Metagenome / Metatranscriptome Family F082875

Overview

Basic Information

• Family ID: F082875
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 113
• Average Sequence Length: 37 residues
• Representative Sequence: MTQETVQIVAGVLAVLLIGIIIMRRKNKKKTQEDEF
• Number of Associated Samples: 101
• Number of Associated Scaffolds: 113

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 37.50 %
• % of genes near scaffold ends (potentially truncated): 1.77 %
• % of genes from short scaffolds (< 2000 bps): 6.19 %
• Associated GOLD sequencing projects: 97
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (93.805 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.009 % of family members)
• Environment Ontology (ENVO): Unclassified (37.168 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (43.363 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 42.19%
  β-sheet: 0.00%
  Coil/Unstructured: 57.81%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF08450	SGL	43.36
PF02866	Ldh_1_C	7.96
PF01243	Putative_PNPOx	4.42
PF00482	T2SSF	2.65
PF00903	Glyoxalase	1.77
PF03938	OmpH	1.77
PF07676	PD40	0.88
PF00056	Ldh_1_N	0.88
PF00037	Fer4	0.88
PF13751	DDE_Tnp_1_6	0.88
PF01625	PMSR	0.88
PF12840	HTH_20	0.88
PF08240	ADH_N	0.88
PF13442	Cytochrome_CBB3	0.88
PF14224	DUF4331	0.88
PF00216	Bac_DNA_binding	0.88
PF01425	Amidase	0.88
PF06262	Zincin_1	0.88
PF01261	AP_endonuc_2	0.88
PF03989	DNA_gyraseA_C	0.88
PF01808	AICARFT_IMPCHas	0.88
PF01933	CofD	0.88
PF07992	Pyr_redox_2	0.88
PF00351	Biopterin_H	0.88
PF01596	Methyltransf_3	0.88
PF00856	SET	0.88
PF01168	Ala_racemase_N	0.88
PF00501	AMP-binding	0.88
PF02627	CMD	0.88
PF00072	Response_reg	0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG3391	DNA-binding beta-propeller fold protein YncE	General function prediction only [R]	43.36
COG3386	Sugar lactone lactonase YvrE	Carbohydrate transport and metabolism [G]	43.36
COG0039	Malate/lactate dehydrogenase	Energy production and conversion [C]	8.85
COG2825	Periplasmic chaperone for outer membrane proteins, Skp family	Cell wall/membrane/envelope biogenesis [M]	1.77
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.88
COG4123	tRNA1(Val) A37 N6-methylase TrmN6	Translation, ribosomal structure and biogenesis [J]	0.88
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	0.88
COG3824	Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG3186	Phenylalanine-4-hydroxylase	Amino acid transport and metabolism [E]	0.88
COG2518	Protein-L-isoaspartate O-methyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG1486	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase	Carbohydrate transport and metabolism [G]	0.88
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.88
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.88
COG0391	Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 family	Carbohydrate transport and metabolism [G]	0.88
COG0225	Peptide methionine sulfoxide reductase MsrA	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG0188	DNA gyrase/topoisomerase IV, subunit A	Replication, recombination and repair [L]	0.88
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.88
COG0138	AICAR transformylase/IMP cyclohydrolase PurH	Nucleotide transport and metabolism [F]	0.88

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.81 %
