| Basic Information | |
|---|---|
| Family ID | F082911 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 49 residues |
| Representative Sequence | DGKLRYRSSRTTGTARLSEDKGKTILTVMPEDPNYRTGRAEYERVK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.89 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 89.38 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.531 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (23.009 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.088 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.558 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 33.78% Coil/Unstructured: 66.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF02515 | CoA_transf_3 | 5.31 |
| PF12697 | Abhydrolase_6 | 2.65 |
| PF08327 | AHSA1 | 1.77 |
| PF00589 | Phage_integrase | 1.77 |
| PF02776 | TPP_enzyme_N | 1.77 |
| PF10442 | FIST_C | 1.77 |
| PF07690 | MFS_1 | 1.77 |
| PF00300 | His_Phos_1 | 1.77 |
| PF13533 | Biotin_lipoyl_2 | 0.88 |
| PF13473 | Cupredoxin_1 | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF01812 | 5-FTHF_cyc-lig | 0.88 |
| PF03061 | 4HBT | 0.88 |
| PF04185 | Phosphoesterase | 0.88 |
| PF01527 | HTH_Tnp_1 | 0.88 |
| PF07366 | SnoaL | 0.88 |
| PF03466 | LysR_substrate | 0.88 |
| PF01425 | Amidase | 0.88 |
| PF14378 | PAP2_3 | 0.88 |
| PF13304 | AAA_21 | 0.88 |
| PF06897 | DUF1269 | 0.88 |
| PF00528 | BPD_transp_1 | 0.88 |
| PF02780 | Transketolase_C | 0.88 |
| PF00115 | COX1 | 0.88 |
| PF13177 | DNA_pol3_delta2 | 0.88 |
| PF02775 | TPP_enzyme_C | 0.88 |
| PF04343 | DUF488 | 0.88 |
| PF13432 | TPR_16 | 0.88 |
| PF04392 | ABC_sub_bind | 0.88 |
| PF02211 | NHase_beta | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 5.31 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 0.88 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.88 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.88 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.30 % |
| Unclassified | root | N/A | 17.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_GG3DY5401DBQXZ | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300000550|F24TB_10062233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1167 | Open in IMG/M |
| 3300000550|F24TB_12223409 | Not Available | 831 | Open in IMG/M |
| 3300001139|JGI10220J13317_10213299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300005166|Ga0066674_10385699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 652 | Open in IMG/M |
| 3300005167|Ga0066672_10165605 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1393 | Open in IMG/M |
| 3300005167|Ga0066672_10272355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1094 | Open in IMG/M |
| 3300005178|Ga0066688_10482615 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005180|Ga0066685_10150176 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1584 | Open in IMG/M |
| 3300005186|Ga0066676_10443435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 879 | Open in IMG/M |
| 3300005289|Ga0065704_10730757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Fischerbacteria → Candidatus Fischerbacteria bacterium RBG_13_37_8 | 549 | Open in IMG/M |
| 3300005330|Ga0070690_101018902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300005332|Ga0066388_105351707 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005444|Ga0070694_100789569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 778 | Open in IMG/M |
