NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082917

Metagenome / Metatranscriptome Family F082917

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082917
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 41 residues
Representative Sequence MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAF
Number of Associated Samples 99
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 61.61 %
% of genes near scaffold ends (potentially truncated) 99.12 %
% of genes from short scaffolds (< 2000 bps) 79.65 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.407 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(25.664 % of family members)
Environment Ontology (ENVO) Unclassified
(78.761 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.611 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13385Laminin_G_3 8.85
PF16778Phage_tail_APC 2.65
PF01833TIG 1.77
PF00622SPRY 1.77
PF05345He_PIG 1.77
PF12810Gly_rich 0.88
PF04820Trp_halogenase 0.88
PF137592OG-FeII_Oxy_5 0.88



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.41 %
All OrganismsrootAll Organisms39.82 %
unclassified Hyphomonasno rankunclassified Hyphomonas1.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10025063All Organisms → Viruses → Predicted Viral2743Open in IMG/M
3300000265|LP_A_09_P04_10DRAFT_1047605Not Available648Open in IMG/M
3300000949|BBAY94_10033719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC121P1433Open in IMG/M
3300001355|JGI20158J14315_10065152All Organisms → Viruses → Predicted Viral1425Open in IMG/M
3300001460|JGI24003J15210_10068373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C1361116Open in IMG/M
3300006090|Ga0082015_1011186All Organisms → Viruses → Predicted Viral1550Open in IMG/M
3300006191|Ga0075447_10034372Not Available1935Open in IMG/M
3300006193|Ga0075445_10132994Not Available904Open in IMG/M
3300006405|Ga0075510_10074240Not Available514Open in IMG/M
3300006565|Ga0100228_1031801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P4090Open in IMG/M
3300006735|Ga0098038_1146785unclassified Hyphomonas → Hyphomonas sp.788Open in IMG/M
3300006749|Ga0098042_1040909Not Available1283Open in IMG/M
3300006749|Ga0098042_1041840unclassified Hyphomonas → Hyphomonas sp.1265Open in IMG/M
3300006802|Ga0070749_10091482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus1806Open in IMG/M
3300006802|Ga0070749_10120509All Organisms → Viruses → Predicted Viral1541Open in IMG/M
3300006916|Ga0070750_10091173Not Available1421Open in IMG/M
3300006921|Ga0098060_1038071Not Available1448Open in IMG/M
3300006921|Ga0098060_1227055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC121P507Open in IMG/M
3300006924|Ga0098051_1051551Not Available1137Open in IMG/M
3300006924|Ga0098051_1088376Not Available836Open in IMG/M
3300007541|Ga0099848_1022243Not Available2696Open in IMG/M
3300007541|Ga0099848_1239199Not Available639Open in IMG/M
3300007640|Ga0070751_1073584All Organisms → Viruses → Predicted Viral1447Open in IMG/M
3300009001|Ga0102963_1010588All Organisms → Viruses3938Open in IMG/M
3300009071|Ga0115566_10396130Not Available797Open in IMG/M
3300009172|Ga0114995_10829054Not Available507Open in IMG/M
3300009420|Ga0114994_10793145Not Available616Open in IMG/M
3300009498|Ga0115568_10017344All Organisms → Viruses → Predicted Viral4201Open in IMG/M
3300009507|Ga0115572_10651049Not Available578Open in IMG/M
3300009526|Ga0115004_10101841Not Available1763Open in IMG/M
3300009526|Ga0115004_10105809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus1724Open in IMG/M
3300009593|Ga0115011_10250663All Organisms → Viruses → Predicted Viral1328Open in IMG/M
3300009790|Ga0115012_10185249Not Available1519Open in IMG/M
3300010148|Ga0098043_1059826Not Available1152Open in IMG/M
3300010153|Ga0098059_1067272Not Available1433Open in IMG/M
3300010883|Ga0133547_11538159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae1246Open in IMG/M
3300012920|Ga0160423_10098307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae2071Open in IMG/M
3300012953|Ga0163179_10213535Not Available1484Open in IMG/M
3300017697|Ga0180120_10298848Not Available645Open in IMG/M
3300017713|Ga0181391_1004669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales3712Open in IMG/M
3300017714|Ga0181412_1036675Not Available1293Open in IMG/M