All Organisms	root	All Organisms	6.19 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.81 %
cellular organisms	root	All Organisms → cellular organisms	6.19 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.81 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	6.19 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.81 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	3.54 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.88 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.81 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	2.65 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.88 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.81 %
unclassified Terriglobia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia	1.77 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.88 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.81 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	1.77 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.88 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300009093|Ga0105240_10047006	All Organisms → cellular organisms → Bacteria	5463
3300010379|Ga0136449_102271273	Not Available	788
3300021170|Ga0210400_11257025	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	595
3300021432|Ga0210384_11761275	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	525
3300025903|Ga0207680_11071373	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	576
3300031231|Ga0170824_119856868	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	521
3300031754|Ga0307475_10323815	All Organisms → cellular organisms → Bacteria	1238
3300032955|Ga0335076_10375956	All Organisms → cellular organisms → Bacteria → Acidobacteria	1306

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.65%
Host-Associated	Host-Associated	19.47%
Engineered	Engineered	0.89%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.06%
Aquatic	Environmental → Aquatic	18.58%
Plants	Host-Associated → Plants	18.58%
Human	Host-Associated → Human	0.89%
Wastewater	Engineered → Wastewater	0.89%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.52%
Freshwater	Environmental → Aquatic → Freshwater	13.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	10.62%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.96%
Sediment	Environmental → Aquatic → Sediment	4.42%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.89%
Peat	Environmental → Terrestrial → Peat	0.89%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.89%
Cave	Environmental → Terrestrial → Cave	0.89%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.89%
Digestive System	Host-Associated → Human → Digestive System	0.89%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.89%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.90%
Lake	Environmental → Aquatic → Freshwater → Lake	12.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.31%
