Basic Information | |
---|---|
Family ID | F082848 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 45 residues |
Representative Sequence | MKAYKAAQAKDQDKMIDLSETLSAACAGCHRKWRDRRTPANRCK |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.65 % |
% of genes near scaffold ends (potentially truncated) | 94.69 % |
% of genes from short scaffolds (< 2000 bps) | 92.92 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.487 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.929 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.363 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.673 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF13531 | SBP_bac_11 | 11.50 |
PF00069 | Pkinase | 6.19 |
PF01322 | Cytochrom_C_2 | 4.42 |
PF02230 | Abhydrolase_2 | 3.54 |
PF07690 | MFS_1 | 3.54 |
PF00753 | Lactamase_B | 2.65 |
PF02518 | HATPase_c | 1.77 |
PF07366 | SnoaL | 1.77 |
PF13676 | TIR_2 | 1.77 |
PF02687 | FtsX | 1.77 |
PF04389 | Peptidase_M28 | 1.77 |
PF13620 | CarboxypepD_reg | 1.77 |
PF13349 | DUF4097 | 1.77 |
PF10518 | TAT_signal | 0.88 |
PF00176 | SNF2-rel_dom | 0.88 |
PF13442 | Cytochrome_CBB3 | 0.88 |
PF13601 | HTH_34 | 0.88 |
PF14200 | RicinB_lectin_2 | 0.88 |
PF13290 | CHB_HEX_C_1 | 0.88 |
PF12704 | MacB_PCD | 0.88 |
PF02225 | PA | 0.88 |
PF01769 | MgtE | 0.88 |
PF03102 | NeuB | 0.88 |
PF05163 | DinB | 0.88 |
PF03544 | TonB_C | 0.88 |
PF14833 | NAD_binding_11 | 0.88 |
PF13561 | adh_short_C2 | 0.88 |
PF00496 | SBP_bac_5 | 0.88 |
PF11066 | DUF2867 | 0.88 |
PF01925 | TauE | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 24.78 |
COG3909 | Cytochrome c556 | Energy production and conversion [C] | 4.42 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.88 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 0.88 |
COG2089 | Sialic acid synthase SpsE, contains C-terminal SAF domain | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.88 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.49 % |
Unclassified | root | N/A | 34.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_105578153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1914 | Open in IMG/M |
3300000890|JGI11643J12802_10619118 | Not Available | 569 | Open in IMG/M |
3300004463|Ga0063356_105082038 | Not Available | 565 | Open in IMG/M |
3300004633|Ga0066395_10289251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
3300005169|Ga0066810_10173032 | Not Available | 529 | Open in IMG/M |
3300005334|Ga0068869_101527429 | Not Available | 593 | Open in IMG/M |
3300005347|Ga0070668_101873974 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005364|Ga0070673_101110790 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300005367|Ga0070667_100667960 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300005457|Ga0070662_100163396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1743 | Open in IMG/M |
3300005543|Ga0070672_101943610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300005544|Ga0070686_101321599 | Not Available | 603 | Open in IMG/M |
3300005718|Ga0068866_10304662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
3300005764|Ga0066903_106274466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300005764|Ga0066903_108791350 | Not Available | 513 | Open in IMG/M |
