| Basic Information | |
|---|---|
| Family ID | F082831 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LQFVKEHELTHRAQLFLYLRMKGIVPATTRRRLAKQAAR |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 90.27 % |
| % of genes from short scaffolds (< 2000 bps) | 93.81 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.230 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (12.389 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.363 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (29.204 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 39.82 |
| PF00578 | AhpC-TSA | 2.65 |
| PF05193 | Peptidase_M16_C | 1.77 |
| PF12002 | MgsA_C | 1.77 |
| PF00675 | Peptidase_M16 | 0.88 |
| PF12837 | Fer4_6 | 0.88 |
| PF01960 | ArgJ | 0.88 |
| PF05163 | DinB | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.88 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.23 % |
| Unclassified | root | N/A | 1.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_105430608 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300002568|C688J35102_119526068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 712 | Open in IMG/M |
| 3300003218|JGI26339J46600_10082285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 810 | Open in IMG/M |
| 3300005334|Ga0068869_101966475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005445|Ga0070708_100266401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1611 | Open in IMG/M |
| 3300005542|Ga0070732_10723345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300005719|Ga0068861_101898184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300006162|Ga0075030_100476327 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300006237|Ga0097621_101747372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300009177|Ga0105248_10554063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300009545|Ga0105237_11454661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300009552|Ga0116138_1120069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 727 | Open in IMG/M |
| 3300009553|Ga0105249_12916325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009632|Ga0116102_1056892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300009634|Ga0116124_1051789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| 3300009634|Ga0116124_1104837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300009641|Ga0116120_1068298 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300009641|Ga0116120_1164570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 711 | Open in IMG/M |
| 3300009672|Ga0116215_1275044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 734 | Open in IMG/M |
| 3300009839|Ga0116223_10773355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300011055|Ga0138550_176107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 827 | Open in IMG/M |
| 3300011063|Ga0138537_1119696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1195 | Open in IMG/M |
| 3300011071|Ga0138595_1072586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 751 | Open in IMG/M |
| 3300011078|Ga0138565_1037696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1060 | Open in IMG/M |
| 3300011081|Ga0138575_1051678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 730 | Open in IMG/M |
| 3300011085|Ga0138581_1098456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1723 | Open in IMG/M |
| 3300011119|Ga0105246_11229210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300011120|Ga0150983_16067466 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012202|Ga0137363_11378098 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012203|Ga0137399_10869833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300012359|Ga0137385_10395673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1179 | Open in IMG/M |
