| Basic Information | |
|---|---|
| Family ID | F082917 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAF |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.61 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 79.65 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.407 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.664 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.761 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.611 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 8.85 |
| PF16778 | Phage_tail_APC | 2.65 |
| PF01833 | TIG | 1.77 |
| PF00622 | SPRY | 1.77 |
| PF05345 | He_PIG | 1.77 |
| PF12810 | Gly_rich | 0.88 |
| PF04820 | Trp_halogenase | 0.88 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.41 % |
| All Organisms | root | All Organisms | 39.82 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10025063 | All Organisms → Viruses → Predicted Viral | 2743 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1047605 | Not Available | 648 | Open in IMG/M |
| 3300000949|BBAY94_10033719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC121P | 1433 | Open in IMG/M |
| 3300001355|JGI20158J14315_10065152 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
| 3300001460|JGI24003J15210_10068373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C136 | 1116 | Open in IMG/M |
| 3300006090|Ga0082015_1011186 | All Organisms → Viruses → Predicted Viral | 1550 | Open in IMG/M |
| 3300006191|Ga0075447_10034372 | Not Available | 1935 | Open in IMG/M |
| 3300006193|Ga0075445_10132994 | Not Available | 904 | Open in IMG/M |
| 3300006405|Ga0075510_10074240 | Not Available | 514 | Open in IMG/M |
| 3300006565|Ga0100228_1031801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 4090 | Open in IMG/M |
| 3300006735|Ga0098038_1146785 | unclassified Hyphomonas → Hyphomonas sp. | 788 | Open in IMG/M |
| 3300006749|Ga0098042_1040909 | Not Available | 1283 | Open in IMG/M |
| 3300006749|Ga0098042_1041840 | unclassified Hyphomonas → Hyphomonas sp. | 1265 | Open in IMG/M |
| 3300006802|Ga0070749_10091482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 1806 | Open in IMG/M |
| 3300006802|Ga0070749_10120509 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
| 3300006916|Ga0070750_10091173 | Not Available | 1421 | Open in IMG/M |
| 3300006921|Ga0098060_1038071 | Not Available | 1448 | Open in IMG/M |
| 3300006921|Ga0098060_1227055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC121P | 507 | Open in IMG/M |
| 3300006924|Ga0098051_1051551 | Not Available | 1137 | Open in IMG/M |
| 3300006924|Ga0098051_1088376 | Not Available | 836 | Open in IMG/M |
| 3300007541|Ga0099848_1022243 | Not Available | 2696 | Open in IMG/M |
| 3300007541|Ga0099848_1239199 | Not Available | 639 | Open in IMG/M |
| 3300007640|Ga0070751_1073584 | All Organisms → Viruses → Predicted Viral | 1447 | Open in IMG/M |
| 3300009001|Ga0102963_1010588 | All Organisms → Viruses | 3938 | Open in IMG/M |
| 3300009071|Ga0115566_10396130 | Not Available | 797 | Open in IMG/M |
| 3300009172|Ga0114995_10829054 | Not Available | 507 | Open in IMG/M |
| 3300009420|Ga0114994_10793145 | Not Available | 616 | Open in IMG/M |
| 3300009498|Ga0115568_10017344 | All Organisms → Viruses → Predicted Viral | 4201 | Open in IMG/M |
| 3300009507|Ga0115572_10651049 | Not Available | 578 | Open in IMG/M |
| 3300009526|Ga0115004_10101841 | Not Available | 1763 | Open in IMG/M |
| 3300009526|Ga0115004_10105809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 1724 | Open in IMG/M |
| 3300009593|Ga0115011_10250663 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300009790|Ga0115012_10185249 | Not Available | 1519 | Open in IMG/M |
| 3300010148|Ga0098043_1059826 | Not Available | 1152 | Open in IMG/M |