3300005840|Ga0068870_11158225 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005843|Ga0068860_100211362 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
3300005844|Ga0068862_101459333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300006237|Ga0097621_100651342 | Not Available | 966 | Open in IMG/M |
3300006237|Ga0097621_101097207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300006358|Ga0068871_100539318 | Not Available | 1055 | Open in IMG/M |
3300006581|Ga0074048_13438856 | Not Available | 557 | Open in IMG/M |
3300006844|Ga0075428_101975009 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
3300006881|Ga0068865_102124135 | Not Available | 511 | Open in IMG/M |
3300006903|Ga0075426_10952284 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300006904|Ga0075424_101014056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
3300009100|Ga0075418_10647869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
3300009100|Ga0075418_11279107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
3300009100|Ga0075418_11568438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300009148|Ga0105243_10638294 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300009148|Ga0105243_12467523 | Not Available | 559 | Open in IMG/M |
3300009176|Ga0105242_10030992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4270 | Open in IMG/M |
3300009176|Ga0105242_10677931 | Not Available | 1006 | Open in IMG/M |
3300009177|Ga0105248_11255489 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300009551|Ga0105238_12764511 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300009792|Ga0126374_10563642 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300010397|Ga0134124_10070012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2989 | Open in IMG/M |
3300010400|Ga0134122_10188973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1701 | Open in IMG/M |
3300011422|Ga0137425_1183224 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300012212|Ga0150985_101805873 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
3300012212|Ga0150985_103241311 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300012469|Ga0150984_103742619 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300012893|Ga0157284_10026942 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300012895|Ga0157309_10170772 | Not Available | 661 | Open in IMG/M |
3300012898|Ga0157293_10019262 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300012900|Ga0157292_10423298 | Not Available | 509 | Open in IMG/M |
3300012903|Ga0157289_10279022 | Not Available | 582 | Open in IMG/M |
3300012910|Ga0157308_10286872 | Not Available | 597 | Open in IMG/M |
3300012911|Ga0157301_10203239 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300012912|Ga0157306_10352534 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 559 | Open in IMG/M |
3300012924|Ga0137413_10912602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
3300012943|Ga0164241_10629586 | Not Available | 777 | Open in IMG/M |
3300012961|Ga0164302_11075182 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012985|Ga0164308_10036035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3071 | Open in IMG/M |
3300013296|Ga0157374_11327602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
3300013308|Ga0157375_10999838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