| 3300005467|Ga0070706_100630455 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005468|Ga0070707_101703601 | Not Available | 597 | Open in IMG/M |
| 3300005468|Ga0070707_102043814 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005518|Ga0070699_100025992 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 5049 | Open in IMG/M |
| 3300005536|Ga0070697_100281639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
| 3300005544|Ga0070686_101560086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300005555|Ga0066692_10106257 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300005555|Ga0066692_10333366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300005568|Ga0066703_10684138 | Not Available | 591 | Open in IMG/M |
| 3300005568|Ga0066703_10717241 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
| 3300005598|Ga0066706_10763674 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005713|Ga0066905_101131664 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005713|Ga0066905_101551477 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005764|Ga0066903_101429307 | Not Available | 1301 | Open in IMG/M |
| 3300005764|Ga0066903_106967614 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
| 3300006034|Ga0066656_10198061 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300006034|Ga0066656_10292584 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
| 3300006194|Ga0075427_10021119 | Not Available | 1035 | Open in IMG/M |
| 3300006572|Ga0074051_11466803 | Not Available | 823 | Open in IMG/M |
| 3300006796|Ga0066665_10406942 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1123 | Open in IMG/M |
| 3300006852|Ga0075433_11176864 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
| 3300006854|Ga0075425_100175957 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300006854|Ga0075425_101232385 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
| 3300006854|Ga0075425_101454886 | Not Available | 774 | Open in IMG/M |
| 3300006904|Ga0075424_100255871 | Not Available | 1862 | Open in IMG/M |
| 3300006914|Ga0075436_101146388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
| 3300009098|Ga0105245_12433076 | Not Available | 577 | Open in IMG/M |
| 3300009100|Ga0075418_10720339 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300009100|Ga0075418_12135626 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009147|Ga0114129_10305897 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300009147|Ga0114129_11294939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 903 | Open in IMG/M |
| 3300010301|Ga0134070_10445137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300010335|Ga0134063_10450820 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
| 3300010336|Ga0134071_10433300 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010336|Ga0134071_10497511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 629 | Open in IMG/M |
| 3300010358|Ga0126370_11099845 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium fosmid pJB190D12_contig II | 732 | Open in IMG/M |
| 3300010358|Ga0126370_11226019 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010362|Ga0126377_10166562 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300010362|Ga0126377_10192042 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300010362|Ga0126377_12125739 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010373|Ga0134128_11930205 | Not Available | 650 | Open in IMG/M |