3300017719|Ga0181390_1051859All Organisms → Viruses → Predicted Viral1202Open in IMG/M
3300017737|Ga0187218_1005100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales3697Open in IMG/M
3300017743|Ga0181402_1007229All Organisms → Viruses → Predicted Viral3456Open in IMG/M
3300017743|Ga0181402_1147906Not Available596Open in IMG/M
3300017748|Ga0181393_1087240All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon813Open in IMG/M
3300017751|Ga0187219_1019030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P2532Open in IMG/M
3300017769|Ga0187221_1116329Not Available808Open in IMG/M
3300017776|Ga0181394_1042896Not Available1545Open in IMG/M
3300017782|Ga0181380_1038809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aestuariivita → unclassified Aestuariivita → Aestuariivita sp.1729Open in IMG/M
3300017956|Ga0181580_10652053Not Available674Open in IMG/M
3300017969|Ga0181585_10488878Not Available827Open in IMG/M
3300018041|Ga0181601_10267807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage963Open in IMG/M
3300018048|Ga0181606_10062654Not Available2473Open in IMG/M
3300018424|Ga0181591_10752651Not Available681Open in IMG/M
3300020377|Ga0211647_10223501Not Available604Open in IMG/M
3300020385|Ga0211677_10167993Not Available923Open in IMG/M
3300020416|Ga0211644_10223645Not Available772Open in IMG/M
3300020457|Ga0211643_10058271Not Available1919Open in IMG/M
3300020469|Ga0211577_10293371All Organisms → Viruses → Predicted Viral1033Open in IMG/M
3300020472|Ga0211579_10051471All Organisms → Viruses → Predicted Viral2555Open in IMG/M
3300021368|Ga0213860_10108990Not Available1212Open in IMG/M
3300021375|Ga0213869_10438478Not Available527Open in IMG/M
3300021957|Ga0222717_10170312Not Available1311Open in IMG/M
3300021959|Ga0222716_10192621All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Foussvirus → Foussvirus S46C101297Open in IMG/M
3300021960|Ga0222715_10117021All Organisms → Viruses → Predicted Viral1698Open in IMG/M
3300021961|Ga0222714_10144447All Organisms → Viruses → Predicted Viral1436Open in IMG/M
3300021962|Ga0222713_10530182Not Available699Open in IMG/M
3300022068|Ga0212021_1015207Not Available1378Open in IMG/M
3300022164|Ga0212022_1071646Not Available532Open in IMG/M
3300022168|Ga0212027_1050715Not Available520Open in IMG/M
(restricted) 3300024264|Ga0233444_10039527All Organisms → Viruses → Predicted Viral2969Open in IMG/M
3300025108|Ga0208793_1038565Not Available1537Open in IMG/M
3300025120|Ga0209535_1013887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae4353Open in IMG/M
3300025120|Ga0209535_1054462Not Available1679Open in IMG/M
3300025120|Ga0209535_1058489Not Available1590Open in IMG/M
3300025137|Ga0209336_10107131Not Available781Open in IMG/M
3300025138|Ga0209634_1068559Not Available1676Open in IMG/M
3300025138|Ga0209634_1076585Not Available1551Open in IMG/M
3300025138|Ga0209634_1191158All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300025543|Ga0208303_1113564Not Available555Open in IMG/M
3300025543|Ga0208303_1121555Not Available525Open in IMG/M
3300025626|Ga0209716_1029050All Organisms → Viruses → Predicted Viral2076Open in IMG/M
3300025646|Ga0208161_1030928Not Available1886Open in IMG/M
3300025652|Ga0208134_1111443Not Available741Open in IMG/M
3300025674|Ga0208162_1007250All Organisms → Viruses → Predicted Viral4931Open in IMG/M
3300025687|Ga0208019_1058947Not Available1296Open in IMG/M
3300025759|Ga0208899_1069803Not Available1411Open in IMG/M
3300025771|Ga0208427_1057032All Organisms → Viruses → Predicted Viral1423Open in IMG/M
3300025816|Ga0209193_1089270Not Available783Open in IMG/M
3300025818|Ga0208542_1039922All Organisms → Viruses → Predicted Viral1496Open in IMG/M
3300025822|Ga0209714_1124898Not Available683Open in IMG/M
3300025853|Ga0208645_1025754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Votkovvirus → unclassified Votkovvirus → Pelagibacter phage HTVC200P3136Open in IMG/M
3300025853|Ga0208645_1051613Not Available1956Open in IMG/M
3300026187|Ga0209929_1142658Not Available590Open in IMG/M
3300026258|Ga0208130_1071652Not Available1016Open in IMG/M
3300027298|Ga0208970_1069559Not Available576Open in IMG/M
3300027308|Ga0208796_1066620Not Available782Open in IMG/M
3300027668|Ga0209482_1023479All Organisms → Viruses2608Open in IMG/M
3300027752|Ga0209192_10289907Not Available593Open in IMG/M