3300014745|Ga0157377_11596484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300015372|Ga0132256_102577025 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300015374|Ga0132255_103231156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300016404|Ga0182037_11982829 | Not Available | 522 | Open in IMG/M |
3300017792|Ga0163161_11733208 | Not Available | 554 | Open in IMG/M |
3300018067|Ga0184611_1071938 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300018081|Ga0184625_10254740 | Not Available | 919 | Open in IMG/M |
3300018432|Ga0190275_10231785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1769 | Open in IMG/M |
3300018481|Ga0190271_13173050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
3300018482|Ga0066669_10482758 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300019362|Ga0173479_10036571 | Not Available | 1528 | Open in IMG/M |
3300019362|Ga0173479_10113469 | Not Available | 1026 | Open in IMG/M |
3300021082|Ga0210380_10417119 | Not Available | 614 | Open in IMG/M |
3300021082|Ga0210380_10466268 | Not Available | 579 | Open in IMG/M |
3300021859|Ga0210334_11078735 | Not Available | 723 | Open in IMG/M |
3300024187|Ga0247672_1017677 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300025907|Ga0207645_10531551 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300025908|Ga0207643_10483831 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300025920|Ga0207649_10487058 | Not Available | 936 | Open in IMG/M |
3300025923|Ga0207681_10229000 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300025931|Ga0207644_10839268 | Not Available | 769 | Open in IMG/M |
3300025940|Ga0207691_10982281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 705 | Open in IMG/M |
3300025972|Ga0207668_10988484 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300026116|Ga0207674_11887703 | Not Available | 564 | Open in IMG/M |
3300026118|Ga0207675_100111068 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
3300026118|Ga0207675_100764656 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Limnoglobus → Limnoglobus roseus | 978 | Open in IMG/M |
3300026118|Ga0207675_101334287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300026121|Ga0207683_10094106 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
3300027682|Ga0209971_1105302 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300027874|Ga0209465_10229585 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300027915|Ga0209069_10517460 | Not Available | 675 | Open in IMG/M |
3300028379|Ga0268266_12244014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300028380|Ga0268265_12267350 | Not Available | 550 | Open in IMG/M |
3300028812|Ga0247825_10026421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3811 | Open in IMG/M |
3300029636|Ga0222749_10400449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300031198|Ga0307500_10283010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300031226|Ga0307497_10460349 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031562|Ga0310886_10654096 | Not Available | 650 | Open in IMG/M |
3300031847|Ga0310907_10656433 | Not Available | 576 | Open in IMG/M |
3300031858|Ga0310892_10220200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
