M |
3300012211|Ga0137377_11082780 | Not Available | 732 | Open in IMG/M |
3300012363|Ga0137390_10927266 | Not Available | 825 | Open in IMG/M |
3300012582|Ga0137358_10749440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
3300012922|Ga0137394_10705456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 849 | Open in IMG/M |
3300012927|Ga0137416_10274647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1387 | Open in IMG/M |
3300012944|Ga0137410_11096418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
3300012971|Ga0126369_11544248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
3300012984|Ga0164309_11095081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
3300012986|Ga0164304_11017304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
3300014150|Ga0134081_10298414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
3300014166|Ga0134079_10202286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 834 | Open in IMG/M |
3300014325|Ga0163163_12561664 | Not Available | 568 | Open in IMG/M |
3300014501|Ga0182024_12776761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
3300015264|Ga0137403_10582973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 985 | Open in IMG/M |
3300015356|Ga0134073_10232598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
3300016294|Ga0182041_12029879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300016371|Ga0182034_10029267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3417 | Open in IMG/M |
3300016387|Ga0182040_10640916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
3300016445|Ga0182038_10121524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1941 | Open in IMG/M |
3300017995|Ga0187816_10359066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
3300018084|Ga0184629_10394106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
3300018086|Ga0187769_11522079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300021088|Ga0210404_10391756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
3300021178|Ga0210408_11280434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
3300021361|Ga0213872_10436262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
3300021384|Ga0213876_10320862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
3300021401|Ga0210393_10857583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
3300021478|Ga0210402_10525322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1099 | Open in IMG/M |
3300021478|Ga0210402_10750875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 900 | Open in IMG/M |
3300022726|Ga0242654_10246422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
3300024227|Ga0228598_1107194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
3300026315|Ga0209686_1229714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300026908|Ga0207787_1000994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3687 | Open in IMG/M |
3300027069|Ga0208859_1000616 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
3300027565|Ga0209219_1149304 | Not Available | 563 | Open in IMG/M |
3300027698|Ga0209446_1094305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
3300027908|Ga0209006_10860348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300028047|Ga0209526_10316111 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300031446|Ga0170820_10179925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
3300031545|Ga0318541_10766115 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300031561|Ga0318528_10706574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300031561|Ga0318528_10731708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300031564|Ga0318573_10457531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
