Metagenome Family F082929

Basic Information
Family ID	F082929
Family Type	Metagenome
Number of Sequences	113
Average Sequence Length	39 residues
Representative Sequence	AAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Number of Associated Samples	97
Number of Associated Scaffolds	113

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.12 %
% of genes from short scaffolds (< 2000 bps)	94.69 %
Associated GOLD sequencing projects	93
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.25

Most Common Taxonomy
Group	Unclassified (51.327 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.743 % of family members)
Environment Ontology (ENVO)	Unclassified (39.823 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.903 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 5.88% β-sheet: 0.00% Coil/Unstructured: 94.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF03167	UDG	40.71
PF08534	Redoxin	8.85
PF00392	GntR	1.77
PF03401	TctC	0.88
PF04392	ABC_sub_bind	0.88
PF10431	ClpB_D2-small	0.88
PF07508	Recombinase	0.88
PF01668	SmpB	0.88
PF01425	Amidase	0.88
PF04430	DUF498	0.88
PF02668	TauD	0.88
PF13649	Methyltransf_25	0.88
PF00300	His_Phos_1	0.88
PF02518	HATPase_c	0.88

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG0692	Uracil-DNA glycosylase	Replication, recombination and repair [L]	40.71
COG1573	Uracil-DNA glycosylase	Replication, recombination and repair [L]	40.71
COG3663	G:T/U-mismatch repair DNA glycosylase	Replication, recombination and repair [L]	40.71
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.88
COG0691	tmRNA-binding protein	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG1504	Uncharacterized conserved protein, DUF498 domain	Function unknown [S]	0.88
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.88
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.88
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.88
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.88
COG3737	Uncharacterized protein, contains Mth938-like domain	Function unknown [S]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
All Organisms	root	All Organisms	48.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
cellular organisms	root	All Organisms → cellular organisms	48.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	47.79 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	43.36 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.88 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	43.36 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.88 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	28.32 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	11.50 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	0.88 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8.85 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	0.88 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas	1.77 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Chondrichthyes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Elasmobranchii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Selachii	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Galeomorphii	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Galeoidea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Orectolobiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Hemiscylliidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Chiloscyllium	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.50 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.54 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1.77 %
Chiloscyllium punctatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459012\|GOYVCMS02IZOM9	Not Available	540	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10033952	Not Available	1188	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10041849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1044	Open in IMG/M
3300005332\|Ga0066388_104385716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	719	Open in IMG/M
3300005439\|Ga0070711_100677148	Not Available	867	Open in IMG/M
3300005713\|Ga0066905_100522275	Not Available	991	Open in IMG/M
3300005719\|Ga0068861_101582866	Not Available	645	Open in IMG/M
3300005764\|Ga0066903_104596046	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	735	Open in IMG/M
3300006038\|Ga0075365_10155072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	1594	Open in IMG/M
3300006046\|Ga0066652_101846837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	544	Open in IMG/M
