| Basic Information | |
|---|---|
| Family ID | F082786 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 46 residues |
| Representative Sequence | KERKNNTSGQPEQKQERNYSQGENQPVLASLPNDPPVVTVTTYRRFS |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 82.30 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.575 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.929 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.319 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.442 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00643 | zf-B_box | 67.26 |
| PF05154 | TM2 | 7.08 |
| PF13349 | DUF4097 | 5.31 |
| PF00132 | Hexapep | 1.77 |
| PF16363 | GDP_Man_Dehyd | 0.88 |
| PF06224 | HTH_42 | 0.88 |
| PF12860 | PAS_7 | 0.88 |
| PF14312 | FG-GAP_2 | 0.88 |
| PF13345 | Obsolete Pfam Family | 0.88 |
| PF02224 | Cytidylate_kin | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 7.08 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.88 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.58 % |
| Unclassified | root | N/A | 4.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10516845 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100108409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2606 | Open in IMG/M |
| 3300002568|C688J35102_119252826 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10060442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1459 | Open in IMG/M |
| 3300004633|Ga0066395_10933107 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300004633|Ga0066395_10966729 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005093|Ga0062594_100327764 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300005181|Ga0066678_10028495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3015 | Open in IMG/M |
| 3300005293|Ga0065715_10554816 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005437|Ga0070710_10913068 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005536|Ga0070697_101256275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300005538|Ga0070731_10909334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 583 | Open in IMG/M |
| 3300005542|Ga0070732_10315565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300005542|Ga0070732_10558577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300005554|Ga0066661_10304672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300005557|Ga0066704_10016208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4286 | Open in IMG/M |
| 3300005559|Ga0066700_10424532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 936 | Open in IMG/M |
| 3300005575|Ga0066702_10501278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300005921|Ga0070766_10450998 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005995|Ga0066790_10138518 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300006354|Ga0075021_10107748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1659 | Open in IMG/M |
| 3300006796|Ga0066665_10990615 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300006854|Ga0075425_100395040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1593 | Open in IMG/M |
