NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082853

Metagenome / Metatranscriptome Family F082853

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082853
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 57 residues
Representative Sequence VRRLRFALLGATLAYFFDPDNGSTRRKAAIKRLVALRAARRPELADDLVGQARDAS
Number of Associated Samples 104
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 24.78 %
% of genes from short scaffolds (< 2000 bps) 77.88 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.434 % of family members)
Environment Ontology (ENVO) Unclassified
(39.823 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.133 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 59.52%    β-sheet: 0.00%    Coil/Unstructured: 40.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF00990GGDEF 35.40
PF00005ABC_tran 24.78
PF08402TOBE_2 4.42
PF13416SBP_bac_8 2.65
PF00171Aldedh 1.77
PF01244Peptidase_M19 0.88
PF00528BPD_transp_1 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.77
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.77
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.77
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_187844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1031Open in IMG/M
3300000891|JGI10214J12806_10468334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300000955|JGI1027J12803_101494352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1034Open in IMG/M
3300001686|C688J18823_10122988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1798Open in IMG/M
3300001686|C688J18823_10456532All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300003990|Ga0055455_10198243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300004156|Ga0062589_101440066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300005093|Ga0062594_100001801All Organisms → cellular organisms → Bacteria5278Open in IMG/M
3300005163|Ga0066823_10031460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium882Open in IMG/M
3300005294|Ga0065705_10121589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2943Open in IMG/M
3300005328|Ga0070676_10772592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300005329|Ga0070683_100229546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1765Open in IMG/M
3300005329|Ga0070683_100724570All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300005334|Ga0068869_100635649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium905Open in IMG/M
3300005336|Ga0070680_100655105All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005341|Ga0070691_10157153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1170Open in IMG/M
3300005344|Ga0070661_100307220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1236Open in IMG/M
3300005437|Ga0070710_10836909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300005441|Ga0070700_101063472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300005466|Ga0070685_10067857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2105Open in IMG/M
3300005526|Ga0073909_10093869All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300005535|Ga0070684_100709895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium938Open in IMG/M
3300005539|Ga0068853_100112861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2416Open in IMG/M
3300005539|Ga0068853_100854894All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300005544|Ga0070686_100049224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2673Open in IMG/M
3300005549|Ga0070704_100476025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1080Open in IMG/M
3300005615|Ga0070702_100562344All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005842|Ga0068858_100353970All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300005888|Ga0075289_1085456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300005983|Ga0081540_1012237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5672Open in IMG/M