| 3300010375|Ga0105239_11630423 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 746 | Open in IMG/M |
| 3300010863|Ga0124850_1062743 | Not Available | 1145 | Open in IMG/M |
| 3300012189|Ga0137388_11490146 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012199|Ga0137383_11141675 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
| 3300012203|Ga0137399_10918549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
| 3300012205|Ga0137362_10439579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1129 | Open in IMG/M |
| 3300012362|Ga0137361_10542587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1067 | Open in IMG/M |
| 3300012362|Ga0137361_10785883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 867 | Open in IMG/M |
| 3300012582|Ga0137358_10933034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
| 3300012685|Ga0137397_10261619 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300012685|Ga0137397_10902589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300012922|Ga0137394_11465873 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012927|Ga0137416_11169911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
| 3300012930|Ga0137407_11362667 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
| 3300012948|Ga0126375_10924217 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012948|Ga0126375_11150428 | Not Available | 642 | Open in IMG/M |
| 3300013297|Ga0157378_11074866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
| 3300014154|Ga0134075_10441645 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300015264|Ga0137403_11052346 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
| 3300015359|Ga0134085_10227631 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300015373|Ga0132257_101287299 | Not Available | 928 | Open in IMG/M |
| 3300015374|Ga0132255_100387994 | Not Available | 2030 | Open in IMG/M |
| 3300017944|Ga0187786_10312052 | Not Available | 650 | Open in IMG/M |
| 3300018468|Ga0066662_12738247 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300020170|Ga0179594_10404021 | Not Available | 518 | Open in IMG/M |
| 3300025910|Ga0207684_11709261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
| 3300026297|Ga0209237_1000690 | All Organisms → cellular organisms → Bacteria | 19406 | Open in IMG/M |
| 3300026298|Ga0209236_1080185 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300026313|Ga0209761_1121852 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300026331|Ga0209267_1012624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4504 | Open in IMG/M |
| 3300026331|Ga0209267_1142648 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 993 | Open in IMG/M |
| 3300026335|Ga0209804_1107649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1275 | Open in IMG/M |
| 3300026529|Ga0209806_1305782 | Not Available | 534 | Open in IMG/M |
| 3300026532|Ga0209160_1060785 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
| 3300026537|Ga0209157_1012229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5687 | Open in IMG/M |
| 3300026540|Ga0209376_1069416 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1924 | Open in IMG/M |
| 3300026548|Ga0209161_10334399 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 690 | Open in IMG/M |
| 3300026548|Ga0209161_10513560 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300027324|Ga0209845_1004292 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300027748|Ga0209689_1112505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1383 | Open in IMG/M |