| 3300006904|Ga0075424_101227878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300006954|Ga0079219_10262217 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300007076|Ga0075435_100006258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8401 | Open in IMG/M |
| 3300007076|Ga0075435_100072584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2812 | Open in IMG/M |
| 3300007076|Ga0075435_100999555 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300009088|Ga0099830_10123699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1961 | Open in IMG/M |
| 3300009089|Ga0099828_10113651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2358 | Open in IMG/M |
| 3300009093|Ga0105240_10262108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1993 | Open in IMG/M |
| 3300009174|Ga0105241_10068290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2754 | Open in IMG/M |
| 3300009551|Ga0105238_11384733 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300009870|Ga0131092_11451358 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010048|Ga0126373_12904538 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010329|Ga0134111_10550380 | Not Available | 512 | Open in IMG/M |
| 3300010336|Ga0134071_10108739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1323 | Open in IMG/M |
| 3300010375|Ga0105239_12472968 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300010401|Ga0134121_12725473 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300011119|Ga0105246_10025007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 3889 | Open in IMG/M |
| 3300011120|Ga0150983_10878738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300011269|Ga0137392_11046319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300011271|Ga0137393_10062670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2941 | Open in IMG/M |
| 3300012206|Ga0137380_10024906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5509 | Open in IMG/M |
| 3300012207|Ga0137381_10756455 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012350|Ga0137372_10685144 | Not Available | 744 | Open in IMG/M |
| 3300012362|Ga0137361_11947096 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012924|Ga0137413_10317827 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300012929|Ga0137404_10818305 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012930|Ga0137407_10222734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1701 | Open in IMG/M |
| 3300012930|Ga0137407_10712628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300012960|Ga0164301_11851889 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012987|Ga0164307_11603049 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300013297|Ga0157378_10811450 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300013307|Ga0157372_12889328 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300015245|Ga0137409_10693241 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300015264|Ga0137403_10573147 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300015371|Ga0132258_10117011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6324 | Open in IMG/M |