| 3300012469|Ga0150984_111794151 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012955|Ga0164298_11192204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300012986|Ga0164304_10822497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300014152|Ga0181533_1191304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300014156|Ga0181518_10424508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300014165|Ga0181523_10831138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300014167|Ga0181528_10015731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4455 | Open in IMG/M |
| 3300014167|Ga0181528_10808075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300014168|Ga0181534_10769704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300014490|Ga0182010_10427739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300014491|Ga0182014_10404381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300014491|Ga0182014_10493531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300014495|Ga0182015_11015187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300014502|Ga0182021_11606454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300014638|Ga0181536_10195290 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300014655|Ga0181516_10216061 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300014969|Ga0157376_10475611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
| 3300014969|Ga0157376_12238290 | Not Available | 586 | Open in IMG/M |
| 3300015373|Ga0132257_104244294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300016422|Ga0182039_11794207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300016700|Ga0181513_1188898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300016702|Ga0181511_1227389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300017934|Ga0187803_10061142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1482 | Open in IMG/M |
| 3300017935|Ga0187848_10073753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1594 | Open in IMG/M |
| 3300017938|Ga0187854_10300494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300017946|Ga0187879_10435211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 727 | Open in IMG/M |
| 3300017948|Ga0187847_10339923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300017972|Ga0187781_10406469 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300017991|Ga0180434_10907026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300018013|Ga0187873_1286521 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300018022|Ga0187864_10243829 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300018023|Ga0187889_10402407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300018034|Ga0187863_10273693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300018042|Ga0187871_10440497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300018044|Ga0187890_10036388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2973 | Open in IMG/M |
| 3300018044|Ga0187890_10781335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300018057|Ga0187858_10479831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 763 | Open in IMG/M |
| 3300018086|Ga0187769_11149830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300020579|Ga0210407_10021083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4837 | Open in IMG/M |
| 3300020581|Ga0210399_10783468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300021479|Ga0210410_11458570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300023090|Ga0224558_1175416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 666 | Open in IMG/M |