| 3300010153|Ga0098059_1067272 | Not Available | 1433 | Open in IMG/M |
| 3300010883|Ga0133547_11538159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1246 | Open in IMG/M |
| 3300012920|Ga0160423_10098307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 2071 | Open in IMG/M |
| 3300012953|Ga0163179_10213535 | Not Available | 1484 | Open in IMG/M |
| 3300017697|Ga0180120_10298848 | Not Available | 645 | Open in IMG/M |
| 3300017713|Ga0181391_1004669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3712 | Open in IMG/M |
| 3300017714|Ga0181412_1036675 | Not Available | 1293 | Open in IMG/M |
| 3300017719|Ga0181390_1051859 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300017737|Ga0187218_1005100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3697 | Open in IMG/M |
| 3300017743|Ga0181402_1007229 | All Organisms → Viruses → Predicted Viral | 3456 | Open in IMG/M |
| 3300017743|Ga0181402_1147906 | Not Available | 596 | Open in IMG/M |
| 3300017748|Ga0181393_1087240 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 813 | Open in IMG/M |
| 3300017751|Ga0187219_1019030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 2532 | Open in IMG/M |
| 3300017769|Ga0187221_1116329 | Not Available | 808 | Open in IMG/M |
| 3300017776|Ga0181394_1042896 | Not Available | 1545 | Open in IMG/M |
| 3300017782|Ga0181380_1038809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aestuariivita → unclassified Aestuariivita → Aestuariivita sp. | 1729 | Open in IMG/M |
| 3300017956|Ga0181580_10652053 | Not Available | 674 | Open in IMG/M |
| 3300017969|Ga0181585_10488878 | Not Available | 827 | Open in IMG/M |
| 3300018041|Ga0181601_10267807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
| 3300018048|Ga0181606_10062654 | Not Available | 2473 | Open in IMG/M |
| 3300018424|Ga0181591_10752651 | Not Available | 681 | Open in IMG/M |
| 3300020377|Ga0211647_10223501 | Not Available | 604 | Open in IMG/M |
| 3300020385|Ga0211677_10167993 | Not Available | 923 | Open in IMG/M |
| 3300020416|Ga0211644_10223645 | Not Available | 772 | Open in IMG/M |
| 3300020457|Ga0211643_10058271 | Not Available | 1919 | Open in IMG/M |
| 3300020469|Ga0211577_10293371 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300020472|Ga0211579_10051471 | All Organisms → Viruses → Predicted Viral | 2555 | Open in IMG/M |
| 3300021368|Ga0213860_10108990 | Not Available | 1212 | Open in IMG/M |
| 3300021375|Ga0213869_10438478 | Not Available | 527 | Open in IMG/M |
| 3300021957|Ga0222717_10170312 | Not Available | 1311 | Open in IMG/M |
| 3300021959|Ga0222716_10192621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Foussvirus → Foussvirus S46C10 | 1297 | Open in IMG/M |
| 3300021960|Ga0222715_10117021 | All Organisms → Viruses → Predicted Viral | 1698 | Open in IMG/M |
| 3300021961|Ga0222714_10144447 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
| 3300021962|Ga0222713_10530182 | Not Available | 699 | Open in IMG/M |
| 3300022068|Ga0212021_1015207 | Not Available | 1378 | Open in IMG/M |
| 3300022164|Ga0212022_1071646 | Not Available | 532 | Open in IMG/M |
| 3300022168|Ga0212027_1050715 | Not Available | 520 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10039527 | All Organisms → Viruses → Predicted Viral | 2969 | Open in IMG/M |
| 3300025108|Ga0208793_1038565 | Not Available | 1537 | Open in IMG/M |
| 3300025120|Ga0209535_1013887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 4353 | Open in IMG/M |
| 3300025120|Ga0209535_1054462 | Not Available | 1679 | Open in IMG/M |
| 3300025120|Ga0209535_1058489 | Not Available | 1590 | Open in IMG/M |
| 3300025137|Ga0209336_10107131 | Not Available | 781 | Open in IMG/M |
| 3300025138|Ga0209634_1068559 | Not Available | 1676 | Open in IMG/M |