| 3300017822|Ga0187802_10254247 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300017927|Ga0187824_10216300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300017934|Ga0187803_10465548 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300018433|Ga0066667_10391844 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300019275|Ga0187798_1158683 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300020579|Ga0210407_10885413 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300020580|Ga0210403_11358441 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300020581|Ga0210399_10105647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2306 | Open in IMG/M |
| 3300020581|Ga0210399_10946001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300021088|Ga0210404_10016092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3144 | Open in IMG/M |
| 3300021088|Ga0210404_10228993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300021168|Ga0210406_10330289 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300021168|Ga0210406_10709510 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300021171|Ga0210405_10109562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2180 | Open in IMG/M |
| 3300021171|Ga0210405_10826691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300021181|Ga0210388_11494140 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300021344|Ga0193719_10025284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2548 | Open in IMG/M |
| 3300021478|Ga0210402_11666648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300021559|Ga0210409_10536462 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300022504|Ga0242642_1097049 | Not Available | 512 | Open in IMG/M |
| 3300024288|Ga0179589_10081747 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300025898|Ga0207692_10348051 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300025898|Ga0207692_10411966 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300025914|Ga0207671_10479842 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300025929|Ga0207664_10330110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1347 | Open in IMG/M |
| 3300025941|Ga0207711_11924964 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300025942|Ga0207689_11719722 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026214|Ga0209838_1022582 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300026316|Ga0209155_1012253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3720 | Open in IMG/M |
| 3300026320|Ga0209131_1231374 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300026331|Ga0209267_1124043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300026538|Ga0209056_10599654 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300027576|Ga0209003_1119652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300027842|Ga0209580_10158718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300027854|Ga0209517_10223011 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300027862|Ga0209701_10024924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3889 | Open in IMG/M |