| 3300023101|Ga0224557_1223990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300025412|Ga0208194_1030822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300025434|Ga0208690_1017003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300025448|Ga0208037_1039332 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300025453|Ga0208455_1065305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300025914|Ga0207671_10878063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300025930|Ga0207701_10300765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300027846|Ga0209180_10633737 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027854|Ga0209517_10518449 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300029636|Ga0222749_10718908 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300029889|Ga0246001_1054878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300029945|Ga0311330_11370413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300029951|Ga0311371_11289229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300030000|Ga0311337_12025139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300030490|Ga0302184_10442492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300030520|Ga0311372_12575873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300030730|Ga0307482_1291755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300031232|Ga0302323_102453108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300031249|Ga0265339_10202720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300031250|Ga0265331_10275917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300031716|Ga0310813_11810316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 573 | Open in IMG/M |
| 3300031754|Ga0307475_10047610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3208 | Open in IMG/M |
| 3300031772|Ga0315288_10724501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300031796|Ga0318576_10578691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300031821|Ga0318567_10699873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300031902|Ga0302322_102048275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300031962|Ga0307479_10307059 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300031962|Ga0307479_10590394 | Not Available | 1093 | Open in IMG/M |
| 3300032001|Ga0306922_10478377 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300032046|Ga0315289_10375088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300032180|Ga0307471_103459532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300032516|Ga0315273_11574204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300032782|Ga0335082_10159000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2180 | Open in IMG/M |
| 3300032805|Ga0335078_11655715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300032828|Ga0335080_10155292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2533 | Open in IMG/M |
| 3300032828|Ga0335080_11561229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300032829|Ga0335070_11708855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300032892|Ga0335081_12232365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300032896|Ga0335075_10333683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1665 | Open in IMG/M |