3300031564|Ga0318573_10535127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
3300031564|Ga0318573_10719920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300031572|Ga0318515_10144342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1266 | Open in IMG/M |
3300031640|Ga0318555_10036042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2440 | Open in IMG/M |
3300031719|Ga0306917_10451864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1006 | Open in IMG/M |
3300031744|Ga0306918_10909038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
3300031747|Ga0318502_10249338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1036 | Open in IMG/M |
3300031754|Ga0307475_10958905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
3300031763|Ga0318537_10214977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 715 | Open in IMG/M |
3300031779|Ga0318566_10429011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300031782|Ga0318552_10642486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300031795|Ga0318557_10142510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1081 | Open in IMG/M |
3300031797|Ga0318550_10322828 | Not Available | 749 | Open in IMG/M |
3300031823|Ga0307478_10099820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2246 | Open in IMG/M |
3300031832|Ga0318499_10189864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
3300031833|Ga0310917_10533360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
3300031846|Ga0318512_10559101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
3300031859|Ga0318527_10012998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2808 | Open in IMG/M |
3300031890|Ga0306925_10236444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1970 | Open in IMG/M |
3300031893|Ga0318536_10637443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
3300031947|Ga0310909_11094035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
3300031959|Ga0318530_10338208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
3300032010|Ga0318569_10270608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
3300032043|Ga0318556_10322560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
3300032055|Ga0318575_10519376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300032059|Ga0318533_10679016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
3300032068|Ga0318553_10179494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1102 | Open in IMG/M |
3300032076|Ga0306924_12615368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300032090|Ga0318518_10533528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
3300032091|Ga0318577_10523213 | Not Available | 565 | Open in IMG/M |
3300032261|Ga0306920_100867809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1321 | Open in IMG/M |
3300032261|Ga0306920_102415576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
3300032770|Ga0335085_10732315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1096 | Open in IMG/M |
3300033134|Ga0335073_10633517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1186 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.09% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.85% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.54% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.77% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.89% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1007462183 | 3300002245 | Forest Soil | RHAEMLPNAAVSVEDLQGANAALRRLERFWIRAGDFVQRPPQFAA* |