| 3300025138|Ga0209634_1076585 | Not Available | 1551 | Open in IMG/M |
| 3300025138|Ga0209634_1191158 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300025543|Ga0208303_1113564 | Not Available | 555 | Open in IMG/M |
| 3300025543|Ga0208303_1121555 | Not Available | 525 | Open in IMG/M |
| 3300025626|Ga0209716_1029050 | All Organisms → Viruses → Predicted Viral | 2076 | Open in IMG/M |
| 3300025646|Ga0208161_1030928 | Not Available | 1886 | Open in IMG/M |
| 3300025652|Ga0208134_1111443 | Not Available | 741 | Open in IMG/M |
| 3300025674|Ga0208162_1007250 | All Organisms → Viruses → Predicted Viral | 4931 | Open in IMG/M |
| 3300025687|Ga0208019_1058947 | Not Available | 1296 | Open in IMG/M |
| 3300025759|Ga0208899_1069803 | Not Available | 1411 | Open in IMG/M |
| 3300025771|Ga0208427_1057032 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300025816|Ga0209193_1089270 | Not Available | 783 | Open in IMG/M |
| 3300025818|Ga0208542_1039922 | All Organisms → Viruses → Predicted Viral | 1496 | Open in IMG/M |
| 3300025822|Ga0209714_1124898 | Not Available | 683 | Open in IMG/M |
| 3300025853|Ga0208645_1025754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Votkovvirus → unclassified Votkovvirus → Pelagibacter phage HTVC200P | 3136 | Open in IMG/M |
| 3300025853|Ga0208645_1051613 | Not Available | 1956 | Open in IMG/M |
| 3300026187|Ga0209929_1142658 | Not Available | 590 | Open in IMG/M |
| 3300026258|Ga0208130_1071652 | Not Available | 1016 | Open in IMG/M |
| 3300027298|Ga0208970_1069559 | Not Available | 576 | Open in IMG/M |
| 3300027308|Ga0208796_1066620 | Not Available | 782 | Open in IMG/M |
| 3300027668|Ga0209482_1023479 | All Organisms → Viruses | 2608 | Open in IMG/M |
| 3300027752|Ga0209192_10289907 | Not Available | 593 | Open in IMG/M |
| 3300029309|Ga0183683_1005712 | All Organisms → Viruses → Predicted Viral | 3731 | Open in IMG/M |
| 3300029309|Ga0183683_1010334 | All Organisms → Viruses → Predicted Viral | 2384 | Open in IMG/M |
| 3300031167|Ga0308023_1040274 | All Organisms → Viruses | 912 | Open in IMG/M |
| 3300031539|Ga0307380_11216981 | Not Available | 582 | Open in IMG/M |
| 3300031565|Ga0307379_10733405 | All Organisms → Viruses | 882 | Open in IMG/M |
| 3300031602|Ga0307993_1165579 | Not Available | 554 | Open in IMG/M |
| 3300031626|Ga0302121_10083804 | Not Available | 950 | Open in IMG/M |
| 3300031628|Ga0308014_1005324 | All Organisms → Viruses | 3603 | Open in IMG/M |
| 3300031658|Ga0307984_1009046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC121P | 3648 | Open in IMG/M |
| 3300031687|Ga0308008_1054890 | Not Available | 947 | Open in IMG/M |
| 3300031689|Ga0308017_1074646 | Not Available | 704 | Open in IMG/M |
| 3300034418|Ga0348337_042629 | All Organisms → Viruses | 1923 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.66% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.47% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.62% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.31% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.31% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.42% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.77% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.77% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.77% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.89% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.89% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300027298 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027308 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
| 3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100250631 | 3300000115 | Marine | MAYIGQGLDRFSNVEKLDVITPATATGAGPYNLTKGSVAFVPSS |