| 3300034282|Ga0370492_0027445 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 12.39% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 8.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.54% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.77% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.77% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.89% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300011055 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1054306082 | 3300001213 | Wetland | RLEMVQTVKEHELTHRAQLFMYLRLNGIVPSTTRRRLAGRAAK* |
| C688J35102_1195260681 | 3300002568 | Soil | TRLEMVQTIKEHELTHRSQLFMYLRLKGITPVTTRRRMAKQAGK* |
| JGI26339J46600_100822851 | 3300003218 | Bog Forest Soil | VTRLEMLQMLKEHELTHRAHLFLYMRMKGLVPATTRRRMAKQAGR* |
| Ga0068869_1019664751 | 3300005334 | Miscanthus Rhizosphere | GEKVTRLEMLQAIKEHELSHRAVLFLCLRMKGMVPATTRRRIAKQAAE* |
| Ga0070708_1002664015 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVQFTKEHELTHRAQLFLYSRLKGIVPVTTRRRLAKQQKADAAV* |
| Ga0070732_107233453 | 3300005542 | Surface Soil | VTRLEMLQLLKEHELTHRSTLFMYLRLKGIVPATTRRRQAKANA* |
| Ga0068861_1018981841 | 3300005719 | Switchgrass Rhizosphere | IKEHELTHRSQLFLYLRMKGIVPATTRRRMAKQASQ* |
| Ga0075030_1004763271 | 3300006162 | Watersheds | MLQGIKEHELSHRSQLFVYLRLKGLTPPTTRRRLAKAKA* |
| Ga0097621_1017473723 | 3300006237 | Miscanthus Rhizosphere | VKEHELTHRSQLFMYLRLKGIVPATTRRRLARQAQK* |
| Ga0105248_105540631 | 3300009177 | Switchgrass Rhizosphere | FVKEHELTHRAQLFLCLRIKGLVPATTRRRQAKQAAK* |
| Ga0105237_114546612 | 3300009545 | Corn Rhizosphere | MIQFLKEHELTHRQQLFMYLRLKGMVPATTRRRLARQAAK* |
| Ga0116138_11200693 | 3300009552 | Peatland | MVTRLEMLLWVAEHELTHRQQLFTYLRMKGIVPATTRRRLARLAAAE* |
| Ga0105249_129163252 | 3300009553 | Switchgrass Rhizosphere | RLEMVQTIKEHELTHRSQLFMYLRLKGIVPATTRRRMAKQTGK* |
| Ga0116102_10568924 | 3300009632 | Peatland | DGQKVTRLEMVQTIKEHELTHRQQLFMYQRLKGMVPATTRRRLAKQAGK* |
| Ga0116124_10517891 | 3300009634 | Peatland | QQVTRLEMIQLVKEHELTHRQQLFLFLRMKGVVPVTTRRRQAKK* |
| Ga0116124_11048371 | 3300009634 | Peatland | MLQTIKEHELTHRAHLFLCLRMKGIVPATTRRRLAAQAGR* |
| Ga0116120_10682981 | 3300009641 | Peatland | KEHELTHRQQLFTYLRVKGIVPVTTRRRLARQAAGR* |
| Ga0116120_11645701 | 3300009641 | Peatland | LQFVKEHELTHRAQLFLYLRMKGIVPATTRRRLAKQAAR* |
| Ga0116215_12750441 | 3300009672 | Peatlands Soil | VMVTRLEMLQWVKEHELTHRQQLFTCLRMKGVVPATTRRRLARLAASK* |
| Ga0116223_107733551 | 3300009839 | Peatlands Soil | IKEHELTHRAHMFLCLRMKGIVPATTRRRLAQQAGK* |
| Ga0138550_1761071 | 3300011055 | Peatlands Soil | QMAKEHELTHRAQLFLYLRMKGIVPATTRRRLAKQQTA* |
| Ga0138537_11196961 | 3300011063 | Peatlands Soil | MAKEHELTHRAQLFLYLRMKGIVPATTRRRLAKQQTA* |
| Ga0138595_10725863 | 3300011071 | Peatlands Soil | LEMLQMVKEHELTHRATMFLCLRMKGIVPATTRRRMAKQAAR* |
| Ga0138565_10376964 | 3300011078 | Peatlands Soil | AKEHELTHRAQLFLYLRMKGIVPATTRRRLAKQQTA* |
| Ga0138575_10516781 | 3300011081 | Peatlands Soil | MLQMVKEHELTHRSTMFLCLRMKGIVPATTRRRMAKQAAR* |
| Ga0138581_10984561 | 3300011085 | Peatlands Soil | EHELTHRAQLFLYLRMKGIVPATTRRRLAKQQTA* |
| Ga0105246_112292103 | 3300011119 | Miscanthus Rhizosphere | TIKEHELTHRSQLFMYLRLKGIIPATTRRRMAKQAGK* |
| Ga0150983_160674664 | 3300011120 | Forest Soil | MARKEMIPFMKEYELADRAQMFMYLRLKHIVPATTRRRLAKQQKT* |
| Ga0137363_113780981 | 3300012202 | Vadose Zone Soil | IKEHELTHRQQLFMYLRLKGIIPPTTRRRMAKAKT* |
| Ga0137399_108698331 | 3300012203 | Vadose Zone Soil | RLEMLQFIKEHELTHRSQMFLCLRLKGIVPATTRRRQAAQKSA* |
| Ga0137385_103956734 | 3300012359 | Vadose Zone Soil | QFIKEHELTHRSQMFVYLRLKGIVPATTRRRQAAQKSA* |
| Ga0150984_1117941514 | 3300012469 | Avena Fatua Rhizosphere | LQFIKEHELTHRSQMFVYLRLKGIVPGTTRRRLAAQKSA* |
| Ga0164298_111922042 | 3300012955 | Soil | DGQQVTRLEMVQTIKEHELTHRSQLLMYLRIKGIIPATTRRRMAKQAGK* |
| Ga0164304_108224971 | 3300012986 | Soil | LEMVQTIKEHELTHRSQLFMYLRLKGIVPATTRRRMAKQAGK* |