3300031892|Ga0310893_10439099 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031938|Ga0308175_101547607 | Not Available | 741 | Open in IMG/M |
3300031938|Ga0308175_102046014 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031939|Ga0308174_11109580 | Not Available | 673 | Open in IMG/M |
3300032002|Ga0307416_102970744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 567 | Open in IMG/M |
3300032012|Ga0310902_10088933 | Not Available | 1623 | Open in IMG/M |
3300032013|Ga0310906_10039391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2235 | Open in IMG/M |
3300032075|Ga0310890_10976129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 680 | Open in IMG/M |
3300032075|Ga0310890_11540985 | Not Available | 548 | Open in IMG/M |
3300032076|Ga0306924_10188014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2371 | Open in IMG/M |
3300032144|Ga0315910_10912036 | Not Available | 685 | Open in IMG/M |
3300032770|Ga0335085_12515424 | Not Available | 510 | Open in IMG/M |
3300033004|Ga0335084_11898847 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300033550|Ga0247829_11008189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300034148|Ga0364927_0172159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300034664|Ga0314786_126993 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300034664|Ga0314786_144826 | Not Available | 551 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 13.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.31% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.65% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.77% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.77% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.77% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1055781533 | 3300000559 | Soil | KDQDKMIDASNAVNASCEGCHRRWRNPRTPANRCK* |
JGI11643J12802_106191182 | 3300000890 | Soil | QDVRDISMKAYAAAQAKDQDKIIAVSETLSAACAGCHRKWRDRKAPENRCK* |
Ga0063356_1050820382 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VQQVRDASMQAYKAAQAKDQDKMIELSEKLSACCSGCHRKWRDRRAIENRCK* |
Ga0066395_102892511 | 3300004633 | Tropical Forest Soil | WVAFVQEVRDVGMKSYKAAQAKDQDKIIEISDTLSRACSGCHRKFRDRKTPQNRCK* |
Ga0066810_101730322 | 3300005169 | Soil | YKAAQAKDQDKMIDIAETLSRACAGCHRKWRDRRTPDNRCK* |
Ga0068869_1015274291 | 3300005334 | Miscanthus Rhizosphere | AQAKDQDKIVEISETLSTSCSGCHRKFRDRKAPENRCKPS* |
Ga0070668_1018739741 | 3300005347 | Switchgrass Rhizosphere | KAYRAAQAKDQDKMIDISESLSAACAGCHRKWRDRRTPDNRCK* |
Ga0070673_1011107902 | 3300005364 | Switchgrass Rhizosphere | YAAAQAKDQDKIIAVSETLSASCAGCHRKWRDRKTKENRCK* |
Ga0070667_1006679601 | 3300005367 | Switchgrass Rhizosphere | VSMKSYKAAQAKDQEKMIDLSEALSRSCAGCHRKWRDRRTPDNRCK* |
Ga0070662_1001633963 | 3300005457 | Corn Rhizosphere | QDVRDISMKAYAAAQAKDQDKIIAVSETLSAACAGCHRKWRDRKAPDNRCK* |
Ga0070672_1019436102 | 3300005543 | Miscanthus Rhizosphere | GMKAYKAAQAKDQEKMIDIGETLSAACAGCHRKWRDRRTPANRCM* |
Ga0070686_1013215992 | 3300005544 | Switchgrass Rhizosphere | KAAQAKDQDKIVEISETLSTSCSGCHRKFRDRKAPENRCKPS* |
Ga0068866_103046622 | 3300005718 | Miscanthus Rhizosphere | SMKAYKAAQAKDQEKIIELSEALSASCVNCHRKWRDRKTPANHCK* |
Ga0066903_1062744661 | 3300005764 | Tropical Forest Soil | MKAFKAAQAKDQEKMIELSVTVSDACAHCHRKWRDRKTPANRCK* |