3300006178\|Ga0075367_10938246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	552	Open in IMG/M
3300006800\|Ga0066660_10929534	Not Available	706	Open in IMG/M
3300007076\|Ga0075435_100164411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1871	Open in IMG/M
3300009088\|Ga0099830_10834162	Not Available	761	Open in IMG/M
3300009090\|Ga0099827_10591634	Not Available	956	Open in IMG/M
3300009143\|Ga0099792_10763198	Not Available	630	Open in IMG/M
3300009545\|Ga0105237_12580612	Not Available	519	Open in IMG/M
3300009792\|Ga0126374_11382525	Not Available	572	Open in IMG/M
3300010043\|Ga0126380_11852885	Not Available	547	Open in IMG/M
3300010046\|Ga0126384_11128492	Not Available	720	Open in IMG/M
3300010162\|Ga0131853_11313682	Not Available	534	Open in IMG/M
3300010358\|Ga0126370_12321137	Not Available	531	Open in IMG/M
3300010361\|Ga0126378_10177886	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2191	Open in IMG/M
3300010361\|Ga0126378_11576201	Not Available	745	Open in IMG/M
3300010361\|Ga0126378_11784974	Not Available	699	Open in IMG/M
3300010366\|Ga0126379_11550170	Not Available	768	Open in IMG/M
3300010376\|Ga0126381_102003927	Not Available	834	Open in IMG/M
3300010376\|Ga0126381_103345904	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300010398\|Ga0126383_10529400	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1241	Open in IMG/M
3300010863\|Ga0124850_1090971	Not Available	883	Open in IMG/M
3300012096\|Ga0137389_10453200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1098	Open in IMG/M
3300012211\|Ga0137377_11380190	Not Available	633	Open in IMG/M
3300012354\|Ga0137366_10164617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1666	Open in IMG/M
3300012359\|Ga0137385_10383898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1199	Open in IMG/M
3300012362\|Ga0137361_10673987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	946	Open in IMG/M
3300012958\|Ga0164299_10951961	Not Available	628	Open in IMG/M
3300012989\|Ga0164305_11428712	Not Available	610	Open in IMG/M
3300014157\|Ga0134078_10157599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	898	Open in IMG/M
3300014968\|Ga0157379_12102221	Not Available	559	Open in IMG/M
3300015077\|Ga0173483_10631543	Not Available	594	Open in IMG/M
3300015373\|Ga0132257_101499546	Not Available	860	Open in IMG/M
3300016294\|Ga0182041_10015247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4539	Open in IMG/M
3300016357\|Ga0182032_10388546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1126	Open in IMG/M
3300016357\|Ga0182032_11138525	Not Available	670	Open in IMG/M
3300016422\|Ga0182039_10198507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1598	Open in IMG/M
3300018067\|Ga0184611_1072112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1176	Open in IMG/M
3300018431\|Ga0066655_10721716	Not Available	675	Open in IMG/M
3300018481\|Ga0190271_12909623	Not Available	575	Open in IMG/M
3300019881\|Ga0193707_1059379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1205	Open in IMG/M
3300019890\|Ga0193728_1149146	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1030	Open in IMG/M
3300021080\|Ga0210382_10051015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1628	Open in IMG/M
3300021086\|Ga0179596_10430536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	667	Open in IMG/M
3300021178\|Ga0210408_10306539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1266	Open in IMG/M
3300021178\|Ga0210408_11072057	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum	621	Open in IMG/M
3300021432\|Ga0210384_10683054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	919	Open in IMG/M
3300021479\|Ga0210410_10984880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	732	Open in IMG/M
3300021559\|Ga0210409_10470061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1119	Open in IMG/M
3300025906\|Ga0207699_10315965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1094	Open in IMG/M
3300025915\|Ga0207693_11037820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	625	Open in IMG/M
3300025925\|Ga0207650_10154864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1812	Open in IMG/M
3300026041\|Ga0207639_11730173	Not Available	586	Open in IMG/M
3300026298\|Ga0209236_1270876	Not Available	551	Open in IMG/M
3300026310\|Ga0209239_1149455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	930	Open in IMG/M
3300026327\|Ga0209266_1254605	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300026361\|Ga0257176_1089942	Not Available	504	Open in IMG/M
3300026498\|Ga0257156_1070910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	722	Open in IMG/M