| Ga0181533_11913043 | 3300014152 | Bog | QTIKEHELTHRQQLFLYLRLKGLVPATTRRRLAKQAGK* |
| Ga0181518_104245083 | 3300014156 | Bog | FVKEHELTHRAQLFLYMRMKGMVPATTRRRLAKQAAR* |
| Ga0181523_108311381 | 3300014165 | Bog | RLEMLQTIKEHELTHRAHLFLCLRMKGIVPATTKRRLAAQAGR* |
| Ga0181528_100157311 | 3300014167 | Bog | KEHELTHRAHMFLCLRLKGIVPATTRRRLAKQAGR* |
| Ga0181528_108080752 | 3300014167 | Bog | VTRLEMLQTIKEHELTHRAHLFLCLRMKGLVPATTRRRLAAQAGK* |
| Ga0181534_107697043 | 3300014168 | Bog | EMLQTIKEHELTHRAHLFLCLRMKGIVPATTRRRMAQQAGR* |
| Ga0182010_104277391 | 3300014490 | Fen | KEHELTHRAQLFMYLRLKGLVPATTRRRLAKQAGK* |
| Ga0182014_104043811 | 3300014491 | Bog | KEHELTHRAQLFLYMRMKGIVPATTRRRLAKQAAR* |
| Ga0182014_104935311 | 3300014491 | Bog | QTIKEHELTHRAQLFLYLRLKGLVPATTRRRLAKQAGK* |
| Ga0182015_110151873 | 3300014495 | Palsa | LQFVKEHELTHRAQLFLYMRMKGIVPATTRRRLAKQAAR* |
| Ga0182021_116064543 | 3300014502 | Fen | EHELTHRSQLFMYLRLKGIVPATTRRRLAKQAGR* |
| Ga0181536_101952904 | 3300014638 | Bog | VMVTRLEMLLWIGDHELTHRQQLFTYLRMKGMMPATTRRRLARQAGK* |
| Ga0181516_102160611 | 3300014655 | Bog | EMLHTMKEQEMAHRADLFPCLRMKGIVPAPTRRRLAKEAGK* |
| Ga0157376_104756111 | 3300014969 | Miscanthus Rhizosphere | MTRHFDLAQLTRMEMIQFLKEHELTHRQQLFMYLRLKGMVPATTRRRLARQAAK* |
| Ga0157376_122382901 | 3300014969 | Miscanthus Rhizosphere | LQFLKEHELTHRSQLFMLMRIKGMVPPTTKRRLAATKA* |
| Ga0132257_1042442941 | 3300015373 | Arabidopsis Rhizosphere | LEMVQTIKEHELTHRSQLFMYLRLKGIIPATTRRRVAKPAAK* |
| Ga0182039_117942073 | 3300016422 | Soil | RLETLQFTKEHELTHRSQMFLYLRMKNIVPATTRRRTAKQQKA |
| Ga0181513_11888984 | 3300016700 | Peatland | TRLEMLLWIGDHELTHRQQLFTYLRMKGIVPATTRRRLARQAAAQ |
| Ga0181511_12273891 | 3300016702 | Peatland | GQKVTRLEMVQTIKEHELTHRQQLFMYQRLKGMVPATTRRRLAKQAGK |
| Ga0187803_100611421 | 3300017934 | Freshwater Sediment | VTRLEMLQMVKEHELTHRATMFLCLRMKGIVPATTRRRMAKQAAR |
| Ga0187848_100737534 | 3300017935 | Peatland | IKEHELTHRAQLFMYLRLKGLVPATTRRRLAKQAGK |
| Ga0187854_103004941 | 3300017938 | Peatland | GQKVTRLEMVETIKEHELTHRAQLFLYLRLKGLVPATTRRRLAKQAGK |
| Ga0187879_104352111 | 3300017946 | Peatland | IKEHEMTHRAHLFLCLRMKGIVPATTRRRLAKQAGK |
| Ga0187847_103399231 | 3300017948 | Peatland | KEHELTHRAHMFLCLRLKGIVPATTRRRLAKQAGR |
| Ga0187781_104064691 | 3300017972 | Tropical Peatland | QFVKEHELTHRAQLFLYLRMKGLVPATTRRRLAKQAAR |
| Ga0180434_109070261 | 3300017991 | Hypersaline Lake Sediment | QFIKEHELTHRMQLFLYLRMNGVVQPTTQRKMAKR |
| Ga0187873_12865213 | 3300018013 | Peatland | WIGDHELTHRQQLFTYLRMKGIVPATTRRRLARQAAAQ |
| Ga0187864_102438291 | 3300018022 | Peatland | TIKEHELTHRAQLFLYLRLKGLVPATTRRRLAKQAGK |
| Ga0187889_104024071 | 3300018023 | Peatland | MLQFVKEHELTHRQQLFTYLRMKGMMPATTRRRLARQAGK |
| Ga0187863_102736931 | 3300018034 | Peatland | KEHELAHRQQLFTYMRMKGIVPATTRRRQARLAASK |
| Ga0187871_104404971 | 3300018042 | Peatland | RVTRLEMLQTIKEHELTHRAHMFLCLRLKGIVPATTRRRLAKQAGR |
| Ga0187890_100363885 | 3300018044 | Peatland | RLEMLLWIGDHELTHRQQLFTYLRMKGIVPATTRRRLARQAAAK |
| Ga0187890_107813353 | 3300018044 | Peatland | WIGDHELTHRQQLFTYLRMKGIVPATTRRRLARQAASK |
| Ga0187858_104798313 | 3300018057 | Peatland | GQKVTRLEMLQTVKEHELTHRAHLFLCLRIKGIVPATTRRRLAQQAGR |
| Ga0187769_111498301 | 3300018086 | Tropical Peatland | FVKEHELTHRAQLFLYMRMKGIVPVTTRRRLAKQAAR |
| Ga0210407_100210832 | 3300020579 | Soil | MIPFMKEYELADRAQMFMYLRLKHIVPATTRRRLAKQQKT |
| Ga0210399_107834683 | 3300020581 | Soil | MARKEMIPLMKEYELADRAQMFMYLRLKHIVPATTCRRLAKQQKT |
| Ga0210410_114585701 | 3300021479 | Soil | MARKEMIPFMKEYELADRAQMFMYLRLKHIVPATTCRRLAKQQKT |
| Ga0224558_11754161 | 3300023090 | Soil | KEHELTHRAHMFLCLRMKGIVPATTRRRLAQQAGK |
| Ga0224557_12239903 | 3300023101 | Soil | DGQRVTRLEMLQMVKEHELTHRAHLFLCLRMKGIVPATTRRRLAQQAGK |