Ga0066903_1087913502 | 3300005764 | Tropical Forest Soil | DAGMKAFKAAQEKNQDKMIELSVTVSDACAHCHRKWRDRKTPANRCK* |
Ga0068870_111582251 | 3300005840 | Miscanthus Rhizosphere | KSFTAAQAKDQDKIIELSETLSTACSGCHRKFRDRKTPDNRCKS* |
Ga0068860_1002113623 | 3300005843 | Switchgrass Rhizosphere | MKAYKAAQAKDQEKMIDLSETVSASCAGCHRKWRDRRTPANRCK* |
Ga0068862_1014593332 | 3300005844 | Switchgrass Rhizosphere | FVQEVRDAGMKAYKAAQDKDQEKMIGIGETLSAACAGCHRKWRDRRTPANRCK* |
Ga0097621_1006513421 | 3300006237 | Miscanthus Rhizosphere | QAYRAAQANDQDKMVENSGTLSAACADCHRKWRDRRTPENRCR* |
Ga0097621_1010972072 | 3300006237 | Miscanthus Rhizosphere | QDKIIELSETLSTACSGCHRKFRDRKTPDNRCKS* |
Ga0068871_1005393182 | 3300006358 | Miscanthus Rhizosphere | MFVQEVRDVSMEAYKAAQAKDQDKMIDISETLSKACAGCHRKWRDRRTPDNRCK* |
Ga0074048_134388562 | 3300006581 | Soil | RDVSMKAYKAAQAKDQDKMIDIAETLSRACAGCHRKWRDRRTPDNRCK* |
Ga0075428_1019750092 | 3300006844 | Populus Rhizosphere | QTKSQEKMMETSETLNAACVGCHRKWRDRRTPANRCK* |
Ga0068865_1021241351 | 3300006881 | Miscanthus Rhizosphere | FVQQVRDTSMQAYKAAQAKDQQKMIDVSEPLSASCAGCHRKWRDRRTPANRCKLGT* |
Ga0075426_109522841 | 3300006903 | Populus Rhizosphere | GQAKDQDKLIELSETVSGSCEHCHRKWRNRRAPAIRCK* |
Ga0075424_1010140561 | 3300006904 | Populus Rhizosphere | QQLRDASMASFKAAQAKDQEKMISLADTLNASCVGCHRKWRDRKTPDNRCK* |
Ga0075418_106478692 | 3300009100 | Populus Rhizosphere | EVRDTSMSAYKAAQTKSQDKMIEISETLSTACAGCHRKWRDRRTPDNRCK* |
Ga0075418_112791072 | 3300009100 | Populus Rhizosphere | EVRDASMKAYKAAQAKDQDKMIELSETLSTACAGCHRKWRDRRTSDNRCK* |
Ga0075418_115684381 | 3300009100 | Populus Rhizosphere | DQEKMLDVAETLSATCTGCHRKWRDRRAPDNRCK* |
Ga0105243_106382943 | 3300009148 | Miscanthus Rhizosphere | DQSKMIELSETLNASCEGCHRKWRGRGGPANRCK* |
Ga0105243_124675231 | 3300009148 | Miscanthus Rhizosphere | ARAKDQDKIIENSETLSASCAGCHRKWRDRKTPDNHCK* |
Ga0105242_100309926 | 3300009176 | Miscanthus Rhizosphere | YAAAQAKDQDKMIAIAETLSASCDGCHRKWRNPRPPAARCK* |
Ga0105242_106779312 | 3300009176 | Miscanthus Rhizosphere | QQVRDASMKAYKAAQAKDQDKMIELSETLSAACAGCHRKWRDRKTPANHCK* |
Ga0105248_112554892 | 3300009177 | Switchgrass Rhizosphere | LRDASMQAYRAAQAKDQDKMIENSETLSAACAGCHLKWRDRRTAENRCR* |
Ga0105238_127645112 | 3300009551 | Corn Rhizosphere | DQEKIIELSEALSASCANCHRKWRDRKTPANHCK* |
Ga0126374_105636421 | 3300009792 | Tropical Forest Soil | VRDVGMKSYKAAQAKDQDKIIEISDTLSRACSGCHRKFRDRKTPQNRCK* |
Ga0134124_100700122 | 3300010397 | Terrestrial Soil | SQDKMIEISETLSTACAGCHRKWRDRRTPDNRCK* |
Ga0134122_101889731 | 3300010400 | Terrestrial Soil | MKAYKVAQAKDQEKMIDLSETLSRSCAGCHRKWRDRRTPENRCK* |
Ga0137425_11832242 | 3300011422 | Soil | DQDKMIETAEALDKSCAGCHRKFRDRKAPENRCK* |
Ga0150985_1018058731 | 3300012212 | Avena Fatua Rhizosphere | KDQDKMIENSEMLSEACAACHRKWRDRRTAENRCK* |
Ga0150985_1032413111 | 3300012212 | Avena Fatua Rhizosphere | ASMQAYTAAKAKDQDKMIANSETLTTACAGCHRKWRDRRTPENRCK* |
Ga0150984_1037426193 | 3300012469 | Avena Fatua Rhizosphere | AAQAKDQDEMIAISETLSASCNNCHRRYRRGGANRCK* |
Ga0157284_100269421 | 3300012893 | Soil | KDQDKIIAVSETLSASCAGCHRKWRDRKTKENRCK* |
Ga0157309_101707721 | 3300012895 | Soil | AMFVQEVRDVSLKAYRAAQAKDQDKMIEISETLSTACAGCHRKWRDRKAPDNRCK* |
Ga0157293_100192621 | 3300012898 | Soil | KDQDKMIEISETLSTACAGCHRKWRDRKAPDNRCK* |
Ga0157292_104232981 | 3300012900 | Soil | RDVSMKAYRAAQAKDQDKMIEISETLSAACAGCHRKWRDRKAPDNRCK* |