| 3300028381|Ga0268264_11916884 | Not Available | 602 | Open in IMG/M |
| 3300031226|Ga0307497_10700927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300031544|Ga0318534_10719433 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031561|Ga0318528_10036801 | All Organisms → cellular organisms → Bacteria | 2431 | Open in IMG/M |
| 3300031680|Ga0318574_10308420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300031736|Ga0318501_10565325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300031740|Ga0307468_102153982 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300031740|Ga0307468_102354649 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 518 | Open in IMG/M |
| 3300031819|Ga0318568_10343302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300031820|Ga0307473_10272724 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1050 | Open in IMG/M |
| 3300031820|Ga0307473_10935257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300031890|Ga0306925_12068948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300031910|Ga0306923_11796875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300032174|Ga0307470_11242832 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
| 3300032180|Ga0307471_102009296 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300032180|Ga0307471_102584014 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 643 | Open in IMG/M |
| 3300032180|Ga0307471_103071456 | Not Available | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_05731020 | 2070309009 | Soil | EGKFYLQDGQLRYRSSRTTGTATVFEDQGRTLLAVMPKNLDYKTGRAEYERVK |
| F24TB_100622332 | 3300000550 | Soil | FYLQDGKLRYRSSRTTGTARLSEDKGKTSLTMIADNPDYGKAEYERIR* |
| F24TB_122234091 | 3300000550 | Soil | KLRYRSSRTTGTASLSEDQGKTILTVMPEDSYYKTGKAEYERVK* |
| JGI10220J13317_102132991 | 3300001139 | Soil | SSRTTGTAKLSEDKGKTTLTVTPEDPNFRTGTGEYERVK* |
| Ga0066674_103856991 | 3300005166 | Soil | AEGKFYLKDGKLSYRSSRTTGTARLSEEGGKTTLTVTPEDPNYRTGKAEYERVK* |
| Ga0066672_101656051 | 3300005167 | Soil | LRYRSSRTTGTASLSEDKGKTTLTVLPEDSTYGRADYERVK* |
| Ga0066672_102723551 | 3300005167 | Soil | KFYLQDGKLRYRSSRTTGTASLSEDRGKTMLTVMPEDPKYHTGRAEYERVKE* |
| Ga0066688_104826151 | 3300005178 | Soil | FYLQDGKLRYRSSRTIGTASLSEDQGKTMLTVMPEDPKYQTGRAEYERVKE* |
| Ga0066685_101501765 | 3300005180 | Soil | GKFYLQDGKLRYRSSRTTGTASLSEDNGKTVLTVKPEDPNYQTGTGEYERVK* |
| Ga0066676_104434352 | 3300005186 | Soil | YRSSRTTGTAKLSEDQGKTILTVMPEDPNYRTGRAEYERVK* |
| Ga0065704_107307572 | 3300005289 | Switchgrass Rhizosphere | GQFYLQNGKLFYRSSRTTGAASLSEDKGKTTLSVLPEDPNYRTGRADYERAD* |
| Ga0070690_1010189022 | 3300005330 | Switchgrass Rhizosphere | GKLMYRSSRTAGVAKLTEDDGKTTITITPDDPSYRTGSARYERVK* |
| Ga0066388_1053517071 | 3300005332 | Tropical Forest Soil | GASTEGKFYLQDGKLRYRSSRTTGTASLSEDQGKTVLTVMPADPKYRAGSAAFERVK* |
| Ga0070694_1007895692 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | NGSTAVGQFSLRDGKLVYQSSRTTGTAKLSEDKGKTTLTVTPEDPNFRTGTGEYERVK* |
| Ga0070708_1012164503 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LHDGKLLYRSSRTTGAASISEDQGKTVLTVLPVDPLYGAGSRAEYERVE* |
| Ga0070706_1006304551 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GSTSEGRFYLQDGKLRYRSSRTTGTARLSEDKGKTTLTVMPEDSTYGRADYERVK* |
| Ga0070707_1017036011 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FYLQDGKLRYRSSRTTGTASVSEDKGKTVLKLMPEDPNYRTGRAEYERVK* |