3300006237|Ga0097621_100429655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1187Open in IMG/M
3300006806|Ga0079220_11532432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300006845|Ga0075421_100875620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1027Open in IMG/M
3300006854|Ga0075425_101250569All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300006914|Ga0075436_101048539All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300009148|Ga0105243_12380517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300009174|Ga0105241_10131138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2029Open in IMG/M
3300009176|Ga0105242_10255809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1580Open in IMG/M
3300009551|Ga0105238_12547133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300010147|Ga0126319_1342619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1114Open in IMG/M
3300010154|Ga0127503_11174260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300010329|Ga0134111_10390853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300010371|Ga0134125_10030412All Organisms → cellular organisms → Bacteria6013Open in IMG/M
3300010396|Ga0134126_10372552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1662Open in IMG/M
3300012198|Ga0137364_11055251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300012200|Ga0137382_10278205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1164Open in IMG/M
3300012212|Ga0150985_119905880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300012898|Ga0157293_10029107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1098Open in IMG/M
3300012901|Ga0157288_10216332Not Available621Open in IMG/M
3300012951|Ga0164300_10403046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300012955|Ga0164298_10186250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1201Open in IMG/M
3300012957|Ga0164303_10639915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300012960|Ga0164301_10031006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2548Open in IMG/M
3300012960|Ga0164301_11088791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300012989|Ga0164305_10928991All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300012989|Ga0164305_11707367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300013308|Ga0157375_10011528All Organisms → cellular organisms → Bacteria → Proteobacteria7806Open in IMG/M
3300014968|Ga0157379_10368763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1316Open in IMG/M
3300015374|Ga0132255_102681956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300017792|Ga0163161_11747431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300018031|Ga0184634_10237986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium833Open in IMG/M
3300019883|Ga0193725_1009659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2746Open in IMG/M
3300019886|Ga0193727_1017682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2602Open in IMG/M
3300020004|Ga0193755_1168069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300020005|Ga0193697_1006497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2853Open in IMG/M
3300020070|Ga0206356_11294486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300021363|Ga0193699_10029127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2059Open in IMG/M
3300021445|Ga0182009_10031051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2133Open in IMG/M
3300022756|Ga0222622_10012202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4126Open in IMG/M
3300025552|Ga0210142_1052298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300025900|Ga0207710_10072139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1585Open in IMG/M
3300025903|Ga0207680_10108113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1799Open in IMG/M
3300025907|Ga0207645_10276149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1115Open in IMG/M