Loam	Environmental → Terrestrial → Soil → Loam	5.31%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.31%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.65%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.77%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.89%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	0.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.89%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.89%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.89%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.51%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	11.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.08%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.31%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.31%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.42%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.42%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.77%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	0.89%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.89%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.89%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.89%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.89%

Habitat

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	23.01%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	11.50%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.08%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.42%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.65%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.65%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	2.65%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.77%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.77%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.77%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.77%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.77%
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	0.89%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.89%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	0.89%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.89%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.89%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.89%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.89%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.89%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.89%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.89%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.89%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.89%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
2199352024	Bare-fallow DEEP SOIL	Environmental
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Host-Associated
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009400	Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858	Environmental
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental
3300010346	AD_USMOca	Engineered
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010379	Sb_50d combined assembly	Environmental
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental
3300020057	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2	Environmental
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental
3300021374	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08	Environmental
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental
3300027799 (restricted)	Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG	Environmental
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300028043 (restricted)	Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG	Environmental
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental
3300032046	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40	Environmental
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
deeps_00649780	2199352024	Soil	MTQENIQIGAGVLAVILIVIIILRRKGKKKQQEDEF
INPhiseqgaiiFebDRAFT_1055452182	3300000364	Soil	MTQETVQIISGVLAVLLVGIIILRRKSKKKQQEDEF*
Ga0058859_117455832	3300004798	Host-Associated	LYCLVVPSRRSMTQETVQIIAGVLAVVLIGLIIMRRKGKKKTQDDEF*
Ga0070734_1000022849	3300005533	Surface Soil	MTQQNVVQIVAGILCVLLVAIIIMRRKNKKKSQQDEF*
Ga0070730_109287301	3300005537	Surface Soil	MTQSTVQIVAGVLCLLLIVVVIMRRKGKKKTEDDF*
Ga0066695_104357592	3300005553	Soil	MTQETVQIVAGVLLVVIIGILIMRRKGKKKQQEDEF*
Ga0068859_1020987612	3300005617	Switchgrass Rhizosphere	GDRSMTQETVQIVAGVLAVLLIGIIIMRRKNKKKTQEDEF*
Ga0068864_1009312771	3300005618	Switchgrass Rhizosphere	MTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQDDEF*
Ga0066905_1009556212	3300005713	Tropical Forest Soil	MTQETVQIVAGVLAVLLIGIVIMRRKSKKKTQEDEF*
Ga0066903_1004212053	3300005764	Tropical Forest Soil	MTQQTVQIVAGVLAVILVGIVILRRKNKKSKGADDEF*
Ga0066903_1007560492	3300005764	Tropical Forest Soil	MSQETVQIVAGVLAVILIGIIIMRRKGKKKTEDEF*
Ga0066903_1043256332	3300005764	Tropical Forest Soil	MTQETVQIVAGVLALVLVAIIILRRKSKKKQQEDEF*
Ga0074470_107240831	3300005836	Sediment (Intertidal)	MTQETVQIIAGVLALLLVGIIILRRKNKKKQQEDEF*
Ga0068863_1021818432	3300005841	Switchgrass Rhizosphere	FSFPRGDRSMTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQDDEF*
Ga0068860_1012931881	3300005843	Switchgrass Rhizosphere	LTFHRGDRSMTQETVQIVAGVLAVLIIGIIIMRRKNKKKTQEDEF*
Ga0066656_102202181	3300006034	Soil	MTQETVQIVAGVLLVVVIGILIMRRKNKKKTQEDEF*
Ga0075028_1002798092	3300006050	Watersheds	MSSETVQIIAGLLCVVLVGVIIMRRKTKKKTDQQDEF*
Ga0079037_1024777742	3300006224	Freshwater Wetlands	LEDLAHVATETIVQIVSGVLAVACVVIIIMRRKKKKKQQEDEF*
Ga0075421_1009062264	3300006845	Populus Rhizosphere	MTQETVQIVAGVLAVLIIGIIIMRRKNKKKTQEDEF*
Ga0075421_1013523232	3300006845	Populus Rhizosphere	MTQETVQIVSGALAVLLVGIIFLRRKNKKKQQEDEF*
Ga0075431_1000097414	3300006847	Populus Rhizosphere	MTQETVQLVAGALAVLLVGIIILRRKNKKKQQEDEF*
Ga0075425_1004473923	3300006854	Populus Rhizosphere	MTQETVQIVAGVLAVILIAIVILRRKNKKKQQEDEF*
Ga0075424_1011046644	3300006904	Populus Rhizosphere	MSQTTVQVISGILCVILIVIIILRRKSKKKTEDEF*
Ga0099791_102180632	3300007255	Vadose Zone Soil	MTQETVQIIAGVLAVLLIGIVIMRRKSKKKTQEDEF*
Ga0066710_1002319343	3300009012	Grasslands Soil	MSQTTVQVISGILCVILIVIIILRRKSKKKTEDEF
Ga0066710_1003284701	3300009012	Grasslands Soil	MTQETVQIVAGVLLVVVIGILIMRRKNKKKTQEDEF
Ga0099829_108108031	3300009038	Vadose Zone Soil	MTQETVQIVAGVLLAVIIGILIMRRKGKKKQQEDEF*
Ga0099830_112353342	3300009088	Vadose Zone Soil	MTQETVQIIAGVLAVLLIGIIIMRRKSKKKTQEDEF*
Ga0099828_104284902	3300009089	Vadose Zone Soil	MTQETVQLIAGALAVLLIGIIILRRKNKKKQQDDEF*
Ga0099827_109723592	3300009090	Vadose Zone Soil	MTQETVQIIAGVLAVLIIGIVVMRRKSKKKTQEDEF*
Ga0105240_100470062	3300009093	Corn Rhizosphere	MTQSTVQIVAGILCLAVIAIIIMRRKGKKKSEDEF*
Ga0066709_1009387402	3300009137	Grasslands Soil	MTQETVQIISGALAVLLVGIIFLRRKSKKKEQEDEF*
Ga0099792_104571842	3300009143	Vadose Zone Soil	MSSETVQIIAGVLCIVLVGVIIMRRKNKKKTDQQDEF*
Ga0099792_107165731	3300009143	Vadose Zone Soil	DLSMTQETVQIVAGVLLVVIIGILIMRRKGKKKQQKDEF*
Ga0099792_107916102	3300009143	Vadose Zone Soil	MTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQEDEF*