| Ga0070707_1020438141 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FYLQDGKLRYRSSRTTGTATLSEDQGKTMLTVMPENSYYKTGKAEYERVK* |
| Ga0070699_10002599211 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KFYLRDGKLRYRSSRTTGTASLSEDQGKTMLKVTPENSNYKTGRAEYERVK* |
| Ga0070697_1002816391 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EGKFYLQDGKLRYRSSRTTGTARLSEEQGRTTLTVMPENSYYKTGRAEYERVKE* |
| Ga0070686_1015600862 | 3300005544 | Switchgrass Rhizosphere | YQSSRTTGTAKLSEDKGKTTLTVTPEDPNFRTGTGEYERVK* |
| Ga0066692_101062571 | 3300005555 | Soil | GKLRYRSSRTTGTASVSEDKGKTVLTVMPEDPNYRTGRAQYERLK* |
| Ga0066692_103333661 | 3300005555 | Soil | RTTGTAKLSEDQGKTTLTVMPEDPNYRTGRAEYERVK* |
| Ga0066703_106841381 | 3300005568 | Soil | LRYRSSGTTGTASLSEDEGITVLTVMPEDANYRTGSAKYQRVR* |
| Ga0066703_107172412 | 3300005568 | Soil | GTFYLQDGKLRYRSSRTTGTASVSEDKGKTVLKLMPEDPNYRTGRAEYERVK* |
| Ga0066706_107636741 | 3300005598 | Soil | SRTTGTARLSEEGGKTTLTVTPEDPNYRTGKAEYERVK* |
| Ga0066905_1011316641 | 3300005713 | Tropical Forest Soil | GAITEGKFYLQDGQLRYRSSRTTGAATLSEDQDKTVLTVMPADPRYHTGRAEYERVK* |
| Ga0066905_1015514772 | 3300005713 | Tropical Forest Soil | QDGQLRYRSSRTTGAASLSDDQGTTRLTMMPADPKYHTGRAEYERVKQ* |
| Ga0066903_1014293071 | 3300005764 | Tropical Forest Soil | TTEGQFYLQDGKLRYRSSRSEGTASLSDDKGKATLRMTADNPDYGKAEYERIR* |
| Ga0066903_1069676142 | 3300005764 | Tropical Forest Soil | LQDGQLRYRSSRTTGAATVSEDQDKTVLTVMPADPKYHTGRAEYERVK* |
| Ga0066656_101980614 | 3300006034 | Soil | VSGSTAEGKFYLKDGKVLYRSSRTTGTARLSEEGGKTTLMVTPEDPNYRTGKAEYERVK* |
| Ga0066656_102925843 | 3300006034 | Soil | DGKLRYRSSRTTGTARLSEDKGKTILTVMPEDPNYRTGRAEYERVK* |
| Ga0075427_100211191 | 3300006194 | Populus Rhizosphere | DGKLLYRSSRTTGKAQLTEDKGKTTLSVIPDDPNYRTGRGDYERVK* |
| Ga0074051_114668032 | 3300006572 | Soil | KFYLQDGKLRYQSSRTAGTASLSEDRGKTTLTMTPENLDYGKAEYERVQ* |
| Ga0066665_104069422 | 3300006796 | Soil | LLYRSSRTTGTARLSEEGGKTTLTVTPEDPNYRTGKAEYERVK* |
| Ga0075433_111768642 | 3300006852 | Populus Rhizosphere | GKFYLQEGQLRYRSSRTTGTASLSEDRGKTMLTVMPEDPKYHTGRAEYERVKE* |
| Ga0075425_1001759574 | 3300006854 | Populus Rhizosphere | FYLQDGKLMYRSSRTTGTARLTEEGGKTTITVTPDDPTYRTGSAQYERIK* |
| Ga0075425_1012323853 | 3300006854 | Populus Rhizosphere | SRTAGTASLSEDQGKTILTVMPEGPTCETGRKEYERAK* |
| Ga0075425_1014548863 | 3300006854 | Populus Rhizosphere | TRTTGTANLSEDQGKTILTVMPEDPTSDTGRTKYERVK* |
| Ga0075424_1002558711 | 3300006904 | Populus Rhizosphere | GSTTEGQFYLQGGKLLYRSSRTTGAAKLSEDKGRTTLTVTPDDPNYRTGTGEYERVK* |
| Ga0075436_1011463881 | 3300006914 | Populus Rhizosphere | QGEFYLQDGKLMYRSSRTTGTARVTEEGGKTTITVTPDDPTFRTGSAQYERIK* |
| Ga0105245_124330761 | 3300009098 | Miscanthus Rhizosphere | RTTGTASFSEDKGKTTLTLKPEDATYGKAEYERVK* |
| Ga0075418_107203393 | 3300009100 | Populus Rhizosphere | SSRTTGTATVFEDQGRTLLAVMPENLDYKTGRAEYERVK* |
| Ga0075418_121356261 | 3300009100 | Populus Rhizosphere | TQRGVQTEGKFYLQDGKLLYQSSRTAGTARLSEDRGKTSLTMTPENPDYGKAEYERVR* |
| Ga0114129_103058974 | 3300009147 | Populus Rhizosphere | EDGKLRYRSSRTTGTASLSEDRGKAVLTVMPEDPNYQTGRGEYERVK* |
| Ga0114129_112949392 | 3300009147 | Populus Rhizosphere | SQGKFYLQDGKLMYRSSRTTGTARLTEEGGKTTITVTPDDPTYRTGSAQYERIK* |
| Ga0134070_104451372 | 3300010301 | Grasslands Soil | GKFYLKDGKLLYQSSRTTGTARLSEEGGKTTLTVTPADPNYRTGKAEYERVK* |
| Ga0134063_104508202 | 3300010335 | Grasslands Soil | GKLRYRSSRTTGTASLSEDKGKTTLTVLPEDSTYGRADYERVK* |
| Ga0134071_104333002 | 3300010336 | Grasslands Soil | SEGKFYLQDGKLRYRSSRTTGTASLSEDKGKTTLTVVPEDPNYQTGRAEYERVK* |