3300025910|Ga0207684_11077510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300025911|Ga0207654_10064991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2147Open in IMG/M
3300025917|Ga0207660_10208709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1528Open in IMG/M
3300025927|Ga0207687_10047083All Organisms → cellular organisms → Bacteria2988Open in IMG/M
3300025927|Ga0207687_10075536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2419Open in IMG/M
3300025931|Ga0207644_10399917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1123Open in IMG/M
3300025931|Ga0207644_11611657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300025933|Ga0207706_10891724All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300026035|Ga0207703_11774203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300026041|Ga0207639_10936025All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300027310|Ga0207983_1011219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1026Open in IMG/M
3300027775|Ga0209177_10259501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300027909|Ga0209382_10516871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1313Open in IMG/M
3300028380|Ga0268265_10207605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1704Open in IMG/M
3300028708|Ga0307295_10007694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2510Open in IMG/M
3300028713|Ga0307303_10035056All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300028718|Ga0307307_10010147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2491Open in IMG/M
3300028755|Ga0307316_10260954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300028768|Ga0307280_10079572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1066Open in IMG/M
3300028810|Ga0307294_10084676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium981Open in IMG/M
3300028828|Ga0307312_10077871All Organisms → cellular organisms → Bacteria2022Open in IMG/M
3300028875|Ga0307289_10012600All Organisms → cellular organisms → Bacteria3240Open in IMG/M
3300028875|Ga0307289_10053564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1616Open in IMG/M
3300030336|Ga0247826_11102061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300030336|Ga0247826_11679068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300031058|Ga0308189_10521766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300031094|Ga0308199_1162629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300031152|Ga0307501_10024272All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300031170|Ga0307498_10089581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium926Open in IMG/M
3300031198|Ga0307500_10105602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium761Open in IMG/M
3300031226|Ga0307497_10203555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium859Open in IMG/M
3300031720|Ga0307469_11027302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300031858|Ga0310892_10730353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300031938|Ga0308175_100003240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales11256Open in IMG/M
3300032174|Ga0307470_10569118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300033412|Ga0310810_11269831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300033475|Ga0310811_10246234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2122Open in IMG/M
3300033550|Ga0247829_11148332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300033551|Ga0247830_10572753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium892Open in IMG/M
3300034664|Ga0314786_157143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.31%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.54%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.54%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.65%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.77%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.77%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.89%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027310Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_032325402199352025SoilVRRLRFALIGAALAYFFDPDNGTKRRKGVIKRLAELRAQRGGELAGDLVGQTRAVQEPSTTQD