JGIcombinedJ26739_1016627931 | 3300002245 | Forest Soil | IEMLGQTTITDTDLQGVVTTLRRLERFWIRASDLVQRPGQFAA* |
Ga0062387_1005126811 | 3300004091 | Bog Forest Soil | HIEMLSHTTVTDENLQSVIVTLGRLERFWVRAGDLVQRPGRFAA* |
Ga0062389_1041286171 | 3300004092 | Bog Forest Soil | NQTAITDEDLTAATVTLRRLERFWIRAGDLVQRPGQYAA* |
Ga0066677_103498053 | 3300005171 | Soil | EMLNQTTITTADLEGVVVTLRRLERFWIRASDLLQRPGQFAA* |
Ga0070711_1017698142 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LPQAALSAEDLQGAGATLRRLERFWIRAGDFVQRPPQFAA* |
Ga0070678_1010597491 | 3300005456 | Miscanthus Rhizosphere | RHVDLLAQTAVSDEDLAAVTLTLRRLERFWIRAGDLVVQRPGQFAA* |
Ga0070741_105610461 | 3300005529 | Surface Soil | AVSGEDLDTVIVTLRRLERFWIRAGDLVQRPGQYAA* |
Ga0066701_105562191 | 3300005552 | Soil | TTSDLEGVVVTLRRLERFWIRASDLLQRPGQFAA* |
Ga0066702_103116173 | 3300005575 | Soil | HIEMLGQTTITEADLQTVVTTLRRLERFWIRASDLVQRPGQFAA* |
Ga0066903_1077738441 | 3300005764 | Tropical Forest Soil | QRHAAMLPQAGFTAEDLQDGATMLRRLERFWIRAGDVVQRSPQFAA* |
Ga0075274_10934402 | 3300005901 | Rice Paddy Soil | VTGDDLQNVIVTLRRLERFWIRASDLVQRPGQFAA* |
Ga0070717_111020641 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HIEMLGETRITDSDLQGVVTTLRRLERFWLRDSDLS* |
Ga0070765_1022066432 | 3300006176 | Soil | QTAITEDDLQNATVTLRRLERFWIRAGDLVQRPGQFAA* |
Ga0099794_106869152 | 3300007265 | Vadose Zone Soil | EIGVASVEELDAMNGVLRRLERFWVRAGDLVQRPGQFAA* |
Ga0099829_106586611 | 3300009038 | Vadose Zone Soil | TAVTDGDLDSVIVTLRRLERFWVRAGDLVQRPGRFAA* |
Ga0099829_107507021 | 3300009038 | Vadose Zone Soil | MLNQTTITDADLQGVVVTLRRLERFWMRASDLLQRAGQSAA* |
Ga0099828_101996651 | 3300009089 | Vadose Zone Soil | IELLSQTAVTDGDLDSVIVTLRRLERFWVRAGDLVQRPGRFAA* |
Ga0099792_110548411 | 3300009143 | Vadose Zone Soil | RHVEMLGQTAITDADLQGVAVTLGRLERFWMRASDLLQQPGRFAA* |
Ga0116219_1000659714 | 3300009824 | Peatlands Soil | LNQTAITGEDLTAATVTLRRLERFWIRAGDLVQRPGQYAA* |
Ga0126315_111466072 | 3300010038 | Serpentine Soil | VEMLAQTAVTEDDLKNVMVTLRRLERFWIRASDLVQRPGNNFAAA* |
Ga0126373_129641641 | 3300010048 | Tropical Forest Soil | ATINMDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA* |
Ga0134062_106646361 | 3300010337 | Grasslands Soil | TTITNADLEGVVVTLRRLERFWIRASDLLQRPGQFAA* |
Ga0074044_104348221 | 3300010343 | Bog Forest Soil | TLNMDDLQAVGVTLRRLERFWVRAADLVQRPPRFAA* |
Ga0126378_105085911 | 3300010361 | Tropical Forest Soil | HHAEMLPRAGVAAEDLQGTNATLRRLERFWIRAGDLVQRPPQLAA* |
Ga0126378_108360712 | 3300010361 | Tropical Forest Soil | GLLSQAAVSVEDLQAVGVTLGRLERFWIRASDLVQRPLQFAA* |
Ga0126379_109909861 | 3300010366 | Tropical Forest Soil | HAAMLPQAGLTAEDLQDGATMLRRLERFWIRAGDVVQRPPQFAA* |
Ga0124850_10810411 | 3300010863 | Tropical Forest Soil | MLSQATINMDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA* |
Ga0126350_100867432 | 3300010880 | Boreal Forest Soil | LDQTPITGPDLQNSLVTLRRLERFWVRAADLAQRPRQRAA* |
Ga0137383_105625821 | 3300012199 | Vadose Zone Soil | TDENLQEVIVTLRRLERFWVRAGDLVQRPGRFAA* |
Ga0137399_104955091 | 3300012203 | Vadose Zone Soil | TLNMEDLQTVGATLRRLERFWIRASDLVQRPPQFAA* |
Ga0137399_113627301 | 3300012203 | Vadose Zone Soil | QTTITNADLEGVVVTLRRLERFWIRASDISLQPEQFAA* |
Ga0137376_109174461 | 3300012208 | Vadose Zone Soil | HIEMLSQTAISDTDPEGVVVTLRRLERFWMRAGDPLQRPGQFAA* |
Ga0137379_105487483 | 3300012209 | Vadose Zone Soil | AITDGDLQGVAVTLRQLERFWIRASDISQQPAQFAA* |
Ga0137378_106659601 | 3300012210 | Vadose Zone Soil | RHVEMLGQTAITDGDLQGAAVTLRQLERFWIRASDISQQPAQFAA* |