| Ga0134071_104975111 | 3300010336 | Grasslands Soil | TEGKFYLQDGKLRYRSSRTIGTASLSEDQGKTMLTVMPEDPKYQTGRAEYERVKE* |
| Ga0126370_110998452 | 3300010358 | Tropical Forest Soil | EGQFYLQGGKILYRSSRTTGAAKLTEDKGRTTLTVTPDDPNYRTGTGEYERVR* |
| Ga0126370_112260192 | 3300010358 | Tropical Forest Soil | LQDGQLRYRSSRTTGAATLSEDQDKTVLTVMPADPKYHTGRAEYERVK* |
| Ga0126377_101665622 | 3300010362 | Tropical Forest Soil | LTTDGATTEGKFYLQDGKLRYRSSRTTGTASLSEDQGKTMLKVMPENSYYKTGRAEYERVK* |
| Ga0126377_101920424 | 3300010362 | Tropical Forest Soil | LTTDGAITEGKFYLQEGRLRYRSSRTTGAASLSEDQGKTMLKVMPENSYYKTGEAQYERVK* |
| Ga0126377_121257392 | 3300010362 | Tropical Forest Soil | FYLQNGKILYRSSRTTGAAKLTEDKGRTTLTVTPDDPNYRTGTGEYERVR* |
| Ga0134128_119302051 | 3300010373 | Terrestrial Soil | RYRSSRTMGTAKLSEDNGKTTLRVIPERPNIETGPAEYERVK* |
| Ga0105239_116304231 | 3300010375 | Corn Rhizosphere | GQFSLRDGKLVYQSSRTTGTAKLSEDKGKTTLTVTPEDPNFRTGTGEYERVK* |
| Ga0124850_10627431 | 3300010863 | Tropical Forest Soil | QDGKLRYRSLGTTGTARVDEDEGITVLTVMPEAPNSRTGSARYQRGK* |
| Ga0137388_114901461 | 3300012189 | Vadose Zone Soil | KFYLQDGKLRYRSSRTTGTASLSEDQGKSILTVMPEDPNYQTGKAEYERVK* |
| Ga0137383_111416751 | 3300012199 | Vadose Zone Soil | TSEGKFYLQDGKLRYRSSRTTGTASLSEDKGKTTLTLKPEDATYGKAEYERVKK* |
| Ga0137399_109185491 | 3300012203 | Vadose Zone Soil | QDGKLMYRSSRTTGAAKLTEEGGKTTVTITPNDPSYRTGSARYERVK* |
| Ga0137362_104395793 | 3300012205 | Vadose Zone Soil | QSSRTTGTARLSAEGGKTTLTVTPADPNYRTGKAEYERVK* |
| Ga0137361_105425873 | 3300012362 | Vadose Zone Soil | LQDGKLRYRSSRTTGTASLSEDKGKTVLPVKAEDPNYRTGTGEYERVKQ* |
| Ga0137361_107858832 | 3300012362 | Vadose Zone Soil | GQFYLQDGQLRYRSSRTTGTAKLSEDQGKTTLTVKPEDPNYQTGTAEYERVK* |
| Ga0137358_109330342 | 3300012582 | Vadose Zone Soil | LTSEGQFYLQDGKLRYRSSRTTGTASLSEDKGKTTLTVLPEDSTYGRADYERVK* |
| Ga0137397_102616192 | 3300012685 | Vadose Zone Soil | VETEGKFYLQDGKLRYQSSRTAGTARLSEDQGKTTLTMTPENPDYGKAEYELIK* |
| Ga0137397_109025891 | 3300012685 | Vadose Zone Soil | QDGKLVYRSSRTTGTATLSEDKGKTTLKVTPEDPNYRTGTGEYERVK* |
| Ga0137394_114658732 | 3300012922 | Vadose Zone Soil | YLQDGKLRYRSSRTTGTAILSEDKGKTVLKVVPEDPNYRTGTGEYERVK* |
| Ga0137416_111699112 | 3300012927 | Vadose Zone Soil | KLMYRSSRTTGAAKLTEEGGKTTVTITPNDPSYRTGSARYERVK* |
| Ga0137407_113626672 | 3300012930 | Vadose Zone Soil | SSIFKTASCAYQSSRTKGTASLSEDNGKTVLKVAPDDRNYRTGTGEYERVK* |
| Ga0126375_109242171 | 3300012948 | Tropical Forest Soil | KFYLQDGGLRYRSSRTRGAASLSQDQGKTVLTVMPADPRYHTGGAEYERVK* |
| Ga0126375_111504282 | 3300012948 | Tropical Forest Soil | IRGSTTEGKFYLEDGKLRYRSSRTTGTASLSEDRGKAVLTVLPEYPNYQTGRGEYERVK* |
| Ga0157378_110748661 | 3300013297 | Miscanthus Rhizosphere | QSSRTTGTAKLSEDKGKTTLTVTPEDPNFRTGTGEYERVK* |
| Ga0134075_104416451 | 3300014154 | Grasslands Soil | RYRSSRTTGTASLSEDNGKTVLTVKPEDPNYQTGTGEYERVK* |
| Ga0137403_110523461 | 3300015264 | Vadose Zone Soil | QDGKLRYRSSRTTGTASLSEDKGKTTLTLKPEDATYGKAEYERVKK* |
| Ga0134085_102276312 | 3300015359 | Grasslands Soil | YRSSRTTGTARLSEEGGKTTLTVTPEDPNYRTGKAEYERVK* |
| Ga0132257_1012872992 | 3300015373 | Arabidopsis Rhizosphere | EGQFYLQDGKLLYRSSRTTGAAKLTEDKGRTTLTVTPDDPNYTTGKGEYERVK* |
| Ga0132255_1003879942 | 3300015374 | Arabidopsis Rhizosphere | GQFYLQDGKLLYRSSRTTGAAKLTEDKGRTTLTVTPDDPNYRTGTGEYERVR* |
| Ga0187786_103120521 | 3300017944 | Tropical Peatland | DGKLRYRSSLTTGTASVSQDKGKTVLTMMPDNANSRTGRAEYERVK |