| 3300027869|Ga0209579_10684329 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027889|Ga0209380_10456190 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027903|Ga0209488_10717709 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027905|Ga0209415_10667933 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300028828|Ga0307312_10458249 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031057|Ga0170834_105269987 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10066522 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300031421|Ga0308194_10198595 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031740|Ga0307468_100973766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300031753|Ga0307477_10552986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300031947|Ga0310909_11315782 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031954|Ga0306926_11147160 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300032076|Ga0306924_12581532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300032205|Ga0307472_102569260 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300032828|Ga0335080_10160938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2483 | Open in IMG/M |
| 3300032828|Ga0335080_11706900 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300033433|Ga0326726_10348943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1396 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105168451 | 3300001593 | Forest Soil | KEKKDNNTSGQPEPRQERNYSQGENQPVLASIPNVPPVGTVTTYRRIS* |
| JGIcombinedJ26739_1001084093 | 3300002245 | Forest Soil | KDNNTSGQPEPRQERNYSQGENQPVLASIPNVPPVGTVTTYRRIS* |
| C688J35102_1192528261 | 3300002568 | Soil | GPEPENRERKNNTSGQPEQKQERNYSQGENQLVLASIDPPVVTVNTDRRFV* |
| JGIcombinedJ51221_100604421 | 3300003505 | Forest Soil | EREKNRKNDTSGQPEPRQERNYSRDENQPVLASLPDRTPAVSVTTTRRFV* |
| Ga0066395_109331071 | 3300004633 | Tropical Forest Soil | EKDNKNKNNTSGQPEQRQERNYSRDENQPVLAYTPDDPTVVTVTTNGRFV* |
| Ga0066395_109667292 | 3300004633 | Tropical Forest Soil | PAPTQERHRKDNNTSQQPEQRQERNYSRGDNQPVLASAPDAPPVVIASATRRFV* |
| Ga0062594_1003277642 | 3300005093 | Soil | QPEQKKDRKNDTSGQPDQKQERNYSQGENQPILASTPALPPVVTETTNRRFV* |
| Ga0066678_100284955 | 3300005181 | Soil | KNHKNDTSGQPEQRQERNYSQEQNQPILASSTNDPTVVTVTTNRRFV* |
| Ga0065715_105548162 | 3300005293 | Miscanthus Rhizosphere | EQKKDRKNDTSGQPDQKQERNYSQGENQPILASTPALPPVVTETTNRRFV* |
| Ga0070710_109130682 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EKEKKDNNTSGQPEPRQERNYSQGENQPVLASIPNDPPVETVTTYRRIS* |
| Ga0070697_1012562751 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EKDNKNHKNDTSGQPEQRQERNYSQEQNQPILASSINDPTVVTVTTNRRFA* |
| Ga0070731_109093341 | 3300005538 | Surface Soil | SEKDNKNKNNTSGQPEQRQERNYSRDENQPVLAYTPDNPTVVTVTTNGRLV* |
| Ga0070732_103155651 | 3300005542 | Surface Soil | EKRKEQNYSRGENQPVLAFAPQDPTVVTGTRYRRLV* |
| Ga0070732_105585772 | 3300005542 | Surface Soil | QEKERERNHKNNTSGDPEPRQERNYSRDENQPVLASGPQNPLAVSVTTTRRDV* |
| Ga0066661_103046721 | 3300005554 | Soil | EQRERDKEHKNNTSGQPEPRQERNYSRDENQPVLASAPENPPAVSVSTTRRYV* |
| Ga0066704_100162081 | 3300005557 | Soil | HRKDNNNTSGQPEPRQERNYSQGENQPVLASTPDVPPIAAVTATRRFV* |
| Ga0066700_104245321 | 3300005559 | Soil | SGQPEQRQERNYSREENQPVLASSVDDPTVLTVTTYRRFV* |
| Ga0066702_105012782 | 3300005575 | Soil | PAPRREKEKNHKNDTSGQPEQRQERNYSREENQPVLASSEDDPTVVTVTTCRRFV* |
| Ga0070766_104509981 | 3300005921 | Soil | KKDNNTSGQPEPRQERNYSQGENQPVLASIPNVPPVGTVTTYRRIS* |