Ga0137377_110827801 | 3300012211 | Vadose Zone Soil | MHRRHVEMLSQTEISDTDLQGVGVTFRRLKRFWIRASDLLQQPGQFAA* |
Ga0137390_109272663 | 3300012363 | Vadose Zone Soil | VMHKRHVEMLGQTAITDGDLQGVAVTLRQLERFWIRASDISQQPAQFAA* |
Ga0137358_107494402 | 3300012582 | Vadose Zone Soil | VEMLNQTTITDADLQGVGVTLRRLERFWIRASDLSQRPGQFAA* |
Ga0137394_107054563 | 3300012922 | Vadose Zone Soil | SAEDLQGAGGTLRRLERFWIRAGDFVQRPPQFAA* |
Ga0137416_102746471 | 3300012927 | Vadose Zone Soil | TLSADDLQAAGVTLRRLERFWIRAADLVQRPPQFAA* |
Ga0137410_110964181 | 3300012944 | Vadose Zone Soil | LNMEDLQTVGATLRRLERFWIRASDLVQRPPQFAA* |
Ga0126369_115442482 | 3300012971 | Tropical Forest Soil | MLPAGLASENLQDANATLRRLERFWIRAGDLVQRPAQVAA* |
Ga0164309_110950811 | 3300012984 | Soil | TEADLQTVVTTLRRLERFWIRASDLVQRPGQFAA* |
Ga0164304_110173042 | 3300012986 | Soil | MPKMLPNAAVSVEDLQGANAALRRLERFWIRAGDFVQHPPQFAA* |
Ga0134081_102984141 | 3300014150 | Grasslands Soil | TTITEADLQTVVTTLRRLERFWIRASDLVQRPGQFAA* |
Ga0134079_102022863 | 3300014166 | Grasslands Soil | RHIEMLGQTTITESDLQGVVTTLRRLERFWIRASDLVQRPGQFAA* |
Ga0163163_125616642 | 3300014325 | Switchgrass Rhizosphere | HRRHVDLLAQTDISDENLTAVTLTLRRLERFWVRAGDPVVQRQGQFAA* |
Ga0182024_127767611 | 3300014501 | Permafrost | IELLSQTAVTTEDLDAVLVTLGRLERFWIRAGDLVQRPGQFAA* |
Ga0137403_105829731 | 3300015264 | Vadose Zone Soil | TITNADLEGVVVTLRRLERFWIRASDLLQRPGQFAA* |
Ga0134073_102325981 | 3300015356 | Grasslands Soil | ITEADLQTVVTTLRRLERFWIRASDLVQRPGQFAA* |
Ga0182041_120298792 | 3300016294 | Soil | QAALSAEDLQGAGATLRRLERFWIRAGDLVQRPPQFAA |
Ga0182034_100292673 | 3300016371 | Soil | LGADDLQAAGVTLRRLERFWIRAADLVQRPPPQFAA |
Ga0182040_106409162 | 3300016387 | Soil | LVGADDLQAVGVTLRRLERFWIRAGDMMHRPPQFAA |
Ga0182038_101215243 | 3300016445 | Soil | RHAEMLPQALVGADDLQAVGVTLRRLERFWIRAGDMMQRPPQFAA |
Ga0187816_103590661 | 3300017995 | Freshwater Sediment | LLPQAAVAMDDLQSVGVTLRRLERFWIRASDLVQRPPQFAA |
Ga0184629_103941061 | 3300018084 | Groundwater Sediment | MHDHHIQLLSQTTPVTDENLQEVIVTLRRLERFWVRAGDLVQRPGQFAAA |
Ga0187769_115220792 | 3300018086 | Tropical Peatland | AITEEDLQAATVTLRRLERFWIRAGDLVQRPGQFAA |
Ga0193728_13289052 | 3300019890 | Soil | LDVMARRHVEMLTETGITDGDLQGVVGTLHRLERFWIRAGDLLQQPGQFAA |
Ga0210404_103917561 | 3300021088 | Soil | RHVEMLAQTAITDADLQGVAVTLRRLERFWVRASDISQQPGRFAA |
Ga0210408_112804341 | 3300021178 | Soil | TTITSADLDGVVVTLRRLERFWIRASDLLQRPGQFAA |
Ga0213872_104362622 | 3300021361 | Rhizosphere | AMLSQAALSAEDLQDVAGTLRRLERFWIRAGDVVQRPPLFAA |
Ga0213876_103208623 | 3300021384 | Plant Roots | EMLSQTTVTDEDLASVTTTLRRLERFWIRAGDLVQRPGQFAA |
Ga0210393_108575831 | 3300021401 | Soil | PNAAVSVEDLQGANAALRRLERFWIGAGDFVQRPPQFAA |
Ga0210402_105253223 | 3300021478 | Soil | QAALSTEDLQDAGATLRRLERFWIRAGDFVQRPPQFAA |
Ga0210402_107508753 | 3300021478 | Soil | SQAPINMDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA |
Ga0242654_102464221 | 3300022726 | Soil | PQATINMDDLQAVGVTLRRLERFWVRAADLVQRPPQFAA |
Ga0228598_11071941 | 3300024227 | Rhizosphere | PQALVGAEDLQAASVTLRRLERFWIRAGDMIQRPPQFAA |
Ga0209686_12297141 | 3300026315 | Soil | QAAVSAEDLQGASATLRRLERFWIRAGDFVQRPPQFAA |
Ga0207787_10009945 | 3300026908 | Tropical Forest Soil | MLSRTAVSADDLQAAGVTLRRLERFWMRATDLRQRPQ |
Ga0208859_10006165 | 3300027069 | Forest Soil | MMRRLDLTDNERAVLITTLRRLERFWIRAGDFVQRPPQFAA |
Ga0209219_11493042 | 3300027565 | Forest Soil | HQRHAETLSQTAITDADLQGAVGTLRRLERFWMLATDFSSRPGQFAA |
Ga0209446_10943051 | 3300027698 | Bog Forest Soil | RHAEMLPNAAVSVEDLQGANAALRRLERFWIRAGDFVQRPPQFAA |
Ga0209006_108603482 | 3300027908 | Forest Soil | LGQTTITDTDLQGVVTTLRRLERFWIRASDLVQRPGQFAA |