Ga0114129_114014872	3300009147	Populus Rhizosphere	MTQETVQIVAGVLAVLLIGIVIMRRKNKKKTQEDEF*
Ga0075423_115510572	3300009162	Populus Rhizosphere	MTQETVQLVAGALAVLLVGIIILRRKNKKKHQEDEF*
Ga0116854_10357092	3300009400	Soil	MSQTTVQIIAGVLCVLLIVVIIMRRKSKKKVDDDF*
Ga0126312_108942521	3300010041	Serpentine Soil	MTQETVQLVAGVLAVLLVGIIILRRKSKKKQEDEF*
Ga0126310_105625312	3300010044	Serpentine Soil	MTQETVQLVAGALAVLLVGIIILRRKNKKKQQEDDF*
Ga0116239_105803311	3300010346	Anaerobic Digestor Sludge	QQGSDTVVKVVCGVLAVVLIGIVILRRKSKKKQEDEF*
Ga0134128_1000006299	3300010373	Terrestrial Soil	MIQAALTPENVKLISGILAVVLVGIIIMRRKGKKKTEDEF*
Ga0136449_1022712731	3300010379	Peatlands Soil	RTEIIMTQTTVQIVAGVLCVVLIAIVILRRKSKKKTEDDF*
Ga0136449_1032042571	3300010379	Peatlands Soil	MSQETVQIIAAVLAVVIIGVIIMRRKGGKKKQEDEF*
Ga0150983_124370552	3300011120	Forest Soil	MSQETVQIIAAVLAVVLIGIIIMRRKGGKKKQEDEF*
Ga0137391_109362332	3300011270	Vadose Zone Soil	MNQQTVQIIAGVLCVIIIAVIVLRRKGKKKQEDEF*
Ga0137388_101996182	3300012189	Vadose Zone Soil	MTQETVQLIAGALAVLLVGIIILRRKNKKKQQDDEF*
Ga0137383_110421861	3300012199	Vadose Zone Soil	MTQETVQIIAGVLAVLIIGIVIMRRKSKKKTQEDEF*
Ga0137399_106242232	3300012203	Vadose Zone Soil	MVTEENIKIIAAVLAVVLIAIIIMRRKNKKKQQDDEF*
Ga0137376_116104542	3300012208	Vadose Zone Soil	MSQETVQIVAGVLLVVIIGIIIMRRKNKKKTQEDDF*
Ga0137379_104485493	3300012209	Vadose Zone Soil	MTQETVRIISGVLAVLLVGLIVLRRKSKKKQQEDEF*
Ga0137378_106248412	3300012210	Vadose Zone Soil	MTQETFQIIAGVLAVLIIGIVIMRRKSKKKTQEDEF*
Ga0137377_112309891	3300012211	Vadose Zone Soil	MTQETVQIIAGVLAVVLIAIIILRRKSKKKQQEDEF*
Ga0137377_116837802	3300012211	Vadose Zone Soil	MTQETVQIVAGVLLAVIIGILIMRRKSKKKQQEDEF*
Ga0150985_1173620692	3300012212	Avena Fatua Rhizosphere	MTQETVQIVAGVLLVVIIGILIMRRKSKKKTQEDDF*
Ga0150985_1208654952	3300012212	Avena Fatua Rhizosphere	MTQETVQIIAGVLAVVLIGLIIMRRKSKKKTQEDEF*
Ga0150985_1215156012	3300012212	Avena Fatua Rhizosphere	MTQETVQIIAGILAVVLIGLIIMRRKGKKKTQEDEF*
Ga0137372_107009222	3300012350	Vadose Zone Soil	MTQETVQIIAGVLAVLLIGIIVMRRKSKKKTQEDEF*
Ga0137369_105293791	3300012355	Vadose Zone Soil	TRIAQAGEDMSQEMVRIIAGVLAIILVVIIIMRRKARKKTEDEF*
Ga0137360_104160072	3300012361	Vadose Zone Soil	MTQETVQIVAGVLLVVIIGILIMSRKGKKKQQEDEF*
Ga0150984_1022675592	3300012469	Avena Fatua Rhizosphere	MTQETVQIVAGVLLVVIIGILIMRRKNKKKTQEDDF*
Ga0137373_110368232	3300012532	Vadose Zone Soil	EEDSMTQETVQIIAGVLAVLLIGIIVMRRKSKKKTQEDEF*
Ga0137398_109762852	3300012683	Vadose Zone Soil	MSQETVQIVAGVLLVVIIGILIMRRKNKKKTQEDDF*
Ga0137394_111990351	3300012922	Vadose Zone Soil	RSIAMTQETVQLVAGALAVLLVGIIILRRKNKKKQQQDDEF*
Ga0137359_116418641	3300012923	Vadose Zone Soil	MTQETVQIIAGVLAVLIIGIVILRRNSKKKTQDDEF*
Ga0164299_113620892	3300012958	Soil	MTQETVQIVAGVLAVLIIGIIIMRRKNKKKTQDDEF*
Ga0157380_119819902	3300014326	Switchgrass Rhizosphere	MTQETVQIVAGVLAVLLIGIIIMRRKNKKKTQEDEF*
Ga0182024_103613983	3300014501	Permafrost	MSQETVQIIAAVLAVVIIGVIVMRRKGGKKKQEDEF*
Ga0184638_12669632	3300018052	Groundwater Sediment	MTEETVKIVAGVLAVLIIGIIIMRRKSKKKTQEDEF
Ga0184615_104624162	3300018059	Groundwater Sediment	VDANTIVQVVSAVLAVLCVVIIIMRRKKKKKQQDEF
Ga0187893_1000118426	3300019487	Microbial Mat On Rocks	VNQETVQIISAVLAVLCVVIIILRRKGKKKDSQQDEF
Ga0163151_102206232	3300020057	Freshwater Microbial Mat	MTPETVQIISAVLCVALVGIIIMRRKSKKKDAPQDDF
Ga0210400_112570252	3300021170	Soil	LAQVTPQNIVQLIAGILCLALIGILIMRRKGKKKHQEDEF