| Ga0066790_101385181 | 3300005995 | Soil | DNNTSGQPEPRQERNYSQGENQPVLAAAPNVPPVVIETTYRRLV* |
| Ga0075021_101077483 | 3300006354 | Watersheds | DKNHKNNTSGDPEPRQERNYSRDENQPVLASAPEDPPAVSVTTNRRFV* |
| Ga0066665_109906151 | 3300006796 | Soil | PQKDQHRKDNNNTSGQPEPRQERNYSQGENQPVLASTPDVPPIAAVTATRRFV* |
| Ga0075425_1003950401 | 3300006854 | Populus Rhizosphere | KERKNNTSGQPEQKQERNYSQGENQPVLASRPNDPPVVMVTTYRRFS* |
| Ga0075424_1012278782 | 3300006904 | Populus Rhizosphere | KNDTSEQPEQKQERNYSQGENQPVLASRPIDPPVVSVTTNRRFV* |
| Ga0079219_102622171 | 3300006954 | Agricultural Soil | PEPAPPEKEREHKNNTSGDPEPRQERNYSRDENQPVLALAPDAPPAVSVTTIRRFV* |
| Ga0075435_1000062589 | 3300007076 | Populus Rhizosphere | SEPQNKEHKNNTSGQPEQRQERNYSLGPDQPMLAGLPNDPPVVMLTTYRRIA* |
| Ga0075435_1000725841 | 3300007076 | Populus Rhizosphere | TSGQPEPTQERNYSQGENQPVLASLPNDPPVVRMTTYRRLS* |
| Ga0075435_1009995552 | 3300007076 | Populus Rhizosphere | ENNNTSGQPEQRQERNYSQGENTPVLAFTPDAPPVVTLTAIRRFV* |
| Ga0099830_101236991 | 3300009088 | Vadose Zone Soil | KEKERKNNTSGQPEQKQERNYSQGENQPVLASAPDDPPVVTVTTYRRFS* |
| Ga0099828_101136514 | 3300009089 | Vadose Zone Soil | NDTSGQPEQRQERNYSREENQPVLASSKDDPTVVTVTTYRRFV* |
| Ga0105240_102621081 | 3300009093 | Corn Rhizosphere | KKDNNTSGQPEPRQERNYSQGENQPVLASLPNDPPVVTVNAYRRLS* |
| Ga0105241_100682901 | 3300009174 | Corn Rhizosphere | KEKEKEKKDNNTSGQPEPRQERNYSQGENQPVLASIPNDPPVETVTTYRRIS* |
| Ga0105238_113847332 | 3300009551 | Corn Rhizosphere | RKNNTSGQPEQRQERNYSRDEHQPVLASLPESTPEVTVTTIRRYV* |
| Ga0131092_114513581 | 3300009870 | Activated Sludge | DPEPKQERNYSRDENQPVLALVPDAPPAVSVTTIRRFV* |
| Ga0126373_129045381 | 3300010048 | Tropical Forest Soil | EQRQERNYSRGDNQPVLASAPDAPPVVIASATRRFV* |
| Ga0134111_105503801 | 3300010329 | Grasslands Soil | KNNTSGQPEQKQERNYSQEGNQPVFASLPDESPVVSVTTYRRFV* |
| Ga0134071_101087391 | 3300010336 | Grasslands Soil | RKNNTSGQPEQKQERNYSQWENHPVLAAVPDQPPVVSVTTTYRRNS* |
| Ga0105239_124729681 | 3300010375 | Corn Rhizosphere | KQERNYSQGENAPILASTPELPPVVTVTTYRRDV* |
| Ga0134121_127254731 | 3300010401 | Terrestrial Soil | SGQPEQKQERNYSQGENQPVLASLPNDPPVVTVTTYRRFS* |
| Ga0105246_100250075 | 3300011119 | Miscanthus Rhizosphere | SGQPEPTQERNYSQGENQPVLASLPNDPPVVRMTTYRRLS* |
| Ga0150983_108787381 | 3300011120 | Forest Soil | NHKNNTSGEPEPRQERNYSRDENQPVLACTPEQAPAVSVTTIRRLV* |
| Ga0137392_110463191 | 3300011269 | Vadose Zone Soil | EPAPREKDNKNHKNDTSGQPEQRQERNYSQEQNQPILASSINDPTVVTVTTNRRFV* |
| Ga0137393_100626704 | 3300011271 | Vadose Zone Soil | SGQPEQRQERNYSQEQNQPILASSTNDPTVVTVTTNRRFA* |
| Ga0137380_100249061 | 3300012206 | Vadose Zone Soil | EKNHKNDTSGQPEQRQERNYSREENQPVLASSKDDPTVVTVTTYRRFV* |
| Ga0137381_107564551 | 3300012207 | Vadose Zone Soil | GKEKEKEHKNNTSGQPEQKQERNYSQGETQPVLASTRDDPPVVTVTTYRRVS* |
| Ga0137372_106851441 | 3300012350 | Vadose Zone Soil | TKDNTSGQPEQKQQRNYSQEGNQPVFASLPNDPPVVNGATYRRFV* |
| Ga0137361_119470961 | 3300012362 | Vadose Zone Soil | PEPRQERNYSQEGNQPVVASLPNDPPVVSVTTYRRLS* |
| Ga0137390_100194071 | 3300012363 | Vadose Zone Soil | KDKTKNNTSGQPEQKQERNYSQEGNQPVFASLPHDQPVVTGATYRRFV* |
| Ga0137413_103178271 | 3300012924 | Vadose Zone Soil | PDQKQERNYSREENQPVLAGLPDQPPAVTVTTNRRFV* |
| Ga0137404_108183052 | 3300012929 | Vadose Zone Soil | DQKQERNYSQGENQPVLASTPELPPVVTVTTYRRFV* |