Ga0209526_103161112 | 3300028047 | Forest Soil | MHQRHAETLSQTAITDADLQGAVGTLRRLERFWMLATDFSSRPGQFAA |
Ga0170820_101799252 | 3300031446 | Forest Soil | APINMDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA |
Ga0318541_107661152 | 3300031545 | Soil | AVSVEDLQAVGVTLGRLERFWIRASDLVQRPLQFAA |
Ga0318528_107065741 | 3300031561 | Soil | GGLSLEDLQTASGTLRRLERFWIRTSDLVQRRPQFAA |
Ga0318528_107317082 | 3300031561 | Soil | QALVGADDLQAVGVTLRRLERFWIRAGDMMQRPPQFAA |
Ga0318573_104575312 | 3300031564 | Soil | LVGADDLQAVGVTLRRLERFWIRAGDMMQRPPQFAA |
Ga0318573_105351271 | 3300031564 | Soil | MLPQAALSADDLQAAVTLRRLERFWIRASDLVQRPQFAA |
Ga0318573_107199201 | 3300031564 | Soil | LEMLPQATINMDDLQAVGVTLRRLERFWVRAADLVQRPPQFAA |
Ga0318515_101443423 | 3300031572 | Soil | LNIDDLQAVGVTLRRLERFWIRAGDLMQRPPQFAA |
Ga0318555_100360423 | 3300031640 | Soil | EMLSQAGLNIDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA |
Ga0306917_104518641 | 3300031719 | Soil | LNMDDLQATGVTLRRLERFWIRAGDLAQRPPQFAA |
Ga0306918_109090382 | 3300031744 | Soil | QATINIDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA |
Ga0318502_102493381 | 3300031747 | Soil | PQGGLSLEDLQTASGTLRRLERFWIRTSDLVQRRPQFAA |
Ga0307475_109589052 | 3300031754 | Hardwood Forest Soil | QTTITDADLQGVVVTLRRLERFWIRASDLLQRPGQFAA |
Ga0318537_102149771 | 3300031763 | Soil | LEMLPQATLNMDDLQAVGGTLRRLERFWIRAGDLAQRPPQFAA |
Ga0318566_104290112 | 3300031779 | Soil | QATINMDDLQAVGVTLRRLERFWVRAADLVQRPPQFAA |
Ga0318552_106424861 | 3300031782 | Soil | SQAALNMDDLQAVGVTLRRLERFWIRAGDLAQRPPQFAA |
Ga0318557_101425103 | 3300031795 | Soil | MLPQGGLSLEDLQTASGTLRRLERFWIRTSDLVQRRPQFAA |
Ga0318550_103228282 | 3300031797 | Soil | QTALGADDLQAAGVTLRRLERFWIRAADLVQRPPPQFAA |
Ga0307478_100998204 | 3300031823 | Hardwood Forest Soil | IELLKQTAVTEGDLDGVVTTLRRLERFWIRASDLVQRPGQFAA |
Ga0318499_101898641 | 3300031832 | Soil | AGLNIDDLQAVGVTLRRLERFWIRAGDLMQRPPQFAA |
Ga0310917_105333601 | 3300031833 | Soil | ALNIDDLQATGVTLRRLERFWIRASDLVQRPPQFAA |
Ga0318512_105591012 | 3300031846 | Soil | ATINIDDLQAVGVTLRRLERFWIRASDLVQRPPQFAA |
Ga0318527_100129981 | 3300031859 | Soil | LNIDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA |
Ga0306925_102364441 | 3300031890 | Soil | HLEMLPQATLNMDDLQAVGGTLRRLERFWIRAGDLAQRPPQFAA |
Ga0318536_106374432 | 3300031893 | Soil | LEMLPQATLNMDDLQAVGVTLRRLERFWIRAGDLAQWPPQFAA |
Ga0310909_110940351 | 3300031947 | Soil | VGADDLQAVGVTLRRLERFWIRAGDMMQRPPQFAA |
Ga0318530_103382081 | 3300031959 | Soil | LNMDDLQAVGVTLRRLERFWIRASDLVQRPPRFAA |
Ga0318569_102706083 | 3300032010 | Soil | SQATLNMDDLQAVGVTLRRLERFWIRASDLVQRPPRFAA |
Ga0318556_103225601 | 3300032043 | Soil | MLPQATLNMDDLQAVGVTLRRLERFWIRAGDLAQWPPQFAA |
Ga0318575_105193762 | 3300032055 | Soil | PPGGLNVEDLQATSATLRRLERFWIRTSDLVQRRPQFAA |
Ga0318533_106790162 | 3300032059 | Soil | LNMDDLQAVGGTLRRLERFWIRAGDLAQRPPQFAA |
Ga0318553_101794941 | 3300032068 | Soil | AEMLPPGGLNVEDLQATSATLRRLERFWIRTSDLVQRRPQFAA |
Ga0306924_126153681 | 3300032076 | Soil | TEMLVPGAVAVGDLDALCATLRRLERFWIRAGDMVQRPPQAAA |
Ga0318518_105335281 | 3300032090 | Soil | QAGLNIDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA |
Ga0318577_105232131 | 3300032091 | Soil | SQTALGADDLQAAGVTLRRLERFWIRAADLVQRPPPQFAA |
Ga0306920_1008678093 | 3300032261 | Soil | QATINMDDLQAVGVTLRRLERFWIRAGDLVQRPPQFAA |
Ga0306920_1024155763 | 3300032261 | Soil | HAELLPQAAVSAEDLDTANTALRRLERFWIRAGDLVLRPPQFAA |
Ga0335085_107323151 | 3300032770 | Soil | EMLNQTAITDEDLAAATVTLRRLERFWIRAGDLVQRPGQYAA |
Ga0335073_106335174 | 3300033134 | Soil | HVEMLNQTAITDDDLTATTVTLRRLERFWIRAGDLVQRPGQYAAA |
⦗Top⦘ |