JGI10214J12806_1046833423300000891SoilVRRLRFALIGAALAYFFDPDNGKARRKALIERLAGLRSRPRPELADDLVGQTRDAS*
JGI1027J12803_10149435223300000955SoilVRRLRFALLGAALAYFFDPDNGKNRRKAAIKRFGELRAEPRPELAEDLAGQARDAS*
C688J18823_1012298833300001686SoilVRRLRLLALGAAFAYFFDPDNGTKRRQAARKRLGELRSQRRPELADDLVGQARDAS*
C688J18823_1045653213300001686SoilRLGRLVRRLRLLALGAALAYFFDPDNGTKRRKAARKRLAELRSQRRPELADDLAGQARDAS*
Ga0055455_1019824313300003990Natural And Restored WetlandsVRRLRYALIGAALAYFFDPDNGTNRRKAAIKRLGELRAQPRPELADDLSAQARDAS*
Ga0062589_10144006623300004156SoilVRRLRFALLGAALAYFFDPDNGKSRRKSAIKRLGELRAERRQELAEDLAGQARDVS*
Ga0062594_10000180123300005093SoilVRGLRLFLLGAALTYFFDPDNGKKRRKAATKRLAELRAKPPEKLADDLVGQVHDTA*
Ga0066823_1003146023300005163SoilVRRLRFALIGAALAYFFDPDNGPKRRKAAIKRLVAMRAARRPELADDLVGQTRGAQTVPGEPPQPD*
Ga0065705_1012158923300005294Switchgrass RhizosphereMRRLRFALLGAALAYYFDPDNGKSRRKAAIKRLGELRAKPRTELAEDLAGQARDAS*
Ga0070676_1077259213300005328Miscanthus RhizosphereVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS*
Ga0070683_10022954623300005329Corn RhizosphereVRRLRFALLGAALAYFFDPDNGKVRREAAIKRLAAMRRGNAQPELAGDLVGQARETT*
Ga0070683_10072457033300005329Corn RhizosphereMRRLRFALLGAALAYFFDPDNGRARRKAALKRLAAMRRGDAQTELADDLVGQARETA*
Ga0068869_10063564923300005334Miscanthus RhizosphereVRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDLVSQARETA*
Ga0070680_10065510523300005336Corn RhizosphereVRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDLVGQARETA*
Ga0070691_1015715313300005341Corn, Switchgrass And Miscanthus RhizosphereVRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDLVGQARDTA*
Ga0070661_10030722023300005344Corn RhizosphereVRRIRFALLGATLAYFFDPDNGSNRRKAAIKRLVALRAARRPELADDLAGHARDAS*
Ga0070710_1083690923300005437Corn, Switchgrass And Miscanthus RhizosphereVRRLRLLVLGAALAYFFDPDNGTKRRKSALKRLAELRSQRRPELADDLVGQARDVS*
Ga0070700_10106347233300005441Corn, Switchgrass And Miscanthus RhizosphereVRRLRFALLGAALAYFFDPDNGKVRREAAIKRLAAMRRGNAQPELAGDLVGQARET
Ga0070685_1006785733300005466Switchgrass RhizosphereVRRLRFALLGAALAYFFDPDNGKVRREAAIKRLAAMRRGNAQPELAGDLVGQARETA*
Ga0073909_1009386923300005526Surface SoilVRRLRFALIGAALAYFFDPDNGKARRKAATKRLAELRSKPPAELTDDLVGQARDTK*
Ga0070684_10070989513300005535Corn RhizosphereMRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDLVGQAR
Ga0068853_10011286133300005539Corn RhizosphereVRRIRFALLGATLAYFFDPDNGSNRRKAAIKRLVALRAARRPELADDLAGQARDAS*
Ga0068853_10085489413300005539Corn RhizosphereRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS*
Ga0070686_10004922443300005544Switchgrass RhizosphereVRRIRFALLGATLAYFFDPDNGSNRRKAAIKRLVALRAARRPELADDLA
Ga0070704_10047602513300005549Corn, Switchgrass And Miscanthus RhizosphereVRRLRFALLGAALAYFFDPDTGKARRKAAIKRLAALRRGDARPELAEDLVGQARDTA*
Ga0070702_10056234423300005615Corn, Switchgrass And Miscanthus RhizosphereLLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS*
Ga0068858_10035397033300005842Switchgrass RhizosphereVRRIRFALLGAMLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS*
Ga0075289_108545633300005888Rice Paddy SoilALAYFFDPENGKSRRKAATKRLVELRSRQRPELADELAGQARDAS*
Ga0081540_101223733300005983Tabebuia Heterophylla RhizosphereMRRLRFALIGAALAYFFDPDNGRKRRKAATKRLAELRSRPPAELTDDLVGQAREPQ*
Ga0097621_10042965533300006237Miscanthus RhizosphereVRRLRFALLGAALAYFFDPDTGKGRRKAAIKRLAALRRGDARPELAEDLVGQARETA*
Ga0079220_1153243223300006806Agricultural SoilVRRLRFALLGAALAYFFDPDNGRARRKAAIKRLSAMRGGDAQTELADDLVGQARETA*
Ga0075421_10087562033300006845Populus RhizosphereVRRLRFALLGAALAYFFDPDNGKSRRKAAIKRLAGLRARPRPELADELAGQARDTQ*
Ga0075425_10125056913300006854Populus RhizosphereVRRLRFALIGAALAYFFDPDNGSKRRKAAIKRLAELRSKPSAELTDDLVGQTRETE*
Ga0075436_10104853913300006914Populus RhizosphereLIGAALAYFFDPDNGSKRRKAAIKRLAELRSKPSAELTDDLVGQTRETE*
Ga0105243_1238051723300009148Miscanthus RhizosphereVRSLRFAFLGAALAYFFDPDNGKSRRKSAIKRLGELRAERRPELAEDLAGQARDAS*