| Ga0137407_102227341 | 3300012930 | Vadose Zone Soil | PEKQERNYSQGENQPVLASLPNDPPVGTVTTYRRLS* |
| Ga0137407_107126281 | 3300012930 | Vadose Zone Soil | KDNTSGQPEPRQERNYSRDENQPVLASAPEDPPAVSVTTIRRFV* |
| Ga0164301_118518892 | 3300012960 | Soil | DKERKNNTSGQPEQKQERNYSQGENQPVLASLPNDPPVVTVTTYRRFS* |
| Ga0164307_116030491 | 3300012987 | Soil | PRQERNYSQGENQPVLASLPNVPPVGTATTYRRLS* |
| Ga0157378_108114502 | 3300013297 | Miscanthus Rhizosphere | EQNKEKKDNNTSGQPEPRQERNYSQGENQPVLASLPNDPPVGTVTTYRRLS* |
| Ga0157372_128893282 | 3300013307 | Corn Rhizosphere | KEQKQEKKDNNTSGQPEPRQERNYSQGENQPVLASLPNDPPVVTVTAYRRLS* |
| Ga0137409_106932411 | 3300015245 | Vadose Zone Soil | QNKEQKNNNTSGEPEQKQERNYSQGENQPVLASLPNNPPVGTATTYRRLS* |
| Ga0137403_105731472 | 3300015264 | Vadose Zone Soil | DNNTSERPEPREERNYSQGENQPVLARLPNDPPVVTTTYRRLS* |
| Ga0132258_101170116 | 3300015371 | Arabidopsis Rhizosphere | SPKEQKKEQKNNNTSGEPDQNQERNYSQGENQPVLASLPNDPPVGTATTYRRLS* |
| Ga0187802_102542471 | 3300017822 | Freshwater Sediment | DQKQERNYSQGENQVMLASLPENRPVVTVTTYRRFS |
| Ga0187824_102163002 | 3300017927 | Freshwater Sediment | KATTPAESTPKEREKNRKNNTSGQPEPRQERNYSRDENQPVLASNPEDPPAVSVTTIRRF |
| Ga0187803_104655481 | 3300017934 | Freshwater Sediment | NTSGQPEPRQERNYSQGENQVILASLPDQPPVVTVTTYRRFS |
| Ga0066667_103918442 | 3300018433 | Grasslands Soil | TTPAEPAPRREKEKNHKNDTSGQPEQRQERNYSREENQPVLASSKDDPTVVTVTTYRRFV |
| Ga0066662_102223041 | 3300018468 | Grasslands Soil | ENRKNNNTSGEPEQKKEQNYSRGENQPVLAFAPKDPTVVTVTANRRLV |
| Ga0187798_11586832 | 3300019275 | Peatland | PEQKQERNYSQGDNQLILASLPDNPPVVTLATLRRNV |
| Ga0210407_108854132 | 3300020579 | Soil | KEKKDNNTSGQPEPRQERNYSQGENQPVLASIPNDPPVETVTTYRRIS |
| Ga0210403_113584412 | 3300020580 | Soil | EQNNNKEKKDNNTSGQPEPRQERNYSQGENQPVLASIPNVPPVGTVTTYRRIS |
| Ga0210399_101056471 | 3300020581 | Soil | TPAEAVPNDKEREKNRKNNTSGEPEPRQERNYSRDENQPVLASLPDQPPAVSVTTIRRLA |
| Ga0210399_109460012 | 3300020581 | Soil | DPEPRQERNYSRDENQPVLASGPQNPLAVSVITTRRDV |
| Ga0210404_100160924 | 3300021088 | Soil | EPRQERNYSRDENQPVLASNPEDPPAVSVTTIRRLV |
| Ga0210404_102289931 | 3300021088 | Soil | AEPGPKDLKERDKNHKNNTSGDPEPRQERNYSRDENQPVLASAPEDPPAVSVTTNRRFV |
| Ga0210406_103302893 | 3300021168 | Soil | EPRQERNYSQGENQPVLASIPNVPPVGTVTTYRRIS |
| Ga0210406_107095102 | 3300021168 | Soil | QRQERNYSQGESQPVLAAAPDIPPVVTMTTYRRFV |
| Ga0210405_101095621 | 3300021171 | Soil | DPEPRQERNYSRDENQPVLASLPEPAPAVSVTTIRRIA |
| Ga0210405_108266912 | 3300021171 | Soil | KELKERDKNHKNNTSGDPEPRQERNYSRDENQPVLASAPDNPPAVSVTTNRRFA |
| Ga0210388_114941401 | 3300021181 | Soil | EKDKEHKNNSSGAPEPRQDRNYASDEIQPVLASAPDAPPAVSVTTIRRFV |
| Ga0193719_100252841 | 3300021344 | Soil | EPEQKQERNYSQGENQPVLASLPNVPPVGTATTYRRLS |
| Ga0210402_116666482 | 3300021478 | Soil | NTSGDPEPRQERNYSRDENQPVLASAPDNPPAVSVTTNRRFA |
| Ga0210409_105364621 | 3300021559 | Soil | PRQERNYSQGENQPVLASIPNVPPVGTVTTYRRIS |
| Ga0242642_10970491 | 3300022504 | Soil | RKNNNTSEQPEKRQERNYSQGESQLVVASLLNDPPVVTVTTYRRLV |
| Ga0179589_100817473 | 3300024288 | Vadose Zone Soil | EQKQERNYSQGENQPVLASLPNDPPVGTATTYRRVS |
| Ga0207692_103480511 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GPSEKDNKNKNNTSGQPEQRQERNYSRDENQPVLAYTPDDPTVVTVTTSRRLV |