Ga0157289_102790222 | 3300012903 | Soil | AKDQDKMIEISETLSAACAGCHRKWRDRKAPDNRCK* |
Ga0157308_102868722 | 3300012910 | Soil | SMKAYRAAQAKDQDKMIEISETLSAACAGCHRKWRDRKAPDNRCK* |
Ga0157301_102032392 | 3300012911 | Soil | MFVQEVRDASMKAYKAAQAKDQDKMIELSGTLSTACAGRHRKWRDRRTPDNRCK* |
Ga0157306_103525341 | 3300012912 | Soil | SQEKMMETSETLNAACVGCHRKWRDRRTPANRCK* |
Ga0137413_109126021 | 3300012924 | Vadose Zone Soil | YKAAQAKDQNKMIDNSETLSAACAHCHRKWRDRKTPATRCK* |
Ga0164241_106295862 | 3300012943 | Soil | EVRDVSMKAYRAAQAKDQDKMIEISETLSAACAGCHRKWRDRKAPDNRCK* |
Ga0164302_110751821 | 3300012961 | Soil | TAAQAKDRDKLIDLSQTVSDACAHCHRKWRDRKTPANRCK* |
Ga0164308_100360351 | 3300012985 | Soil | DASLQAYRAAQANDQDKMIENSGTLSAACADCHRKWRDRRTPENRCR* |
Ga0157374_113276021 | 3300013296 | Miscanthus Rhizosphere | YKAAQTKSQDKMIQISETLSTACAGCHRKWRDRRTPDNRCK* |
Ga0157375_109998382 | 3300013308 | Miscanthus Rhizosphere | VQEVRDVSMKAYKAAQAKDQDTMIELSGTLSTACAGCHRKWRDRRTPANRCK* |
Ga0157377_115964842 | 3300014745 | Miscanthus Rhizosphere | DVSIKAYKAAQAKDQDTMIELSGTLSTACAGCHRKWRDRRTPANRCK* |
Ga0132256_1025770252 | 3300015372 | Arabidopsis Rhizosphere | VRDTSMSAYKAAQTKSQDKMIEISETLSTACAGCHRKWRDRRTPDNRCK* |
Ga0132255_1032311562 | 3300015374 | Arabidopsis Rhizosphere | YGAARAKDQGKMIEISETLSAACAGCHRKWRDRKAPDNRCK* |
Ga0182037_119828291 | 3300016404 | Soil | AWATFVQEVRDAGMQAYKAAQAKDQNKIIEISETLSTSCAHCHRKWRDRKQPANRCK |
Ga0163161_117332083 | 3300017792 | Switchgrass Rhizosphere | MKAYRAAQAKDQDKMIENSETLSAACAGCHRKWRDRRTPEKRCQ |
Ga0184611_10719382 | 3300018067 | Groundwater Sediment | FVQEVRDAGMKAYKAAQAKDQEKMIDLSEALSRSCAGCHRKWRDRRTPDNRCK |
Ga0184625_102547402 | 3300018081 | Groundwater Sediment | DVSMKAYRAAQAKDQDKMIEISETLSTACAGCHRKWRDRKAPDNRCK |
Ga0190275_102317851 | 3300018432 | Soil | SYAAAQAKDQDKMIALAETLSVACAGCHRQGRDRRTPDNRCKEGSPPRRGG |
Ga0190271_131730501 | 3300018481 | Soil | TMFVQDVRDASMSAYKAAQAKDQDKMIDLAETLNAACVGCHRKWRDRKTADNRCK |
Ga0066669_104827582 | 3300018482 | Grasslands Soil | ATFVQEVRDASMKAYTAAQAKDQDKLIGLSETVSDACAHCHRKWRDRKTPANRCK |
Ga0173479_100365711 | 3300019362 | Soil | QAKDQDKMIETAETLSAACAGCHRKFRDRKAPENRCKVQ |
Ga0173479_101134691 | 3300019362 | Soil | QAKDQDKMIEISETLSAACAGCHRKWRDRKAPDNRCK |
Ga0210380_104171191 | 3300021082 | Groundwater Sediment | QSKDQDTMIATAEPLSASCAGCHRKFRDRKTPDNRCK |
Ga0210380_104662681 | 3300021082 | Groundwater Sediment | RDASMKSYKAALAKDQDKMIEFSEELNASCANCHRKWRDRRTPDNRCK |
Ga0210334_110787352 | 3300021859 | Estuarine | VREAGMKAYTAARAKDQNKMIETAETLDRSCSGCHRTWRDRRTPDNRCK |
Ga0247672_10176773 | 3300024187 | Soil | QAKDQEKIVDISETLSNSCSHCHRKWRDRRGANRCK |
Ga0207645_105315511 | 3300025907 | Miscanthus Rhizosphere | AAAQAKDQDKMIAIAETLSASCDGCHRKWRNPRPPASRCK |
Ga0207643_104838312 | 3300025908 | Miscanthus Rhizosphere | AAQAKDQDKMIELSGTLSTACAGCHRKWRDRRTPDNRCK |
Ga0207649_104870582 | 3300025920 | Corn Rhizosphere | MQAYKAAQAKDQDKMIEISEPLSAACAGCHRKWRDRRTPANRCK |
Ga0207681_102290001 | 3300025923 | Switchgrass Rhizosphere | AAQTKSQDKMIEISETLSTACAGCHRKWRDRRTPDNRCK |
Ga0207644_108392682 | 3300025931 | Switchgrass Rhizosphere | RAAQAKDQDKMIEISETLSAACAGCHRKWRDRKAPDNRCK |
Ga0207691_109822811 | 3300025940 | Miscanthus Rhizosphere | GMKAYKAAQAKDQEKMIDIGETLSAACAGCHRKWRDRRTPANRCM |
Ga0207668_109884841 | 3300025972 | Switchgrass Rhizosphere | RDASMKAYRAAQAKDQDKMIDISESLSAACAGCHRKWRDRRTPDNRCK |