Ga0105241_1013113823300009174Corn RhizosphereVRRLRFALLGAALAYFFDPDNGKARRKAATKRLAALRRGDARPELAEDLVGQARDTA*
Ga0105242_1025580913300009176Miscanthus RhizosphereVRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDL
Ga0105238_1254713323300009551Corn RhizosphereVRRLRFALLGAALAYFFDPDTGKARRKAAIKRLAALRRGDARPELAEDLVGQARETA*
Ga0126319_134261923300010147SoilVRRLRFALIGAALAYFFDPDNGTKRRKGVIKRLAELRAQRGGELADDLVGQTRAVQEPSTTQD*
Ga0127503_1117426023300010154SoilVRRLRFALLGATLAYFFDPDNGSTRRKAAIKRLVALRAARRPELADDLVGQARDAS*
Ga0134111_1039085313300010329Grasslands SoilASRATSTGATEVRRLRFALLGAALAYFFDPDNGKSRRKAAIKRLGELRSQPRPELADDLVGQARDTQ*
Ga0134125_1003041243300010371Terrestrial SoilVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDVS*
Ga0134126_1037255233300010396Terrestrial SoilVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALQAARRAELADDLAGQARDAS*
Ga0137364_1105525113300012198Vadose Zone SoilVRRLRFALLGAALAYFFDPDNGKSRRKAAIKRLGELRSQPRPELADDLVGQARDTQ*
Ga0137382_1027820533300012200Vadose Zone SoilVRRLRFALLGAALAYFFDPDNGKSRRKTAIKRLGELRSQPRPELADDLVGQARDTQ*
Ga0150985_11990588033300012212Avena Fatua RhizosphereVRRLRLLALGAALAYFFDPDNGTKRRQAARKRLGELRSRRRPELADDLVGQARDAS*
Ga0157293_1002910733300012898SoilVRRLRFALIGAALAYFFDPDNGKARRKALIERLAGLRSRPRPELADDLVCQTRDAS*
Ga0157288_1021633233300012901SoilVRRLRFALLGALLAYFFDPDNGKKRRKAATKRLAELRSKQPAELTDDLVGQAREPK*
Ga0164300_1040304613300012951SoilVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRAELADDLAGQARDAS*
Ga0164298_1018625033300012955SoilVRRLRFALIGAALAYFFDPDNGPKRRKAAIKRLVAMRAARRPELADDLVGQTRSAEPVGEAPQP
Ga0164303_1063991513300012957SoilVRRLRFALIGAALAYFFDPDNGKARRKAATKRLAELRSKPPAELTDDLVGQARDIK
Ga0164301_1003100633300012960SoilVRRLRFALIGAALAYFFDPDNGPKRRKAAIKRLVAMRAARRPELADDLVGQTRSAEPVGEAPQPD*
Ga0164301_1108879123300012960SoilVRRIRFALLGATLAYFFDPDSGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS*
Ga0164305_1092899123300012989SoilALIGAALAYFFDPDNGPKRRKAAIKRLVAMRAARRPELADDLVGQTRSAEPVGEAPQPD*
Ga0164305_1170736723300012989SoilRATSTGATEVRRLRFALIGAALAYFFDPDNGKARRKAATKRLAELRSKPPAELTDDLVGQARDTK*
Ga0157375_1001152843300013308Miscanthus RhizosphereVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRSELADDLAGQARDAS*
Ga0157379_1036876323300014968Switchgrass RhizosphereVRRIRFALLGATLAYFFDPDNGSKRRKTAIKRLVALRAARRPELADDLAGQARDAS*
Ga0132255_10268195623300015374Arabidopsis RhizosphereVRRLRFALIGAALAYFFDPDNGSKRRKPAIKRLAELRSKPSAELTDDLVGQTRETE*
Ga0163161_1174743123300017792Switchgrass RhizosphereVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS
Ga0184634_1023798633300018031Groundwater SedimentVRSLRFALIGAALAYFFDPDNGTKRRKAAIKRLSELRAERRPELADDLVGQTRGVQEPSATQD
Ga0193725_100965943300019883SoilVRRLRFALIGAALAYFFDPDNGTKRRKGVIKRLAELPAQPGGELADDLVGQTRAVQEPSTTQD
Ga0193727_101768223300019886SoilVRRLRFALIGAALAYFFDPDNGTKRRKGVIKRLAELRAQPGGELADDLVGQTRAVQEPSTTQD
Ga0193755_116806913300020004SoilVRRLRFALIGAALAYFFDPDNGTKRRKGVIKRLAELRAQPSGELAD
Ga0193697_100649723300020005SoilVRSLRFALIGAALAYFFDPDNGTKRRKAAIKRLAELRAERRPELADDLVGQTRGVQEPSATQD
Ga0206356_1129448623300020070Corn, Switchgrass And Miscanthus RhizosphereVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDVS
Ga0193699_1002912713300021363SoilVRRLRFALIGAALAYFFDPDNGTKRRKGVIKRLAELRAQPGGELADDLVGQTRAVQEPATTQD
Ga0182009_1003105133300021445SoilVRRLRFALLGAALAYFFDPDNGKVRREAAIKRLAAMRRGNAQPELAGDLVGQARETT
Ga0222622_1001220223300022756Groundwater SedimentVRRLRYALIGAALAYFFDPDNGTKRRKGAIKRLAELRVDRRPELADDLVGQTRGVQEPSTSQD
Ga0210142_105229823300025552Natural And Restored WetlandsVRRLRYALIGAALAYFFDPDNGTNRRKAAIKRLGELRAQPRPELADDLSAQARDAS
Ga0207710_1007213923300025900Switchgrass RhizosphereVRGLRLFLLGAALTYFFDPDNGKKRRKAATKRLAELRAKPPEKLADDLVGQVHDTA
Ga0207680_1010811323300025903Switchgrass RhizosphereVRRLRFALLGAALAYFFDPDTGKARRKAAIKRLAALRRGDARPELAEDLVGQARDTA
Ga0207645_1027614923300025907Miscanthus RhizosphereVRRIRFALLGATLAYFFDPDNGSKRGKAAIKRLVALRAARRPELADDLAGQARDAS