| LP_A_09_P04_10DRAFT_10476051 | 3300000265 | Marine | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKGSV |
| BBAY94_100337191 | 3300000949 | Macroalgal Surface | MAYIGQNLDRFSNVEKLDVITPSTATGAGPYNLTQNSTAFTPVNANS |
| JGI20158J14315_100651522 | 3300001355 | Pelagic Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTK |
| JGI24003J15210_100683733 | 3300001460 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSV |
| Ga0082015_10111862 | 3300006090 | Marine | MAYIGRNLEQFSNVEKLDAITPATATGAGPYNLTQNSTAFTPVNA |
| Ga0075447_100343724 | 3300006191 | Marine | MAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAFIPSSAET |
| Ga0075445_101329941 | 3300006193 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKA |
| Ga0075510_100742402 | 3300006405 | Aqueous | MAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTK |
| Ga0100228_10318015 | 3300006565 | Marine | MAYIGQNLDRFSNVEKLDVITPSTATGAGPYNLTQNS |
| Ga0098038_11467851 | 3300006735 | Marine | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFT |
| Ga0098042_10409091 | 3300006749 | Marine | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFTPSSSD |
| Ga0098042_10418401 | 3300006749 | Marine | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKG |
| Ga0070749_100914821 | 3300006802 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNSVAF |
| Ga0070749_101205091 | 3300006802 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNSVAFV |
| Ga0070750_100911732 | 3300006916 | Aqueous | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGSVAFTPSSA |
| Ga0098060_10380711 | 3300006921 | Marine | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFTPSSADTM |
| Ga0098060_12270551 | 3300006921 | Marine | MAYIGQGLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFTPSS |
| Ga0098051_10515511 | 3300006924 | Marine | MAYIGQGLNRFSNVEKLDAITPSTSTGAGPYNLTKGGVAF |
| Ga0098051_10883761 | 3300006924 | Marine | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGGVAFTPS |
| Ga0099848_10222431 | 3300007541 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAF |
| Ga0099848_12391991 | 3300007541 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAFVPASAD |
| Ga0070751_10735842 | 3300007640 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAFVPAS |
| Ga0102963_10105881 | 3300009001 | Pond Water | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVAFTPSSADTM |
| Ga0115566_103961303 | 3300009071 | Pelagic Marine | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTK |
| Ga0114995_108290542 | 3300009172 | Marine | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKASVAFVPASA |
| Ga0114994_107931451 | 3300009420 | Marine | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKASVAF |
| Ga0115568_100173441 | 3300009498 | Pelagic Marine | MAYIGQGIDRFSNVEKLDAITPATATGAGPYNLTKGSVAFTPSSADTM |
| Ga0115572_106510491 | 3300009507 | Pelagic Marine | MAYIGRGIENLVNTQKLDVITPSTATGVGPYNLTQNSVAF |
| Ga0115004_101018411 | 3300009526 | Marine | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKASVAFVPS |
| Ga0115004_101058091 | 3300009526 | Marine | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKAS |
| Ga0115011_102506632 | 3300009593 | Marine | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLLKGGVAFTPS |
| Ga0115105_105295571 | 3300009679 | Marine | MAYIGQGIEQFSNVEKLDNITFTNSAGPYNLTKGSAAFTPSSVQSLLIQVDG |
| Ga0115012_101852492 | 3300009790 | Marine | MAYIGQGLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFT |
| Ga0098043_10598261 | 3300010148 | Marine | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVAFTPSS |
| Ga0098059_10672723 | 3300010153 | Marine | MAYIGQNLDRFSNVEKLDVITPATATGAGPYNLTQNSTAFTPV |
| Ga0133547_115381593 | 3300010883 | Marine | MAYIGQNLDRFSIVEKLDVITTATATGAGHYNLTKDSVAFVPAT |
| Ga0160423_100983071 | 3300012920 | Surface Seawater | MAYIGQGIDRFSNVEKLDAITPSTSTGAGPYNLTKG |