Ga0207674_118877031 | 3300026116 | Corn Rhizosphere | QAYKAAQAKDQEKMLDVAETLSATCSGCHRKWRDRRAPGNRCK |
Ga0207675_1001110684 | 3300026118 | Switchgrass Rhizosphere | MKAYRAAQAKDQDKMIEISETLSTACAGCHRKWRDRKAPDNRCK |
Ga0207675_1007646562 | 3300026118 | Switchgrass Rhizosphere | AKDQDKMIAIAETLSASCDGCHRKWRNPRPPASRCK |
Ga0207675_1013342871 | 3300026118 | Switchgrass Rhizosphere | KDQDKIIEIAETLSASCDGCHRKWRNPRPPAGRCK |
Ga0207683_100941062 | 3300026121 | Miscanthus Rhizosphere | AYKAAQTKSQDKMIEISETLSTACAGCHRKWRDRRTPDNRCK |
Ga0209971_11053022 | 3300027682 | Arabidopsis Thaliana Rhizosphere | ASMKAYKAAQAKDQDKMIELSETLSTACAGCHRKWRDRRTPDNRCR |
Ga0209465_102295853 | 3300027874 | Tropical Forest Soil | WVAFVQEVRDVGMKSYKAAQAKDQDKIIEISDTLSRACSGCHRKFRDRKTPQNRCK |
Ga0209069_105174602 | 3300027915 | Watersheds | GMMAYKAAQAKDQDKMRDISEPLSAACAGCHRKWRDRRTPANRCK |
Ga0268266_122440142 | 3300028379 | Switchgrass Rhizosphere | DVRNASMSAYKAAQAKDQEKMIAISETLSAACSGCHRKWRDRRMPENRCR |
Ga0268265_122673502 | 3300028380 | Switchgrass Rhizosphere | RDASMKAYRAAQARDQDKMIENSEALTAACAGCHRKWRDRKTPDNRCK |
Ga0247825_100264211 | 3300028812 | Soil | MFVQEVRDASMKAYRAAQARDQDKMIDTAETLSAACAGCHRKWRDRRTPDNRRK |
Ga0222749_104004492 | 3300029636 | Soil | MKAYKAAQAKDQDKMIDLSETLSAACAGCHRKWRDRRTPANRCK |
Ga0307500_102830101 | 3300031198 | Soil | MFVQELGDVSMKAYRAAQAKDQAKMIELSETLSAACAGCHRKWRDRRAPDNRCK |
Ga0307497_104603492 | 3300031226 | Soil | EVRDAGMQAYTAAQAKDRDKLIDLSETVSAACAHCHRKWRDRRTPANRCK |
Ga0310886_106540961 | 3300031562 | Soil | DAGMNAYKAAQTKSQEKMMETSETLNAACVGCHRKWRDRRTPANRCK |
Ga0310907_106564331 | 3300031847 | Soil | VSMKAYRAAQAKDQDKMIEISETPSAACAGCHRKWRDRKAPDNRCK |
Ga0310892_102202001 | 3300031858 | Soil | DASMKAYKAAQAKDQDKMIELSETLSTACAGCHRKWRDRRTPANRCK |
Ga0310893_104390992 | 3300031892 | Soil | KAKDQDKIIEISETLSASCSGCHRKWRDRKTPDNRCK |
Ga0308175_1015476071 | 3300031938 | Soil | KAYAAARAKDQAKMIDVAETLSSACAGCHRKWRDRKSPENRCR |
Ga0308175_1020460143 | 3300031938 | Soil | KDQDKMIANSATLTAACADCHRKWRDRKTPDNRCT |
Ga0308174_111095801 | 3300031939 | Soil | AYTAAQAKDQDKMIELSAMVSDACGHCHRKFRDRRTAANRCKP |
Ga0307416_1029707442 | 3300032002 | Rhizosphere | SQELRDASMKAYTAAQARSIEKVFEASEVLSANCAGCHRQWRDRRKQPRCQ |
Ga0310902_100889332 | 3300032012 | Soil | DTSMKAYAAAQAKDQDKIIAVSETLSASCAGCHRKWRDRKTKENRCK |
Ga0310906_100393911 | 3300032013 | Soil | YRAAQAKDQDKMIEISETLSTACAGCHRKWRDRKAPDNRCK |
Ga0310890_109761292 | 3300032075 | Soil | RAAQAKDQDKMIEISETLSTACAGCHRKWRDRKAPDNRCK |
Ga0310890_115409852 | 3300032075 | Soil | AMFVQELRDVSMKAYGAAQAKDQDKMIDISETLSAACAGCHRKWRDRKAPDNRCK |
Ga0306924_101880141 | 3300032076 | Soil | SMEAYKAAQAKDQDKIVDLSGRLSASCAGCHRKWRDRRTPENRCK |
Ga0315910_109120362 | 3300032144 | Soil | MKSYKAAQAKDQDQMIATAETLSTSCANCHRRWRDRRAPENRCKEPVK |
Ga0335085_125154241 | 3300032770 | Soil | AKDQDKLIEISETLSASCSHCHRKWRDRRTPANRCK |
Ga0335084_118988472 | 3300033004 | Soil | MQAYKAAQAKDQNKIIEISETLSTSCAHCHRKWRDRRQPANRCK |
Ga0247829_110081891 | 3300033550 | Soil | SAYKAAQTKSQDKMIEISETLSTACAGCHRKWRDRRTPDNRCK |
Ga0364927_0172159_486_620 | 3300034148 | Sediment | MKAYRAAQAKDQDRMIEISETLSAACAGCHRKWRDRKTPDNRCK |
Ga0314786_126993_3_128 | 3300034664 | Soil | YSAAKAKDQDKIIEISETLSASCSGCHRKWRDRKTPDNRCK |
Ga0314786_144826_360_524 | 3300034664 | Soil | MFVQEVRDVSMKAYRAAQAKDQDKMIEISETLSTACAGCHRKWRDRKAPDNRCK |
⦗Top⦘ |