| Ga0207692_104119661 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EKEKKDNNTSGQPEPRQERNYSQGENQPVLASIPNDPPVETATTYRRIS |
| Ga0207671_104798421 | 3300025914 | Corn Rhizosphere | QKQEKKDNNTSGQPEPRQERNYSQGENQPVLASLPNDPPVVTVNAYRRLS |
| Ga0207664_103301101 | 3300025929 | Agricultural Soil | KQEKERERNHKNNTSGDPEPRQERNYSRDENQPVLASGPQNPLAVSVITTRRDV |
| Ga0207711_119249642 | 3300025941 | Switchgrass Rhizosphere | KKDNNTSGQPEPRQERNYSQGENQPVLASLPNDPPVVTVNAYRRLS |
| Ga0207689_117197221 | 3300025942 | Miscanthus Rhizosphere | EPRQERNYSQGENQPVLASIPNDPPVETVTTYRRIS |
| Ga0209838_10225822 | 3300026214 | Soil | DNSKQEPEQKQERNYSQGENQPVLAWAPNNQPVVTLNADRRLS |
| Ga0209155_10122531 | 3300026316 | Soil | KKEKERKNNTSGQPEQKQERNYSQWENHPVLAAVPDQPPVVSVTTTYRRNS |
| Ga0209131_12313742 | 3300026320 | Grasslands Soil | DQKRERNYSREENQPVLAGLPDLPPAVTVTTNRRFV |
| Ga0209267_11240433 | 3300026331 | Soil | QKKEQNYSRGENQPVLAFAPKDPTVVTVTTNRRLV |
| Ga0209056_105996542 | 3300026538 | Soil | PQKDQHRKDNNNTSGQPEPRQERNYSQGENQPVLASTPDVPPIAAVTATRRFV |
| Ga0209003_11196522 | 3300027576 | Forest Soil | PADSVPKEREKNRKNDTSGQPEPRQERNYSRDENQPVLASLPDRTPAVSVTTTRRFV |
| Ga0209580_101587182 | 3300027842 | Surface Soil | ERNHKNNTSGDPEPRQERNYSRDENQPVLASGPQNPLAVSVITTRRDV |
| Ga0209517_102230112 | 3300027854 | Peatlands Soil | EKPKERRNDTSGQPEQKQERNYSQGEGHVVLAAAPENPPVATRTMYRRFL |
| Ga0209701_100249241 | 3300027862 | Vadose Zone Soil | ERKNNTSGQPEQKQERNYSQGETQPVLASAPDDPPVVTVTTYRRFS |
| Ga0209579_106843292 | 3300027869 | Surface Soil | SEKDNKNKNNTSGQPEQRQERNYSRDENQPVLAYTPDNPTVVTVTTNGRLV |
| Ga0209380_104561901 | 3300027889 | Soil | EKKDKKDNNTSGQPEPRQERNYSQGENQPVLASIPNVPPVGTVTTYRRIS |
| Ga0209488_107177092 | 3300027903 | Vadose Zone Soil | TSGQPEPRQERNYSQGENQPVLASIPNDPPVETVTTYRRIS |
| Ga0209415_106679331 | 3300027905 | Peatlands Soil | SPEARPKEKPKDRKNDTSGQPEPRQERNYSLGESQPVLAAAPHDPPVVIVNTYRRFS |
| Ga0307312_104582492 | 3300028828 | Soil | KERKNNTSGQPEQKQERNYSQGENQPVLASLPNDPPVVTVTTYRRFS |
| Ga0170834_1052699871 | 3300031057 | Forest Soil | PKEQNKEKKDNNTSGQPEPGQERNYSQGENQPVLASIPNDPPVVTMTAYRRLS |
| (restricted) Ga0255310_100665221 | 3300031197 | Sandy Soil | VPSPKEQKQEKKDNNTSGQPEPRQERNYSQGENQPVLASIPNDPPVVTMTAYRRLS |
| Ga0308194_101985951 | 3300031421 | Soil | KNNTSGQPEQKQERNYSQGENQPVLASLTNYPPVVTVTTYRRFS |
| Ga0307468_1009737662 | 3300031740 | Hardwood Forest Soil | ESTPKEREKNRKNDTSGQPEPRQERNYSRDENQPVLASLPEPAPAVSVTTTRRFV |
| Ga0307477_105529861 | 3300031753 | Hardwood Forest Soil | SGDPEPRQERNYSRDENQPVLASGPQDPLAVSVSTTRRDV |
| Ga0310909_113157821 | 3300031947 | Soil | PQNKERKNNNNTSEQPEKRQERNYSQGESQFVLAALREENPVVMVTTYRRLV |
| Ga0306926_111471601 | 3300031954 | Soil | KERKNNNNTSEQPEKRQERNYSQGESQFVLAALREENPVVMVTTYRRLV |
| Ga0306924_125815322 | 3300032076 | Soil | PEPRQEQNYSREENQPVLALAPDNPPAVSVTTIRRLV |
| Ga0307472_1025692602 | 3300032205 | Hardwood Forest Soil | KEPINNKEKKDDNTSGQPEPRQERNYSQGEKQPVLASIPNDPPVGTVTTYRRLS |
| Ga0335080_101609381 | 3300032828 | Soil | PDEKQERNYSREENQPVLAGLPEVPPAVTVTTNRRFV |
| Ga0335080_117069001 | 3300032828 | Soil | SGQPEPTQERNYSQGENQPVLAYLPNDPPVVRMTTYRRLL |
| Ga0326726_103489431 | 3300033433 | Peat Soil | KDNNTSGQPEPRQERNYSQGENQPVLASLPSDPPVVRMTTYRRLV |
| ⦗Top⦘ |