| Ga0066662_127382471 | 3300018468 | Grasslands Soil | AEGKFYVKDGKLLYRSSRTTGTARLSEEGGKTTLTVTPEDPNYRTGKAEYERVK |
| Ga0179594_104040212 | 3300020170 | Vadose Zone Soil | SEGKFFLENGALRYRSSRTMGTAKLSEDNGKTTLKVIPEGPNIETGPAEYERVK |
| Ga0207684_117092611 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EGKFYLQDGKLRYRSSRTTGTAKLSEDQGKTTLTVMPEDPNYRTGRAEYERVK |
| Ga0209237_10006901 | 3300026297 | Grasslands Soil | RTTGTAKLSEDQGKTTLTVMPEDPNYRTGRAEYERVK |
| Ga0209236_10801854 | 3300026298 | Grasslands Soil | TTGTAKLSEDQGKTILTVMPEDPNYRTGRAEYERVK |
| Ga0209761_11218523 | 3300026313 | Grasslands Soil | SSRTTGTAKLSEDQGKTILTVMPEDPNYRTGRAEYERVK |
| Ga0209267_10126249 | 3300026331 | Soil | LQDGKLRYRSSRTTGTARLSEDKGKTTLTVMPEDSTYGRADYERVK |
| Ga0209267_11426481 | 3300026331 | Soil | DGKLRYRSSRTTGTASLSEDKGKTTLTVLPEDSTYGRADYERVK |
| Ga0209804_11076491 | 3300026335 | Soil | TTEGKFYLQDGKLRYRSSRTIGTASLSEDQGKTMLTVMPEDPKYQTGRAEYERVKE |
| Ga0209806_13057821 | 3300026529 | Soil | GKLRYRSSRTTGTASLSEDKGKTTLTVLPEDSTYGRADYERVK |
| Ga0209160_10607853 | 3300026532 | Soil | DGKLRYRSSRTTGTARLSEDKGKTILTVMPEDPTYGRADYERVK |
| Ga0209157_10122295 | 3300026537 | Soil | RSSRTTGTARLSEEGGKTTLTVTPEDPNYRTGKAEYERVK |
| Ga0209376_10694161 | 3300026540 | Soil | GKFYLQDGKLRYRSSRTTGTASLSEDNGKTVLTVKPEDPNYQTGTGEYERVK |
| Ga0209161_103343992 | 3300026548 | Soil | YLKDGKLLYQSSRTTGTARLSEEGGKTTLTVTPADPNYRTGKAEYERVK |
| Ga0209161_105135601 | 3300026548 | Soil | DRFYIQDGTLRYRSSRTTGIARLSGDRGTTVLTVMPEDPNYRTGTAEYERVK |
| Ga0209845_10042925 | 3300027324 | Groundwater Sand | EGKFYLQDGKLQYRSSRTTGTARLSEDQGKTILTVMPEDPNYQTGRAEYERVK |
| Ga0209689_11125054 | 3300027748 | Soil | RSSRTTGTASLSEDKGKTTLTVLPEDSTYGRADYERVK |
| Ga0268264_119168841 | 3300028381 | Switchgrass Rhizosphere | SSRTTGTASLSEDKGKTTLTLKPEDATYGKAEYERVK |
| Ga0307497_107009272 | 3300031226 | Soil | RYRSSRTTGTASLSEDKGKTTLTVMPEDATYGKAEYERVK |
| Ga0318534_107194331 | 3300031544 | Soil | LQDGKLRYRSSRTTGDATLSEDKGKVTLKVSPEDPNYRTGRAEYERVK |
| Ga0318528_100368014 | 3300031561 | Soil | FLQDGKLRYRSSRTTGDATLSEDKGKVTLKVSPEDPNYRTGRAEYERVK |
| Ga0318574_103084201 | 3300031680 | Soil | TTEGQFYLQNGKLLYRSSRTTGAAKLTEDQGRTTLTQIPDDPNFRTGTGRYERVK |
| Ga0318501_105653252 | 3300031736 | Soil | YLQNGKLMYRSSRTTGAAKLTEEQGRTTLTQIPDDPNFRTGTGRYERVK |
| Ga0307468_1021539821 | 3300031740 | Hardwood Forest Soil | TAEGQFSLQDGKLVYRSSRTTGTARLSEDKGKTTLTVTPEDPNFRTGTGEYERVK |
| Ga0307468_1023546492 | 3300031740 | Hardwood Forest Soil | VTTEGQFYLQDGKLRYRSSRTTGTARLSEDQGKTTLTVISDNPDYGKAEYERIK |
| Ga0318568_103433022 | 3300031819 | Soil | TEGQFYLQNGKLMYRSSRTTGAAKLTEDKGRTTLTQIPDDPNFRTGTGRYERVK |
| Ga0307473_102727243 | 3300031820 | Hardwood Forest Soil | DGKLRYRSSRTTGTASLSEDKGKTTLTLKPEDATYGKAAYERVK |
| Ga0307473_109352571 | 3300031820 | Hardwood Forest Soil | KLRYRSSRTTGTASLSEDKGKTTLTVLPEDSTYGRADYERVK |
| Ga0306925_120689481 | 3300031890 | Soil | TINGSTTEGQFYLQNGKLMYRSSRTTGAAKLTEEQGRTTLTQIPDDPNFRTGTGRYERVK |
| Ga0306923_117968751 | 3300031910 | Soil | RTTGAAKLTEDKGRTTLTQIPDDPNFRTGTGRYERVK |
| Ga0307470_112428322 | 3300032174 | Hardwood Forest Soil | YLQDGKLRYRSSRTTGTASLSEDKGKTTLTLKPEDATYGKAEYERVK |
| Ga0307471_1020092961 | 3300032180 | Hardwood Forest Soil | QFYLQDGELRYRSSRTTGTAKLSEDGGTTVLTVMPEDPNYRTGTAEYERIR |
| Ga0307471_1025840141 | 3300032180 | Hardwood Forest Soil | YLQDGKLRYRSSRTTGTASLSEDKGKTTLTLKPEDATYGKAAYERVK |
| Ga0307471_1030714561 | 3300032180 | Hardwood Forest Soil | EGKFYLQDGKLRYRSSRTTGTARLSEEQGRTTLTVMPENSYYKTGRAEYERVKE |
| ⦗Top⦘ |