3300029309|Ga0183683_1005712All Organisms → Viruses → Predicted Viral3731Open in IMG/M
3300029309|Ga0183683_1010334All Organisms → Viruses → Predicted Viral2384Open in IMG/M
3300031167|Ga0308023_1040274All Organisms → Viruses912Open in IMG/M
3300031539|Ga0307380_11216981Not Available582Open in IMG/M
3300031565|Ga0307379_10733405All Organisms → Viruses882Open in IMG/M
3300031602|Ga0307993_1165579Not Available554Open in IMG/M
3300031626|Ga0302121_10083804Not Available950Open in IMG/M
3300031628|Ga0308014_1005324All Organisms → Viruses3603Open in IMG/M
3300031658|Ga0307984_1009046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC121P3648Open in IMG/M
3300031687|Ga0308008_1054890Not Available947Open in IMG/M
3300031689|Ga0308017_1074646Not Available704Open in IMG/M
3300034418|Ga0348337_042629All Organisms → Viruses1923Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.66%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous19.47%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.62%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.73%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.31%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.31%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.42%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.42%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.77%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.77%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.77%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.77%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.89%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.89%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.89%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.89%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.89%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000265Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300006090Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124EnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006565Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125mEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020377Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020416Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026258Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes)EnvironmentalOpen in IMG/M
3300027298Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031687Marine microbial communities from water near the shore, Antarctic Ocean - #125EnvironmentalOpen in IMG/M
3300031689Marine microbial communities from water near the shore, Antarctic Ocean - #280EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1002506313300000115MarineMAYIGQGLDRFSNVEKLDVITPATATGAGPYNLTKGSVAFVPSS
LP_A_09_P04_10DRAFT_104760513300000265MarineMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKGSV
BBAY94_1003371913300000949Macroalgal SurfaceMAYIGQNLDRFSNVEKLDVITPSTATGAGPYNLTQNSTAFTPVNANS
JGI20158J14315_1006515223300001355Pelagic MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTK
JGI24003J15210_1006837333300001460MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSV
Ga0082015_101118623300006090MarineMAYIGRNLEQFSNVEKLDAITPATATGAGPYNLTQNSTAFTPVNA
Ga0075447_1003437243300006191MarineMAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAFIPSSAET
Ga0075445_1013299413300006193MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKA
Ga0075510_1007424023300006405AqueousMAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTK
Ga0100228_103180153300006565MarineMAYIGQNLDRFSNVEKLDVITPSTATGAGPYNLTQNS
Ga0098038_114678513300006735MarineMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFT
Ga0098042_104090913300006749MarineMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFTPSSSD
Ga0098042_104184013300006749MarineMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKG
Ga0070749_1009148213300006802AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNSVAF
Ga0070749_1012050913300006802AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNSVAFV
Ga0070750_1009117323300006916AqueousMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGSVAFTPSSA
Ga0098060_103807113300006921MarineMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFTPSSADTM
Ga0098060_122705513300006921MarineMAYIGQGLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFTPSS
Ga0098051_105155113300006924MarineMAYIGQGLNRFSNVEKLDAITPSTSTGAGPYNLTKGGVAF
Ga0098051_108837613300006924MarineMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGGVAFTPS
Ga0099848_102224313300007541AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAF
Ga0099848_123919913300007541AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAFVPASAD
Ga0070751_107358423300007640AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAFVPAS
Ga0102963_101058813300009001Pond WaterMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVAFTPSSADTM
Ga0115566_1039613033300009071Pelagic MarineMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTK
Ga0114995_1082905423300009172MarineMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKASVAFVPASA
Ga0114994_1079314513300009420MarineMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKASVAF
Ga0115568_1001734413300009498Pelagic MarineMAYIGQGIDRFSNVEKLDAITPATATGAGPYNLTKGSVAFTPSSADTM
Ga0115572_1065104913300009507Pelagic MarineMAYIGRGIENLVNTQKLDVITPSTATGVGPYNLTQNSVAF
Ga0115004_1010184113300009526MarineMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKASVAFVPS
Ga0115004_1010580913300009526MarineMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKAS
Ga0115011_1025066323300009593MarineMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLLKGGVAFTPS
Ga0115105_1052955713300009679MarineMAYIGQGIEQFSNVEKLDNITFTNSAGPYNLTKGSAAFTPSSVQSLLIQVDG
Ga0115012_1018524923300009790MarineMAYIGQGLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFT
Ga0098043_105982613300010148MarineMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFTPSS
Ga0098059_106727233300010153MarineMAYIGQNLDRFSNVEKLDVITPATATGAGPYNLTQNSTAFTPV
Ga0133547_1153815933300010883MarineMAYIGQNLDRFSIVEKLDVITTATATGAGHYNLTKDSVAFVPAT
Ga0160423_1009830713300012920Surface SeawaterMAYIGQGIDRFSNVEKLDAITPSTSTGAGPYNLTKG
Ga0163179_1021353513300012953SeawaterMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLLKGGVA
Ga0180120_1029884833300017697Freshwater To Marine Saline GradientMAYIGQNLNRFSNVEKLDAITPATSTGAGPYNLLK
Ga0181391_100466913300017713SeawaterMAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTKGSVAF
Ga0181412_103667513300017714SeawaterMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVA
Ga0181390_105185923300017719SeawaterMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVAFTPSSA
Ga0187218_100510053300017737SeawaterMAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTK
Ga0181402_100722963300017743SeawaterMAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTKGSVAFTPSSADT
Ga0181402_114790613300017743SeawaterMAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTKGS
Ga0181393_108724013300017748SeawaterMAYIGQNLDRFSNVEKLDAITPATATGAGTYNLTKGG
Ga0187219_101903013300017751SeawaterMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLLKGGVAFT
Ga0187221_111632923300017769SeawaterMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGG
Ga0181394_104289623300017776SeawaterMAYIGQGLDRFSNVEKLDAITPATATGAGPYNLTKGGVAFTPSSADT
Ga0181380_103880913300017782SeawaterMAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTKGSVAFTPSS
Ga0181580_1065205313300017956Salt MarshMAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDS
Ga0181585_1048887813300017969Salt MarshMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVA
Ga0181601_1026780713300018041Salt MarshMAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDSVA
Ga0181606_1006265413300018048Salt MarshMAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKD
Ga0181591_1075265133300018424Salt MarshMAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDSV
Ga0211647_1022350113300020377MarineMAYIGQGLDRFSNVEKLDVITPATSTGAGPYNLTKGG
Ga0211677_1016799313300020385MarineMAYIGRGIENLLNTQKLDAITPATATGAGPYNLTQNSVAFVPASADS
Ga0211644_1022364533300020416MarineLGDSXIMAYIGRGIENLLNTQKLDAITPSTSTGAGPYNLTQNST
Ga0211643_1005827133300020457MarineMAYIGQNLDRFSSVEKLDAITPSTSTGAGPYNLTKGGVAFTPSS
Ga0211577_1029337113300020469MarineMAYIGQNLDRFSNVEKLDVITPSTSTGAGPYNLTKGSVAFT
Ga0211579_1005147113300020472MarineMAYIGQNLDRFSNVEKLDVITPSTATGAGPYNLTQNSTAFTPIN
Ga0213860_1010899013300021368SeawaterMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKG
Ga0213869_1043847823300021375SeawaterMAYIGQGLNRFSNVEKLDAITPATATGAGPYNLLKGG
Ga0222717_1017031213300021957Estuarine WaterMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKG
Ga0222716_1019262113300021959Estuarine WaterMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGV
Ga0222715_1011702133300021960Estuarine WaterMAYIGRGIENLVNTQKLDVITPSTATGAGPYNLTKD
Ga0222714_1014444743300021961Estuarine WaterMAYIGRGIENLVNTQRLDVITPSTATGAGPYNLTKNSIAFV
Ga0222713_1053018213300021962Estuarine WaterMAYIGRGIENLVNTQKLDVITPSTATGVGPYNLTQNSVA
Ga0212021_101520723300022068AqueousMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVAFT
Ga0212022_107164623300022164AqueousMAYIGQNLDRFSNVEKLDAITPSTATGAGPYNLTKGSVAFTPSSADIP
Ga0212027_105071523300022168AqueousMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGSVAFTPS
(restricted) Ga0233444_1003952713300024264SeawaterMAYIGRGIENLVNTQKLDAITPSTSTGAGPYNLTQNSVAFVP
Ga0208793_103856513300025108MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKG
Ga0209535_101388763300025120MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAFVPSSA
Ga0209535_105446243300025120MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAF
Ga0209535_105848923300025120MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVA
Ga0209336_1010713113300025137MarineMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTK
Ga0209634_106855913300025138MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAFVP
Ga0209634_107658523300025138MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAFVPSS
Ga0209634_119115833300025138MarineMAYIGRGIENLLNTQKLDVITPATATGAGPYNLTQNSVAFV
Ga0208303_111356423300025543AqueousMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVAF
Ga0208303_112155533300025543AqueousMAYIGRGIENLINAQKLDVITPSTATGVGPYNLTQNSVAFVPSSAD
Ga0209716_102905033300025626Pelagic MarineMAYIGRGIENLINAQKLDAITPSTATGVGPYNLTQNSVAFVP
Ga0208161_103092813300025646AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAFVP
Ga0208134_111144313300025652AqueousMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAFTPSS
Ga0208162_100725013300025674AqueousMAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDSVAFVPASAEQM
Ga0208019_105894713300025687AqueousMAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDSVAFVP
Ga0208899_106980313300025759AqueousMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGSV
Ga0208427_105703213300025771AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNS
Ga0209193_108927023300025816Pelagic MarineMAYIGRGIENLLNTQKLDAITPATATGAGPYNLTQNSVALVQLLHLVQH
Ga0208542_103992223300025818AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNSVAFVPASADQ
Ga0209714_112489813300025822Pelagic MarineMAYIGQGLDRFSNVEKLDAITPATATGAGPYNLTKGSVAFTPS
Ga0208645_102575413300025853AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNSVA
Ga0208645_105161313300025853AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTK
Ga0209929_114265813300026187Pond WaterMAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKG
Ga0208130_107165213300026258MarineMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVA
Ga0208970_106955933300027298MarineMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKGSVAF
Ga0208796_106662013300027308EstuarineMAYIGQGLNRFSNVEKLDVIIPATATGAGPYNLTKGSVAFVPSSA
Ga0209482_102347913300027668MarineMAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAFIPSSAETM
Ga0209192_1028990713300027752MarineMAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKGSVA
Ga0183683_100571213300029309MarineMAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGV
Ga0183683_101033433300029309MarineMAYIGQNLDRFSNVEKLDVITPSTSTGAGPYNLTKGGVAFTPS
Ga0308023_104027413300031167MarineMAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAFIP
Ga0307380_1121698133300031539SoilMAYIGRGIENLINAQKLDVITPSTATGAGPYNLTQNSVAFV
Ga0307379_1073340533300031565SoilMAYIGRGIENLINAQKLDAITPSTATGVGPYNLTQNSVAFVPA
Ga0307993_116557913300031602MarineMAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAFVPSS
Ga0302121_1008380413300031626MarineMAYIGRGIQNLLNAQKLDAITPSTATGVGPYNLTQNSIAFVPA
Ga0308014_100532413300031628MarineMAYIGQGLDRFSNVEKLDVITPATATGAGPYNLTKASVAFVPSSAD
Ga0307984_100904663300031658MarineMAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAF
Ga0308008_105489013300031687MarineMAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKASVAFVP
Ga0308017_107464613300031689MarineMAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKAS
Ga0348337_042629_1795_19233300034418AqueousMAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAFVPA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.