Ga0207684_1107751023300025910Corn, Switchgrass And Miscanthus RhizosphereVRRIRFALLGATLAYFFDPDNGSNRRKAAIKRLVALRAARRPELADDLAGQARDAS
Ga0207654_1006499123300025911Corn RhizosphereVRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDLVGQARDTA
Ga0207660_1020870923300025917Corn RhizosphereVRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDLVSQARETA
Ga0207687_1004708313300025927Miscanthus RhizosphereRFAILGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS
Ga0207687_1007553633300025927Miscanthus RhizosphereVRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDLVGQARETA
Ga0207644_1039991733300025931Switchgrass RhizosphereVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAG
Ga0207644_1161165723300025931Switchgrass RhizosphereIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS
Ga0207706_1089172423300025933Corn RhizosphereLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAEDLVGQARETA
Ga0207703_1177420323300026035Switchgrass RhizosphereVRRIRFALLGAMLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS
Ga0207639_1093602513300026041Corn RhizosphereEVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS
Ga0207983_101121923300027310SoilVRRLRFALIGAALAYFFDPDNGPKRRKAAIKRLVAMRAARRPELADDLVGQTRGAQTVPGEPPQPD
Ga0209177_1025950113300027775Agricultural SoilVRRLRFALLGAALAYFFDPDNGKARRKAAIKRLAALRRGDARPELAE
Ga0209382_1051687133300027909Populus RhizosphereVRRLRFALLGAALAYFFDPDNGKSRRKAAIKRLAGLRARPRPELADELAGQARDTQ
Ga0268265_1020760533300028380Switchgrass RhizosphereVRRIRFALLGATLAYFFDPDNGSKRRKAAIRRLVALRAARRSELADDLAGQARDAS
Ga0307295_1000769443300028708SoilVRRLRYALIGAALAYFFDPDNGTKRRKGAIKRLAELRVDRRPELADD
Ga0307303_1003505623300028713SoilVRRLRFALIGAALAYFFDPDNGKKRRKAATKRLTELRSKPPAELTDDLVGQARDTK
Ga0307307_1001014723300028718SoilVRRLRFALIGAALAYFFDPDNGKKRRKAATKRLTELRSKQPAELTDDLVGQARDTK
Ga0307316_1026095413300028755SoilVRSLRFALIGAALAYFFDPDNGTKRRNGAIKRLAELRAERRPELADDLVGQTRGVQEPSATQD
Ga0307280_1007957223300028768SoilVRRLRYALIGAALAYFFDPDNGTKRRKGAIKRLAELRADRRPELADDLVGQTRGGQEPSTSQD
Ga0307294_1008467613300028810SoilVRRLRYALIGAALAYFFDPDNGTKRRKGAIKRLAELRVDRRPELADDLV
Ga0307312_1007787113300028828SoilRRLRFALIGAALAYFFDPDNGKKRRKAATKRLTELRSKPPAELTDDLVGQARDTK
Ga0307289_1001260033300028875SoilVRRLRFALLGAALAYFFDPDKGKSRRKAMIKRLANLRSKPSAGLTDDLVGQARDTK
Ga0307289_1005356433300028875SoilVRRLRNALIGAALAYFFDPDNGTKRRKGAIKRLAELRADRRPELADDLVGQTRGGQEPSTSQD
Ga0247826_1110206133300030336SoilVRRLRFALLGAALAYFFDPDNGKSRRKAAIKRLAEVRSDRGGELADDLVGQTR
Ga0247826_1167906823300030336SoilVRRIRFALLGATLAYFFDPDNGSMRRKAAIKRLVALRAARRPELADDLAGHARDAS
Ga0308189_1052176623300031058SoilVRRLRFALIGAALAYFFDPDNGTTRRKRVIKRLAELRAQSGGELADDLVGQTRAVQEPSTTQD
Ga0308199_116262913300031094SoilVARRPGRLRLIAFGAALSYFFDPDNGKKRRKAATKRLTELRSKPPAELTDDLVGQARDTK
Ga0307501_1002427223300031152SoilVRRLRFALIGAALAYFFDPDNGTKRRKGVIKRLAELRAQRGGELADDLVGQTRAVHEPSTSQD
Ga0307498_1008958133300031170SoilVRRLRFALIGAALAYFFDPDNGTKRRKGVIKRLAELRAQRGGELADDLVGQTRAVQEPSTTQD
Ga0307500_1010560223300031198SoilVRRVRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLAGQARDAS
Ga0307497_1020355523300031226SoilVRRLRFALIGAALAYFFDPDNGTKRRKRVIKRLAELRAQRGGELADDLVGQTRAVQEPSTTQD
Ga0307469_1102730223300031720Hardwood Forest SoilVRRIRFALLGATLAYFFDPDNGSKRRKTAIKRLVALRAARRPELADDLAGHARDAS
Ga0310892_1073035313300031858SoilVRRLRFALVGAALAYFFDPDNGSKRRKAAIKRIVAMRAARRPELADDLVG
Ga0308175_10000324053300031938SoilVRRLRYALIGAALAYFFDPDNGTKRRKGAIKRLAELRAGRRPELADELAGQARDGS
Ga0307470_1056911833300032174Hardwood Forest SoilVRRIRFALLGATLAYFFDPDNGSKRRKAAIKRLVALRAARRPELADDLA
Ga0310810_1126983123300033412SoilVRRLRFALIGAALAYFFDPDNGSKRRKAAIKRLAELRSKPPAELTDDLVGQTRETE
Ga0310811_1024623423300033475SoilVRRLRFALIGAALAYFFDPDNGSKRRKAAIKRLAELRSKPSAELTDDLVGQTRETE
Ga0247829_1114833213300033550SoilVRRLRFALLGAALAYFFDPDNGKSRRKAAIKRLAEVRSDRGGELADDLVGQTRSVQEPSPTHE
Ga0247830_1057275313300033551SoilVHRLRFALLGAALAYLFDPDNGKSRRKAAIKRLGELRAKPRAELAEDLAGQARDAS
Ga0314786_157143_65_2353300034664SoilVRRLRFALIGAALAYFFDPDNGKARRKAATKRLAELRSKPPAELTDDLVGQARDTK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.