3300026552\|Ga0209577_10545257	Not Available	742	Open in IMG/M
3300027986\|Ga0209168_10164646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1120	Open in IMG/M
3300028536\|Ga0137415_11221043	Not Available	567	Open in IMG/M
3300028814\|Ga0307302_10590681	Not Available	552	Open in IMG/M
3300031545\|Ga0318541_10119239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1431	Open in IMG/M
3300031561\|Ga0318528_10016219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3483	Open in IMG/M
3300031572\|Ga0318515_10259451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	932	Open in IMG/M
3300031640\|Ga0318555_10467992	Not Available	683	Open in IMG/M
3300031680\|Ga0318574_10701040	Not Available	593	Open in IMG/M
3300031682\|Ga0318560_10315254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	843	Open in IMG/M
3300031682\|Ga0318560_10534131	Not Available	635	Open in IMG/M
3300031682\|Ga0318560_10631750	Not Available	580	Open in IMG/M
3300031713\|Ga0318496_10565893	Not Available	628	Open in IMG/M
3300031719\|Ga0306917_10911409	Not Available	687	Open in IMG/M
3300031744\|Ga0306918_10289880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1258	Open in IMG/M
3300031744\|Ga0306918_10358777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1131	Open in IMG/M
3300031771\|Ga0318546_10698804	Not Available	713	Open in IMG/M
3300031771\|Ga0318546_10797964	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	664	Open in IMG/M
3300031777\|Ga0318543_10185145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	922	Open in IMG/M
3300031777\|Ga0318543_10434231	Not Available	589	Open in IMG/M
3300031777\|Ga0318543_10512579	Not Available	537	Open in IMG/M
3300031793\|Ga0318548_10094699	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1424	Open in IMG/M
3300031833\|Ga0310917_10378823	Not Available	961	Open in IMG/M
3300031879\|Ga0306919_10613481	Not Available	839	Open in IMG/M
3300031879\|Ga0306919_11484701	Not Available	510	Open in IMG/M
3300031880\|Ga0318544_10242308	Not Available	698	Open in IMG/M
3300031880\|Ga0318544_10243101	Not Available	696	Open in IMG/M
3300031890\|Ga0306925_11819706	Not Available	582	Open in IMG/M
3300031890\|Ga0306925_12158840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	519	Open in IMG/M
3300031894\|Ga0318522_10247726	Not Available	675	Open in IMG/M
3300031897\|Ga0318520_10667146	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	649	Open in IMG/M
3300031910\|Ga0306923_10065385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4047	Open in IMG/M
3300031942\|Ga0310916_10801154	Not Available	793	Open in IMG/M
3300031942\|Ga0310916_10835145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	774	Open in IMG/M
3300031954\|Ga0306926_11770107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	702	Open in IMG/M
3300032001\|Ga0306922_10589721	All Organisms → cellular organisms → Bacteria	1178	Open in IMG/M
3300032042\|Ga0318545_10007505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3193	Open in IMG/M
3300032044\|Ga0318558_10206459	Not Available	959	Open in IMG/M
3300032052\|Ga0318506_10070884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1447	Open in IMG/M
3300032054\|Ga0318570_10502094	Not Available	553	Open in IMG/M
3300032068\|Ga0318553_10699775	Not Available	530	Open in IMG/M
3300032090\|Ga0318518_10440630	Not Available	667	Open in IMG/M
3300032091\|Ga0318577_10329848	Not Available	729	Open in IMG/M
3300032261\|Ga0306920_104336027	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300033233\|Ga0334722_10499903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	873	Open in IMG/M
3300033290\|Ga0318519_10792864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	582	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.15%
Host-Associated	Host-Associated	8.85%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	87.61%
Plants	Host-Associated → Plants	7.96%
Aquatic	Environmental → Aquatic	3.54%
Arthropoda	Host-Associated → Arthropoda	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	87.61%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.54%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.65%
Freshwater	Environmental → Aquatic → Freshwater	1.77%
Roots	Host-Associated → Plants → Roots	1.77%
Marine	Environmental → Aquatic → Marine	0.89%
Sediment	Environmental → Aquatic → Sediment	0.89%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	81.42%
Loam	Environmental → Terrestrial → Soil → Loam	6.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.65%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.77%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	1.77%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%