| Ga0163179_102135351 | 3300012953 | Seawater | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLLKGGVA |
| Ga0180120_102988483 | 3300017697 | Freshwater To Marine Saline Gradient | MAYIGQNLNRFSNVEKLDAITPATSTGAGPYNLLK |
| Ga0181391_10046691 | 3300017713 | Seawater | MAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTKGSVAF |
| Ga0181412_10366751 | 3300017714 | Seawater | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVA |
| Ga0181390_10518592 | 3300017719 | Seawater | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVAFTPSSA |
| Ga0187218_10051005 | 3300017737 | Seawater | MAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTK |
| Ga0181402_10072296 | 3300017743 | Seawater | MAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTKGSVAFTPSSADT |
| Ga0181402_11479061 | 3300017743 | Seawater | MAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTKGS |
| Ga0181393_10872401 | 3300017748 | Seawater | MAYIGQNLDRFSNVEKLDAITPATATGAGTYNLTKGG |
| Ga0187219_10190301 | 3300017751 | Seawater | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLLKGGVAFT |
| Ga0187221_11163292 | 3300017769 | Seawater | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGG |
| Ga0181394_10428962 | 3300017776 | Seawater | MAYIGQGLDRFSNVEKLDAITPATATGAGPYNLTKGGVAFTPSSADT |
| Ga0181380_10388091 | 3300017782 | Seawater | MAYIGQNLDRFSNVEKLDAITPSTSTGAGPYNLTKGSVAFTPSS |
| Ga0181580_106520531 | 3300017956 | Salt Marsh | MAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDS |
| Ga0181585_104888781 | 3300017969 | Salt Marsh | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVA |
| Ga0181601_102678071 | 3300018041 | Salt Marsh | MAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDSVA |
| Ga0181606_100626541 | 3300018048 | Salt Marsh | MAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKD |
| Ga0181591_107526513 | 3300018424 | Salt Marsh | MAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDSV |
| Ga0211647_102235011 | 3300020377 | Marine | MAYIGQGLDRFSNVEKLDVITPATSTGAGPYNLTKGG |
| Ga0211677_101679931 | 3300020385 | Marine | MAYIGRGIENLLNTQKLDAITPATATGAGPYNLTQNSVAFVPASADS |
| Ga0211644_102236453 | 3300020416 | Marine | LGDSXIMAYIGRGIENLLNTQKLDAITPSTSTGAGPYNLTQNST |
| Ga0211643_100582713 | 3300020457 | Marine | MAYIGQNLDRFSSVEKLDAITPSTSTGAGPYNLTKGGVAFTPSS |
| Ga0211577_102933711 | 3300020469 | Marine | MAYIGQNLDRFSNVEKLDVITPSTSTGAGPYNLTKGSVAFT |
| Ga0211579_100514711 | 3300020472 | Marine | MAYIGQNLDRFSNVEKLDVITPSTATGAGPYNLTQNSTAFTPIN |
| Ga0213860_101089901 | 3300021368 | Seawater | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKG |
| Ga0213869_104384782 | 3300021375 | Seawater | MAYIGQGLNRFSNVEKLDAITPATATGAGPYNLLKGG |
| Ga0222717_101703121 | 3300021957 | Estuarine Water | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKG |
| Ga0222716_101926211 | 3300021959 | Estuarine Water | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGV |
| Ga0222715_101170213 | 3300021960 | Estuarine Water | MAYIGRGIENLVNTQKLDVITPSTATGAGPYNLTKD |
| Ga0222714_101444474 | 3300021961 | Estuarine Water | MAYIGRGIENLVNTQRLDVITPSTATGAGPYNLTKNSIAFV |
| Ga0222713_105301821 | 3300021962 | Estuarine Water | MAYIGRGIENLVNTQKLDVITPSTATGVGPYNLTQNSVA |
| Ga0212021_10152072 | 3300022068 | Aqueous | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVAFT |
| Ga0212022_10716462 | 3300022164 | Aqueous | MAYIGQNLDRFSNVEKLDAITPSTATGAGPYNLTKGSVAFTPSSADIP |
| Ga0212027_10507152 | 3300022168 | Aqueous | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGSVAFTPS |
| (restricted) Ga0233444_100395271 | 3300024264 | Seawater | MAYIGRGIENLVNTQKLDAITPSTSTGAGPYNLTQNSVAFVP |
| Ga0208793_10385651 | 3300025108 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKG |
| Ga0209535_10138876 | 3300025120 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAFVPSSA |
| Ga0209535_10544624 | 3300025120 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAF |
| Ga0209535_10584892 | 3300025120 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVA |
| Ga0209336_101071311 | 3300025137 | Marine | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTK |
| Ga0209634_10685591 | 3300025138 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAFVP |
| Ga0209634_10765852 | 3300025138 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAFVPSS |
| Ga0209634_11911583 | 3300025138 | Marine | MAYIGRGIENLLNTQKLDVITPATATGAGPYNLTQNSVAFV |
| Ga0208303_11135642 | 3300025543 | Aqueous | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKGGVAF |
| Ga0208303_11215553 | 3300025543 | Aqueous | MAYIGRGIENLINAQKLDVITPSTATGVGPYNLTQNSVAFVPSSAD |
| Ga0209716_10290503 | 3300025626 | Pelagic Marine | MAYIGRGIENLINAQKLDAITPSTATGVGPYNLTQNSVAFVP |
| Ga0208161_10309281 | 3300025646 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAFVP |
| Ga0208134_11114431 | 3300025652 | Aqueous | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKGSVAFTPSS |
| Ga0208162_10072501 | 3300025674 | Aqueous | MAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDSVAFVPASAEQM |
| Ga0208019_10589471 | 3300025687 | Aqueous | MAYIGRGIENLVNTQKLDAITPSTATGAGPYNLTKDSVAFVP |
| Ga0208899_10698031 | 3300025759 | Aqueous | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLTKGSV |
| Ga0208427_10570321 | 3300025771 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNS |
| Ga0209193_10892702 | 3300025816 | Pelagic Marine | MAYIGRGIENLLNTQKLDAITPATATGAGPYNLTQNSVALVQLLHLVQH |
| Ga0208542_10399222 | 3300025818 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNSVAFVPASADQ |
| Ga0209714_11248981 | 3300025822 | Pelagic Marine | MAYIGQGLDRFSNVEKLDAITPATATGAGPYNLTKGSVAFTPS |
| Ga0208645_10257541 | 3300025853 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKNSVA |
| Ga0208645_10516131 | 3300025853 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTK |
| Ga0209929_11426581 | 3300026187 | Pond Water | MAYIGQNLDRFSNVEKLDAITPATATGAGPYNLLKG |
| Ga0208130_10716521 | 3300026258 | Marine | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGVA |
| Ga0208970_10695593 | 3300027298 | Marine | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKGSVAF |
| Ga0208796_10666201 | 3300027308 | Estuarine | MAYIGQGLNRFSNVEKLDVIIPATATGAGPYNLTKGSVAFVPSSA |
| Ga0209482_10234791 | 3300027668 | Marine | MAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAFIPSSAETM |
| Ga0209192_102899071 | 3300027752 | Marine | MAYIGQNLDRFSIVEKLDVITPATATGAGPYNLTKGSVA |
| Ga0183683_10057121 | 3300029309 | Marine | MAYIGQNLDRFSNVEKLDAITPATSTGAGPYNLTKGGV |
| Ga0183683_10103343 | 3300029309 | Marine | MAYIGQNLDRFSNVEKLDVITPSTSTGAGPYNLTKGGVAFTPS |
| Ga0308023_10402741 | 3300031167 | Marine | MAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAFIP |
| Ga0307380_112169813 | 3300031539 | Soil | MAYIGRGIENLINAQKLDVITPSTATGAGPYNLTQNSVAFV |
| Ga0307379_107334053 | 3300031565 | Soil | MAYIGRGIENLINAQKLDAITPSTATGVGPYNLTQNSVAFVPA |
| Ga0307993_11655791 | 3300031602 | Marine | MAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAFVPSS |
| Ga0302121_100838041 | 3300031626 | Marine | MAYIGRGIQNLLNAQKLDAITPSTATGVGPYNLTQNSIAFVPA |
| Ga0308014_10053241 | 3300031628 | Marine | MAYIGQGLDRFSNVEKLDVITPATATGAGPYNLTKASVAFVPSSAD |
| Ga0307984_10090466 | 3300031658 | Marine | MAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKASVAF |
| Ga0308008_10548901 | 3300031687 | Marine | MAYIGQGLNRFSNVEKLDVITPATATGAGPYNLTKASVAFVP |
| Ga0308017_10746461 | 3300031689 | Marine | MAYIGQGLNRFSNVEKLDVITPATSTGAGPYNLTKAS |
| Ga0348337_042629_1795_1923 | 3300034418 | Aqueous | MAYIGRGIENLINTQKLDVITPSTATGAGPYNLTKSSVAFVPA |
| ⦗Top⦘ |