Ga0213881_100611702	3300021374	Exposed Rock	MTSQGTVQLIAAILLVVVIAVIIMRRKGRKKQQEDEF
Ga0210384_117612752	3300021432	Soil	PVTPQNIVQLIAGILCLALIGILIMRRKGKKKHQEDEF
Ga0126371_109152872	3300021560	Tropical Forest Soil	MSQETVQIVAGVLAVILIGIIIMRRKGKKKTEDEF
Ga0179589_101971192	3300024288	Vadose Zone Soil	MSSETVQIIAGVLCIVLVGVIIMRRKNKKKTDQQDEF
Ga0209172_100292555	3300025310	Hot Spring Sediment	MTQETVQIVAAILAVLCVVAIVIRRKNKKKTTSQDDF
Ga0207680_110713732	3300025903	Switchgrass Rhizosphere	MTQSTVQIVAGILCLAVIAIIIMRRKGKKKSEDEF
Ga0207701_102881282	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQDDEF
Ga0207704_106354572	3300025938	Miscanthus Rhizosphere	MTQETVQIVAGVLAVLIIGIIIMRRKNKKKTQEDEF
Ga0207641_117341371	3300026088	Switchgrass Rhizosphere	PFSCYTAFSFPRGDRSMTQETVQIIAGVLAVLIIGIVIMRRKNKKKTQDDEF
Ga0209648_102579093	3300026551	Grasslands Soil	MTQENIQIGAGVLAVILILIIILRRKGKKKQQEDEF
(restricted) Ga0233416_101057482	3300027799	Sediment	MTQETVQIVAGILCIVLVVIIILRRKVKKKKQEDEF
Ga0209060_1000044949	3300027826	Surface Soil	MTQQNVVQIVAGILCVLLVAIIIMRRKNKKKSQQDEF
Ga0209590_102309863	3300027882	Vadose Zone Soil	MTQETVQLIAGALAVLLIGIIILRRKNKKKQQDDEF
Ga0209382_113407622	3300027909	Populus Rhizosphere	MTQETVQIVSGALAVLLVGIIFLRRKNKKKQQEDEF
Ga0209069_105116022	3300027915	Watersheds	DTTVQIVAGVLLVVIIAVIVMRRKGKKSSSSEDEF
(restricted) Ga0233417_101159961	3300028043	Sediment	LDQSTVQIIAGILCVVCVAIIIMRRKAKKKQSQEDDC
Ga0308309_113912412	3300028906	Soil	MSQETVQLVAAILAVVLIGIIIMRRKGSKKKQEDEF
Ga0170824_1198568682	3300031231	Forest Soil	MTPQNIVQLVAGILCLALIGILIMRRKGKKKHQEDEF
Ga0302321_1019967192	3300031726	Fen	MDQTTVQIIAGVLLVVVIGVIIMRRKGKKTTSTEDDF
Ga0315293_111810892	3300031746	Sediment	VAPEIAVQIGCAVLAVLCVVIIIMRRKKKKKQQQEDEF
Ga0307475_100258882	3300031754	Hardwood Forest Soil	LAQVTPQNIVQLVAGILCLALIGILIMRRKAKKKHQEDEF
Ga0307475_103238152	3300031754	Hardwood Forest Soil	MTPQNIVQLIAGILCLALIGILIMRRKGKKKRQEDEF
Ga0315288_101383211	3300031772	Sediment	VAPEIAVQIGCAVLAVLCVVIIIMRRKKKKKKQQEDEF
Ga0315288_113152792	3300031772	Sediment	VDATTVVQLASAVLAVLCIAVIIMRRKKKKKQKQAEDDF
Ga0308174_100208462	3300031939	Soil	MIQAALTPENVKLISGILAVVLVGIIIVRRKGKKKTEDEF
Ga0315294_110076881	3300031952	Sediment	VAPETVVQIGCAVLAVLCVVIIIMRRKKKKKQQREDEF
Ga0315289_100326766	3300032046	Sediment	VAPETAVQIGCAVLAVLCVVIIIMRRKKKKKQQQEDEF
Ga0315277_100675166	3300032118	Sediment	VAPETAVQIGCAVLAVLCVVIIIMRRKKKKKQQEDEF
Ga0315295_103199702	3300032156	Sediment	VAPEIAVQIGCAVLAVLCVVIIIMRRKKKKKQQEDEF
Ga0315268_123898932	3300032173	Sediment	VAPENVVQIACAVLAVLCVVIIIMRRKKKKKKQEDEF
Ga0315276_109814771	3300032177	Sediment	VAPENVVQIACAVLAVLCVVIIIMRRKKKKKQQQEDEF
Ga0315275_102887852	3300032401	Sediment	VAPEIAVQIGCAVLAVLCVVIIIMRRKKKKKQQEDDF
Ga0348332_122007022	3300032515	Plant Litter	NYCMDAGTIQIIAAVLAVVLIGVIIMRRKGGKKKTDDDF
Ga0315273_100091276	3300032516	Sediment	VAPETVVQIGCAVLAVLCVVIIIMRRKKKKKQQEDEF
Ga0335085_100197711	3300032770	Soil	MTQATVQIVSGVLAVLLIVIVILRRKSKKKQEEDEF
Ga0335076_103759562	3300032955	Soil	MTQSTVQIIAGVLCVLVIVAIFLRRKGKKKTEDDF
Ga0335077_120893552	3300033158	Soil	MSQETIQIVSAVLAVVLIGIIIMRRKGKKKTEDEF
Ga0310810_101916712	3300033412	Soil	MTQETVQIIAGVLAVLLIGIIIMRRKSKKKTQEDEF
Ga0316619_111100462	3300033414	Soil	LEDLAHVATETIVQIVSGVLAVACVVIIIMRRKKKKKQQEDEF
Ga0316617_1025754012	3300033557	Soil	VATETIVQIVSGVLAVACVVIIIMRRKKKKKQQEDEF