Lake	Environmental → Aquatic → Freshwater → Lake	0.89%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.89%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.89%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.89%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	47.79%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.55%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.08%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.54%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.77%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	1.77%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.89%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.89%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	32.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	13.27%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.73%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	8.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.54%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.77%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	1.77%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.89%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.89%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.89%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.89%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459012	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass	Environmental	Open in IMG/M
3300000793	Forest soil microbial communities from Amazon forest - 2010 replicate II A001	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010162	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)	Host-Associated	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010863	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019881	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2	Environmental	Open in IMG/M
3300019890	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026327	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)	Environmental	Open in IMG/M
3300026361	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B	Environmental	Open in IMG/M
3300026498	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031880	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031894	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032042	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26	Environmental	Open in IMG/M
3300032044	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20	Environmental	Open in IMG/M
3300032052	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032062	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-90	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032090	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.25
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.25
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F082929

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
N56_07213120	2170459012	Grass Soil	VAILRASRAGGREPRERHTPQFLQRPAAPRAGGAGAPIDDDDFED
AF_2010_repII_A001DRAFT_100339523	3300000793	Forest Soil	RAAREAREPRERHTPQFLQRPAAPQRAGAGAAFNDDDDFED*
AF_2010_repII_A001DRAFT_100418491	3300000793	Forest Soil	AERAAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED*
Ga0066388_1043857162	3300005332	Tropical Forest Soil	RAAREREPRHTPQFLQRSPAPQRAGAGAGADTDDDEFDED*
Ga0070711_1006771482	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	AAREAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED*
Ga0066905_1005222751	3300005713	Tropical Forest Soil	PAERAAREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED*
Ga0068861_1015828661	3300005719	Switchgrass Rhizosphere	REPRGERHTPQFLQRPAPAPARAPAGADDDFDEE*
Ga0066903_1045960461	3300005764	Tropical Forest Soil	AARESREPRHTPQFLQRPTAPQRAGAGDDDDFEED*
Ga0075365_101550721	3300006038	Populus Endosphere	AREAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED*
Ga0066652_1018468371	3300006046	Soil	AERAAREAREPRERHTPQFLQRSTAPQRAGAGASLDDDDDFED*
Ga0075367_109382462	3300006178	Populus Endosphere	AREAREPRERHTPQFLQRSTTPQRASAGAAFDDDDEFED*
Ga0066660_109295342	3300006800	Soil	PAERAAREREPRHTPQFLQRPPAPQRVGAGAEADEDEFDED*
Ga0075435_1001644111	3300007076	Populus Rhizosphere	REPRHGSHTPQFLQRGTTPQRAPASTADDDDFED*
Ga0099830_108341622	3300009088	Vadose Zone Soil	AERAAREAREPRERHTPQFLQRSAAPQRASASAADDDDFDD*
Ga0099827_105916341	3300009090	Vadose Zone Soil	ERAAREAREPRDRHTPQFLQRSPSPQRAGAGTTVDDDDDFED*