| Ga0208194_10308223 | 3300025412 | Peatland | LQFVKEHELTHRAQLFLYLRMKGIVPATTRRRLAMQAAR |
| Ga0208690_10170031 | 3300025434 | Peatland | LIKEHELTHRQQLFMYLRLNGVVPPTTRRRQAKAKA |
| Ga0208037_10393321 | 3300025448 | Peatland | MVQTIKEHELTHRAQLFLYLRLKGLVPATTRRRLAKQAGK |
| Ga0208455_10653051 | 3300025453 | Peatland | VTRLEMVQTIKEHELTHRQQLFMYQRLKGMVPATTRRRLAKQAGK |
| Ga0207671_108780632 | 3300025914 | Corn Rhizosphere | MIQFLKEHELTHRQQLFMYLRLKGMVPATTRRRLARQAAK |
| Ga0207701_103007654 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLRQLEILQAIKESELTHRLQLFPYLRFKGIVPATTRRWLAKQASK |
| Ga0209180_106337373 | 3300027846 | Vadose Zone Soil | FVKEHELTHRSQMFVYLRLKGIVPATTKRRQAAQKRA |
| Ga0209517_105184493 | 3300027854 | Peatlands Soil | LEMLQWVKEHELTHRQQLFTYLRMKGVVPATTRRRLARQAANK |
| Ga0222749_107189081 | 3300029636 | Soil | LQFIKEHELTHRSQMFMYLRLKGIVPATTRRRQAKQKGA |
| Ga0246001_10548781 | 3300029889 | Peat | QWVKEHELTHRQQLFTYLRVKGIVPVTTRRRLARQAAGR |
| Ga0311330_113704131 | 3300029945 | Bog | DMIKEHEMTHRAHMFLCLRMKGIVPATTRRRQAQQAAR |
| Ga0311371_112892291 | 3300029951 | Palsa | EHELTHRAQLFLYMRMKGIVPATTRRRLAMAASAQAAR |
| Ga0311337_120251391 | 3300030000 | Fen | LEMVQTIKEHELTHRAQLFMYLRLKGMVPATTRRRLAKQAGK |
| Ga0302184_104424921 | 3300030490 | Palsa | LEMLQFVKEHELTHRSQLFLYSRMNGIVPATTRRRLAKQAAR |
| Ga0311372_125758733 | 3300030520 | Palsa | HELTHRAQLFLYMRMKGIVPATTRRRLAMAASAQAAR |
| Ga0307482_12917553 | 3300030730 | Hardwood Forest Soil | LQFVKEHELTHRAQLFVSMRIKGIVPATTRRRLAKQAGK |
| Ga0302323_1024531081 | 3300031232 | Fen | EMVETIKEHELTHRAQLFMYLRLKGLVPATTRRRLAKQAGK |
| Ga0265339_102027201 | 3300031249 | Rhizosphere | LQMIKEHEMTHRAHLFLCLRMKGIVPATTRRRMAQQAGR |
| Ga0265331_102759171 | 3300031250 | Rhizosphere | LEMLQTIKEHELTHRQQMFVYLRLKGIVPATTRRRQAAK |
| Ga0310813_118103163 | 3300031716 | Soil | GIKEHELTHRSQLFMYLRMKGVVPATTRRRIAKAKA |
| Ga0307475_100476106 | 3300031754 | Hardwood Forest Soil | MARKEMIQFMKEYELADRAQMFMYLRLKHIVPATTCRRLAKQQKT |
| Ga0315288_107245012 | 3300031772 | Sediment | MIQFIKEHELEHRALLFLCLRLKGMVPVTTRRRQARR |
| Ga0318576_105786913 | 3300031796 | Soil | LEMVQSIKEHEMVHRAQLFFCLRLKGIVPATTRRRMAQQAAK |
| Ga0318567_106998733 | 3300031821 | Soil | MAQSIKEHEMVHRAQLFFCLRLKGIVPATTRRRMAQQAAK |
| Ga0302322_1020482753 | 3300031902 | Fen | FDGQRVTRLEMVQTIKEHELTHRSQLFMYLRLKGIVPATTRRRQAKQAGK |
| Ga0307479_103070594 | 3300031962 | Hardwood Forest Soil | MIPFMKEYELADRAQMFMYLRLKHIVPATTRRHLAKQQKT |
| Ga0307479_105903943 | 3300031962 | Hardwood Forest Soil | MVQFTKEHELTHRSHLFLYSRLKGIVPLTTCRLAKQQKA |
| Ga0306922_104783774 | 3300032001 | Soil | IKEHELTHRAQMFMCMRLKGMVPATTRRRLARQAAQ |
| Ga0315289_103750884 | 3300032046 | Sediment | QPVTRLEMIQFVKEHELGHRALLFLYLRLKGIVPVTTRRRQAKK |
| Ga0307471_1034595323 | 3300032180 | Hardwood Forest Soil | TRLEMVQFTKEHELTHRAQLFLYSRLKGIVPVTTRRRLAKQQKV |
| Ga0315273_115742041 | 3300032516 | Sediment | LQFVKEHELIHRQQLFMYLRLKGIVPATTRRKLAAAKR |
| Ga0335082_101590001 | 3300032782 | Soil | KEHEMTHRSQMFLYLRMKGVVPSTTRQRQAKPAAK |
| Ga0335078_116557151 | 3300032805 | Soil | RVTRLEMLQMVKEHELTHRSTMFLYLRMKGIVPATTRRRMAKQAAK |
| Ga0335080_101552925 | 3300032828 | Soil | QFVKEHELTHRAQLFLYLRMKGIAPATTRRRLAKQAASKA |
| Ga0335080_115612291 | 3300032828 | Soil | LEMLQFVKEHELTHRSQLFLYMRMKGIVPATTRRRLAKSATP |
| Ga0335070_117088553 | 3300032829 | Soil | LELVQFVKEHELTHRQQLFLYLRLKGIVPATTRRRMAKPAAR |
| Ga0335081_122323653 | 3300032892 | Soil | SRLELLQALKEHELTHRQQLFVYLRLKGIVPATTRRRIAKANA |
| Ga0335075_103336831 | 3300032896 | Soil | VKEHELTHRSQMFLYLRLKGLVPAPTRRRQSKAKA |
| Ga0370492_0027445_1_126 | 3300034282 | Untreated Peat Soil | ELLQMIKEHELTHRALLFLCLRLKGIVPSTTRRRLAKQAGK |
| ⦗Top⦘ |