Ga0099792_107631982	3300009143	Vadose Zone Soil	AAREAREPRERHTPQFLRRSTAPQRASAGAAFDDDDDFED*
Ga0105237_125806121	3300009545	Corn Rhizosphere	RGPREEREPGQHTPQFLQRPATPQRTGAGAPEDEFEED*
Ga0126374_113825251	3300009792	Tropical Forest Soil	DPAERAAREREPRHTPQFLQRTPAPQRAGAGADADDDEFEED*
Ga0126380_118528851	3300010043	Tropical Forest Soil	AERAAREAREPRERHTPQFLQRPAAPQRAGAGAAFNDDDDFED*
Ga0126384_111284921	3300010046	Tropical Forest Soil	EPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED*
Ga0131853_113136822	3300010162	Termite Gut	DPAERAAREPRHTPQFLQRPAAPQRAGASDDDEFEDE*
Ga0126370_123211371	3300010358	Tropical Forest Soil	RAAREAREPDERHTPQFLQRSTAPQRAGAGAAFNDDDDFED*
Ga0126378_101778861	3300010361	Tropical Forest Soil	EPAERAAREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED*
Ga0126378_115762011	3300010361	Tropical Forest Soil	AERAAREAREPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED*
Ga0126378_117849741	3300010361	Tropical Forest Soil	AERAAREAREPRERHTPQFLQRSTAPQRAGAGAPVDDDDFED*
Ga0126379_115501702	3300010366	Tropical Forest Soil	REPRERHTPQFLQHPTAPQPAGAGAPLDDDDDFED*
Ga0126381_1020039273	3300010376	Tropical Forest Soil	ERAAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDDFED*
Ga0126381_1033459041	3300010376	Tropical Forest Soil	AERAAREAREPHDRHTPQFLQRPTAPQPAGAGAPVDDDDDFED*
Ga0126383_105294001	3300010398	Tropical Forest Soil	AERAAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED*
Ga0124850_10909712	3300010863	Tropical Forest Soil	EAREPRERHTPQFLQRPAAPQRAGAGAPLDDDDDFED*
Ga0137389_104532001	3300012096	Vadose Zone Soil	RELRDRHTPQFLQRSPSPQRAGAGATLEDDDDFED*
Ga0137377_113801901	3300012211	Vadose Zone Soil	EAREPHDRHMPQFLQRPTAPQPAGAGAPLDDDDDFED*
Ga0137366_101646171	3300012354	Vadose Zone Soil	ERAAREAREPRDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED*
Ga0137385_103838981	3300012359	Vadose Zone Soil	REAREPRDRHMPQFLQRPLVPQPAGAGAPLDDDDDFED*
Ga0137361_106739873	3300012362	Vadose Zone Soil	AREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED*
Ga0164299_109519611	3300012958	Soil	RAAREAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED*
Ga0164305_114287121	3300012989	Soil	EPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED*
Ga0134078_101575991	3300014157	Grasslands Soil	AREPRERHTPQFLQRPTVPQRAGAGAGFDDDDDFED*
Ga0157379_121022212	3300014968	Switchgrass Rhizosphere	ERAAREAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED*
Ga0173483_106315431	3300015077	Soil	REAREPRERHTPQFLQRSAAPQRASASAADDDDFDD*
Ga0132257_1014995461	3300015373	Arabidopsis Rhizosphere	EPREGRGEREPRQHTPQFLQRPAAAPQRAGVVPDDDEFED*
Ga0182041_100152478	3300016294	Soil	AREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED
Ga0182032_103885461	3300016357	Soil	AREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0182032_111385253	3300016357	Soil	EAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0182039_101985074	3300016422	Soil	REAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED
Ga0184611_10721121	3300018067	Groundwater Sediment	REAREPRERHTPQFLQRPAAPQRAGAGAPIDDDDFED
Ga0066655_107217162	3300018431	Grasslands Soil	AREPRDRHMPQFLQRPLVPQPAGAGAPLDDGDDFED
Ga0190271_129096232	3300018481	Soil	EPREPREPRHVSHTPQFLQRSAAPQRAGAGAHDDDFED
Ga0193707_10593793	3300019881	Soil	RAAREAREPRERHTPQFLQRPAAPQRAGAGAPIDDDDFED
Ga0193728_11491461	3300019890	Soil	PRESRERHTPQFLHRPAAPQRAGAGAPLDDEDDFED
Ga0210382_100510153	3300021080	Groundwater Sediment	SERAAREAREPRERHTPQFLQRPAAPQRAGAGAPIDDDDFED
Ga0179596_104305362	3300021086	Vadose Zone Soil	VAREAREPRERHMPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0210408_103065391	3300021178	Soil	REPRERHMPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0210408_110720571	3300021178	Soil	AERAAREAREPRDRHTPQFLQRSAAPQRAGAGAAVDDDDDFED
Ga0210384_106830542	3300021432	Soil	REAREPRDRHMPQFLQRPLVPQPAGAGAPLDDDDDFED
Ga0210410_109848802	3300021479	Soil	IGRDPAEREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0210409_104700611	3300021559	Soil	ERAAREREPRHTPQFLQRAPAPQRAGAGAEADDDEFDED
Ga0207699_103159651	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	TMWPRDRHMPQFLQRPLVPQPAGAGAPLDDDDDFED
Ga0207693_110378202	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	AREAREPRERHMPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0207650_101548641	3300025925	Switchgrass Rhizosphere	AREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED
Ga0207639_117301731	3300026041	Corn Rhizosphere	REAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED
Ga0209236_12708761	3300026298	Grasslands Soil	AAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0209239_11494551	3300026310	Grasslands Soil	DPAERAAREAREPRDHHMPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0209266_12546052	3300026327	Soil	AAREAREPRGDRHTPQFLQRSAVPQRAGAGASADDDDDFED
Ga0257176_10899421	3300026361	Soil	EAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED
Ga0257156_10709103	3300026498	Soil	EAREPRERHMPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0209577_105452571	3300026552	Soil	AERAAREAHEPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0209168_101646463	3300027986	Surface Soil	SAREPRDGREGREPRPHTPQFLQRPTAPQRAGAGAPEDDEFENE
Ga0137415_112210432	3300028536	Vadose Zone Soil	REAREPRERHTPQFLQRSAAPQRAGAGAAADDDDDFED
Ga0307302_105906812	3300028814	Soil	QSKIGRDPAERVAREARHTPQFLQRGAPQHVGAEDDDEFAED
Ga0318541_101192393	3300031545	Soil	RKAREPRERHTPQFLQRSTTPQRAGAGAPLDDDDFED
Ga0318528_100162191	3300031561	Soil	AERAAREAREPHDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0318515_102594511	3300031572	Soil	AREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED
Ga0318555_104679921	3300031640	Soil	REAREPRERHTPQFLQRAPSPQRAGAGAALDDDDDFDD
Ga0318574_107010401	3300031680	Soil	PAERAAREAREPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0318560_103152542	3300031682	Soil	REPRERHTPQFLQRSTAPQRAGAGAPLDDDDDFGD
Ga0318560_105341311	3300031682	Soil	AREAREPRDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0318560_106317502	3300031682	Soil	AAREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED
Ga0318496_105658932	3300031713	Soil	EAREPRGDRHTPQFLQRSTAPQRAPAGAAVDDDDDFED
Ga0306917_109114093	3300031719	Soil	AAREAREPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0306918_102898801	3300031744	Soil	RAAREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED
Ga0306918_103587773	3300031744	Soil	AREAREPRERHTPQFLQRPAAPQRAGAGAPLDDDDFED
Ga0318546_106988041	3300031771	Soil	PAERGTREPHDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0318546_107979641	3300031771	Soil	AERAAREAREPRDRHMPQFLQRPLAPQPAGAGAPLDDDDDFED
Ga0318543_101851451	3300031777	Soil	RAAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED
Ga0318543_104342312	3300031777	Soil	RAAREREPRHTPQFLQRAPAPQRAGAGAEADDDEFDED
Ga0318543_105125791	3300031777	Soil	RGTREAREPHDRHTPQFLQRSTAPQRAGAGAPLDDDDDFED
Ga0318548_100946993	3300031793	Soil	ERAAREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED
Ga0310917_103788231	3300031833	Soil	AREAREPRDRHMPQFLQRPTAPQPAGAGAPLDDDDDCED
Ga0306919_106134812	3300031879	Soil	AERAAREAREPRERHTPQFLQRPAAPQRAGAGAAFNDDDDLED
Ga0306919_114847011	3300031879	Soil	AERAAREAREPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0318544_102423083	3300031880	Soil	REPRDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0318544_102431011	3300031880	Soil	ERGTREAREPHDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0306925_118197062	3300031890	Soil	REAREPRDRHMPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0306925_121588402	3300031890	Soil	REPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0318522_102477261	3300031894	Soil	DPAERGTREPHDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0318520_106671462	3300031897	Soil	REPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0306923_100653859	3300031910	Soil	REAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0310916_108011541	3300031942	Soil	AERAAREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0310916_108351452	3300031942	Soil	PAERAAREAREPHDRHTPQFLQRPTAPQPASAGAPLDDDDDFED
Ga0306926_117701072	3300031954	Soil	ERAAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0306922_105897211	3300032001	Soil	ERAAREAREPRERHTPQFLQRPAAPQRAGAGAPLDDDDDFED
Ga0318545_100075051	3300032042	Soil	REPHDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0318558_102064591	3300032044	Soil	AREPRDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED
Ga0318506_100708841	3300032052	Soil	AERAAREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED
Ga0318570_105020942	3300032054	Soil	AREPRERHTPQFLQRAPSPQRAGAGAALDDDDDFDD
Ga0315551_100996211	3300032062	Salt Marsh Sediment	ARGPRENHRDDGHTPQFLQRPATPQRAGAGAGAPVDDEDEFED
Ga0318553_106997751	3300032068	Soil	PAERAAREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0318518_104406302	3300032090	Soil	AREARELRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0318577_103298482	3300032091	Soil	ARELRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED
Ga0306920_1043360271	3300032261	Soil	EAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDDFGD
Ga0334722_104999033	3300033233	Sediment	REGREPRPHTPQFLQRGPTPQRAPAPAGAADEDFED
Ga0318519_107928641	3300033290	Soil	REAREPRERHTPQFLQRSTAPQPAGAGAPLDDDDDFED

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign