| Basic Information | |
|---|---|
| Family ID | F082731 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHM |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 53.10 % |
| % of genes near scaffold ends (potentially truncated) | 20.35 % |
| % of genes from short scaffolds (< 2000 bps) | 96.46 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (94.690 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (18.584 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.973 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (40.708 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.58% β-sheet: 0.00% Coil/Unstructured: 53.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00498 | FHA | 3.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002027|MIS_10142616 | All Organisms → Viruses → Predicted Viral | 1726 | Open in IMG/M |
| 3300002835|B570J40625_100092892 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 3788 | Open in IMG/M |
| 3300004095|Ga0007829_10047262 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 834 | Open in IMG/M |
| 3300004112|Ga0065166_10051622 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1368 | Open in IMG/M |
| 3300004463|Ga0063356_106455293 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 502 | Open in IMG/M |
| 3300004684|Ga0065168_1021989 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1001 | Open in IMG/M |
| 3300004784|Ga0007744_1212391 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1269 | Open in IMG/M |
| 3300004790|Ga0007758_10745849 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 525 | Open in IMG/M |
| 3300005260|Ga0074072_1058086 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1106 | Open in IMG/M |
| 3300005662|Ga0078894_10275154 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1527 | Open in IMG/M |
| 3300005662|Ga0078894_10311054 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1428 | Open in IMG/M |
| 3300005987|Ga0075158_10704305 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 546 | Open in IMG/M |
| 3300005988|Ga0075160_10315454 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 852 | Open in IMG/M |
| 3300005988|Ga0075160_10636918 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 569 | Open in IMG/M |
| 3300006383|Ga0075504_1231787 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1289 | Open in IMG/M |
| 3300006401|Ga0075506_1770417 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1236 | Open in IMG/M |
| 3300006803|Ga0075467_10035298 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 3173 | Open in IMG/M |
| 3300006805|Ga0075464_10130264 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1466 | Open in IMG/M |
| 3300006805|Ga0075464_10274760 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 1011 | Open in IMG/M |
| 3300007094|Ga0102532_1036098 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1442 | Open in IMG/M |
| 3300007200|Ga0103273_1152364 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1465 | Open in IMG/M |
| 3300007544|Ga0102861_1217606 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 527 | Open in IMG/M |
| 3300007561|Ga0102914_1240262 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 555 | Open in IMG/M |
| 3300007725|Ga0102951_1217130 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 542 | Open in IMG/M |
| 3300007760|Ga0105018_1043582 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1860 | Open in IMG/M |
| 3300007860|Ga0105735_1005497 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1886 | Open in IMG/M |
| 3300007861|Ga0105736_1098193 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 633 | Open in IMG/M |
| 3300008108|Ga0114341_10138637 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1428 | Open in IMG/M |
| 3300008110|Ga0114343_1092042 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1067 | Open in IMG/M |
| 3300008116|Ga0114350_1049336 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 1540 | Open in IMG/M |
| 3300009076|Ga0115550_1220222 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 632 | Open in IMG/M |
| 3300009151|Ga0114962_10132653 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1514 | Open in IMG/M |
| 3300009187|Ga0114972_10152314 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1466 | Open in IMG/M |
| 3300009235|Ga0103857_10105358 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 578 | Open in IMG/M |
| 3300009279|Ga0103880_10060501 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 565 | Open in IMG/M |
| 3300009411|Ga0115017_1226058 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 506 | Open in IMG/M |
| 3300009422|Ga0114998_10566712 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 534 | Open in IMG/M |
| 3300009432|Ga0115005_10205662 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1536 | Open in IMG/M |
| 3300009432|Ga0115005_10915789 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 708 | Open in IMG/M |
| 3300009432|Ga0115005_11309742 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 591 | Open in IMG/M |
| 3300009436|Ga0115008_10429057 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 939 | Open in IMG/M |
| 3300009441|Ga0115007_10115422 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1714 | Open in IMG/M |
| 3300009445|Ga0115553_1292468 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 630 | Open in IMG/M |
| 3300009497|Ga0115569_10082710 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1664 | Open in IMG/M |
| 3300009507|Ga0115572_10112194 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1626 | Open in IMG/M |
| 3300009508|Ga0115567_10187236 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1348 | Open in IMG/M |
| 3300009544|Ga0115006_11958528 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 538 | Open in IMG/M |
| 3300009599|Ga0115103_1199484 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
| 3300009599|Ga0115103_1394191 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1058 | Open in IMG/M |
| 3300009606|Ga0115102_10375852 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1324 | Open in IMG/M |
| 3300009701|Ga0116228_10631679 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 725 | Open in IMG/M |
| 3300009785|Ga0115001_10492974 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 757 | Open in IMG/M |
| 3300010157|Ga0114964_10568290 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 532 | Open in IMG/M |
| 3300010885|Ga0133913_11373959 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 1798 | Open in IMG/M |
| 3300012408|Ga0138265_1160872 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300013006|Ga0164294_11130399 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 525 | Open in IMG/M |
| 3300013087|Ga0163212_1069395 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1158 | Open in IMG/M |
| 3300014491|Ga0182014_10474830 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 615 | Open in IMG/M |
| 3300014491|Ga0182014_10530045 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 575 | Open in IMG/M |
| 3300016731|Ga0182094_1181589 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 810 | Open in IMG/M |
| 3300017788|Ga0169931_10248147 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1457 | Open in IMG/M |
| 3300018048|Ga0181606_10305048 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 878 | Open in IMG/M |
| 3300018996|Ga0192916_10199869 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 583 | Open in IMG/M |
| 3300019017|Ga0193569_10073759 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1497 | Open in IMG/M |
| 3300019021|Ga0192982_10126518 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 877 | Open in IMG/M |
| 3300019021|Ga0192982_10183619 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 742 | Open in IMG/M |
| 3300019036|Ga0192945_10028308 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1438 | Open in IMG/M |
| 3300019045|Ga0193336_10433108 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 619 | Open in IMG/M |
| 3300019201|Ga0180032_1075955 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 891 | Open in IMG/M |
| 3300020074|Ga0194113_10873159 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 610 | Open in IMG/M |
| 3300020157|Ga0194049_1039207 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1231 | Open in IMG/M |
| 3300020159|Ga0211734_10161442 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 844 | Open in IMG/M |
| 3300020161|Ga0211726_10153050 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 594 | Open in IMG/M |
| 3300020190|Ga0194118_10032091 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 3703 | Open in IMG/M |
| 3300020197|Ga0194128_10265348 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 876 | Open in IMG/M |
| 3300021091|Ga0194133_10618224 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 520 | Open in IMG/M |
| 3300021093|Ga0194123_10407296 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 621 | Open in IMG/M |
| 3300021345|Ga0206688_10677917 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 992 | Open in IMG/M |
| 3300021350|Ga0206692_1410419 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300021910|Ga0063100_1037078 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1403 | Open in IMG/M |
| 3300021912|Ga0063133_1019307 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1443 | Open in IMG/M |
| 3300021922|Ga0063869_1093033 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 684 | Open in IMG/M |
| 3300021962|Ga0222713_10169977 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1485 | Open in IMG/M |
| 3300023179|Ga0214923_10352132 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 776 | Open in IMG/M |
| 3300025375|Ga0208259_1043940 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 618 | Open in IMG/M |
| 3300027720|Ga0209617_10063691 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1528 | Open in IMG/M |
| 3300027741|Ga0209085_1074636 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1531 | Open in IMG/M |
| 3300027757|Ga0208671_10319115 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 546 | Open in IMG/M |
| 3300027760|Ga0209598_10084353 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1531 | Open in IMG/M |
| 3300027781|Ga0209175_10095706 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1274 | Open in IMG/M |
| 3300027833|Ga0209092_10299510 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 871 | Open in IMG/M |
| 3300027973|Ga0209298_10313860 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 608 | Open in IMG/M |
| 3300030564|Ga0210256_10367505 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 734 | Open in IMG/M |
| 3300030572|Ga0210258_10147948 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 754 | Open in IMG/M |
| 3300030628|Ga0247629_10089585 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 888 | Open in IMG/M |
| 3300030670|Ga0307401_10432625 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 598 | Open in IMG/M |
| 3300030671|Ga0307403_10078120 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1539 | Open in IMG/M |
| 3300030702|Ga0307399_10138013 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1077 | Open in IMG/M |
| 3300030702|Ga0307399_10410986 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 657 | Open in IMG/M |
| 3300030709|Ga0307400_10377693 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 900 | Open in IMG/M |
| 3300030709|Ga0307400_10553113 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 723 | Open in IMG/M |
| 3300030971|Ga0075375_11861565 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 749 | Open in IMG/M |
| 3300031522|Ga0307388_10605960 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 727 | Open in IMG/M |
| 3300031569|Ga0307489_10222076 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1183 | Open in IMG/M |
| 3300031569|Ga0307489_11418429 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 505 | Open in IMG/M |
| 3300031752|Ga0307404_10079064 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300031784|Ga0315899_10095175 | All Organisms → Viruses → Predicted Viral | 3068 | Open in IMG/M |
| 3300031788|Ga0302319_11206896 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 699 | Open in IMG/M |
| 3300032518|Ga0314689_10091803 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1427 | Open in IMG/M |
| 3300033572|Ga0307390_10158944 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1260 | Open in IMG/M |
| 3300034060|Ga0334983_0249861 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1079 | Open in IMG/M |
| 3300034068|Ga0334990_0145122 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1294 | Open in IMG/M |
| 3300034280|Ga0334997_0794520 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 570 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 18.58% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.42% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.42% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.54% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 3.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.65% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.77% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.77% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.77% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.77% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.77% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.89% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.89% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.89% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.89% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.89% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.89% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.89% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.89% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 0.89% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004784 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005987 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA | Engineered | Open in IMG/M |
| 3300005988 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA | Engineered | Open in IMG/M |
| 3300006383 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
| 3300007200 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007760 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009279 | Eukaryotic communities of water from the North Atlantic ocean - ACM42 | Environmental | Open in IMG/M |
| 3300009411 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012408 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300016731 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018996 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156) | Environmental | Open in IMG/M |
| 3300019017 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781 | Environmental | Open in IMG/M |
| 3300019021 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957) | Environmental | Open in IMG/M |
| 3300019036 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086) | Environmental | Open in IMG/M |
| 3300019045 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224) | Environmental | Open in IMG/M |
| 3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021910 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021912 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021922 | Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025375 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027781 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300030564 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030572 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030628 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030670 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030671 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030702 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030709 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030971 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031522 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031752 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032518 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033572 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MIS_101426165 | 3300002027 | Sinkhole Freshwater | MPVLISAIAHDWVYKNHGFNEEQFKSALFTHKIYEDPSVAMHMQ* |
| B570J40625_1000928923 | 3300002835 | Freshwater | MGQDPMMMPVLISAIAHDWVYVKHGFSEDQFKSALYTHRIYENP* |
| Ga0007829_100472621 | 3300004095 | Freshwater | MQEDPMIMPVLISAIAHDWVYKNHNWRGLVQSALFEHRIYEDPNVAQHMQRKQFELMMMA |
| Ga0065166_100516223 | 3300004112 | Freshwater Lake | MRYDPMIMPVLISAIAHDWVYKNKGFNEEQFKAALFAHKIYEDPEVAMHMQQKQMELL* |
| Ga0063356_1064552931 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRYDPMMMPVLISAIAHDWVFKNHGFTEEQFKAALFTHKIYEDPEVAMHMQTKQMELL* |
| Ga0065168_10219892 | 3300004684 | Freshwater | MQEDPMIMPVLISAIAHDWVYKNHNWRGLVKAALFEHRIYEDPNVAQHMQRKQFELM |
| Ga0007744_12123914 | 3300004784 | Freshwater Lake | MMMPVLISAIAHDWVFVKHGFQEDQFKAALFSHRIYENPSVSEHM* |
| Ga0007758_107458491 | 3300004790 | Freshwater Lake | MQEDPMIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHMQRKQFELMMMAQ* |
| Ga0074072_10580863 | 3300005260 | Soil | MMMPVLISAIAHDWVFKNHGYTEDQFKAALFHHKIYEDP* |
| Ga0078894_102751542 | 3300005662 | Freshwater Lake | MLMPVLISALAHDWVMINHNFTEDEFKAALFSHKIYENPSVSEHMQQK* |
| Ga0078894_103110544 | 3300005662 | Freshwater Lake | MLMPVLISAIAHDWVYKNHGFTEEQFKSALFTHRIYENP* |
| Ga0075158_107043052 | 3300005987 | Wastewater Effluent | MMMPIVISAIAHDWVLKNHNFTEDQFKSALFGFKIHEDPELAMFMQ* |
| Ga0075160_103154542 | 3300005988 | Wastewater Effluent | MMMPVLISAIAHDWVFKNHGFTEDQFKAALFTHKIYEDPDVAMHMQ* |
| Ga0075160_106369181 | 3300005988 | Wastewater Effluent | MMQDPMIAPVLISAIAHDWVFVNHNFTEEDFKSALFTHKIYENPEIG* |
| Ga0075504_12317872 | 3300006383 | Aqueous | MQKDPMMMPVLISAISHDWIKKNHGHDEEVFKSALFTHKIYEDPEVSMHMQQK* |
| Ga0075506_17704171 | 3300006401 | Aqueous | MLAPVLISAIAHDWVLVNHNYTEDDFKSALFSHKIYENPEVS |
| Ga0075467_100352982 | 3300006803 | Aqueous | MGADPMMMPVLISAIAHDWVYSEHSWKEEEFKSALFAHRIYENPAVSQHMQQK* |
| Ga0075464_101302644 | 3300006805 | Aqueous | MQDPMIAPVLISAIAHDWVFVNHNFTEEDFKSALFTYKIYENPEIG* |
| Ga0075464_102747604 | 3300006805 | Aqueous | MMMPVLISAIAHDWVMVKHGFTEDEFKAALFLHKIYENP* |
| Ga0102532_10360984 | 3300007094 | Freshwater Lake | MLMPVLISAIAHDWVKVNHGYDEDHFKAALFKHRIYENPEVSEHM* |
| Ga0103273_11523641 | 3300007200 | Freshwater Lake | MQEDPMIMPVLISAIAHDWVYKNHNWTEEVQRALFEHRIYEDPNVAQHMQRKQFELMMMA |
| Ga0102861_12176061 | 3300007544 | Estuarine | MPVLISAIAADWVLMNHKFGEDEFKAALFKHRIYERAEVQQQMQQK* |
| Ga0102914_12402621 | 3300007561 | Estuarine | MIAPVLISAIAHDWVLVNHNYPEDDFKAALFSHKIYENPEIS* |
| Ga0102951_12171302 | 3300007725 | Water | MPVLISALAHDWVFKHHNIPEDQFKAGLFEHKIYEDHSVAQHMQSKQIELMMLAQ* |
| Ga0105018_10435824 | 3300007760 | Marine | MLKDPMIMPVLISAIAHDWVYKNHQWSEENFKSALFEHKIYEDPNVAQHMQKK* |
| Ga0105735_10054974 | 3300007860 | Estuary Water | MLLPVLISAIAHDWVLKNHGFTEDEFKAALFAHKIYEEASVSEHM* |
| Ga0105736_10981932 | 3300007861 | Estuary Water | MFKSEYLSQMRQDPMMMPVLISCIAHDWVRVNHGFSEDEFKSALFHHKIY |
| Ga0114341_101386373 | 3300008108 | Freshwater, Plankton | MIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHMQRK* |
| Ga0114343_10920423 | 3300008110 | Freshwater, Plankton | MQEDPMIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHR |
| Ga0114350_10493362 | 3300008116 | Freshwater, Plankton | MIAPVLISAIAHDWVLVNHNYPEDDFKAALFSHKIYEHPEIS* |
| Ga0115550_12202222 | 3300009076 | Pelagic Marine | MTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYEDPQVAQHMQRK* |
| Ga0114962_101326535 | 3300009151 | Freshwater Lake | MQEDPMIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHMQRKQFELMMMA* |
| Ga0114972_101523141 | 3300009187 | Freshwater Lake | MQEDPMIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHM* |
| Ga0103857_101053583 | 3300009235 | River Water | MRADPMMMPVLISCIAHDWVKVQHGFTEDEFKAALFAHKIYENPKVSEHMQ |
| Ga0103880_100605011 | 3300009279 | Surface Ocean Water | MIMPVLISAIAHDWVFKNHNWSEENFKSALFEHKIYEDPNVAQHMQKK* |
| Ga0115017_12260581 | 3300009411 | Soil | MQDPMMMPVLISAIAHDWVFKNHNFTEEQFKAALFSHKIYEDPSV |
| Ga0114998_105667122 | 3300009422 | Marine | MLKDPMIMPVLISAIAHDWVFKNHSWSEENFKAALFEHKIYEDPNVAQHMQKK* |
| Ga0115005_102056624 | 3300009432 | Marine | MMMMPVLISAIAHDWVKVHHGYTEEDFKAALFAFKIYENP* |
| Ga0115005_109157892 | 3300009432 | Marine | MLKDPMIMPVLISAIAHDWVYKNHKWSEENFKAALFEHKIYEDPNVAQHMQKK* |
| Ga0115005_113097422 | 3300009432 | Marine | MMMMPVLISAIAHDWVKKHYGHSEEDFKAALFHYKIYENPDVA* |
| Ga0115008_104290571 | 3300009436 | Marine | MSKDPMIMPVLISAIAHDWVFKNHNWKEEQFKSALFEHKIYEDPGVA* |
| Ga0115007_101154224 | 3300009441 | Marine | MPVLISAIAHDWVKVNHGYDEDSFKAALFKHKIYENPEVSEHM* |
| Ga0115553_12924683 | 3300009445 | Pelagic Marine | MIMPVLISAIAHDWVYKNHNWKEESFKAALFEHKIYEDRKVAEHMQKKQFELMMMAQQMNPMMGM |
| Ga0115569_100827102 | 3300009497 | Pelagic Marine | MQKDPMIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHM* |
| Ga0115572_101121943 | 3300009507 | Pelagic Marine | MIMPVLISAIAHDWVYKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK* |
| Ga0115567_101872363 | 3300009508 | Pelagic Marine | MTKDPMIMPVLISALAHDWVFKNHNWSEDQFKAALFEHKIYED |
| Ga0115006_119585282 | 3300009544 | Marine | MLMPVLISAIAHDWVKVNHGYDEDSFKAALFKHKIYENPEVSEHM* |
| Ga0115103_11994843 | 3300009599 | Marine | MMMMPVLISAIAHDWVKKHYGHTEEDFKAALFHYKIYENPDVA* |
| Ga0115103_13941912 | 3300009599 | Marine | MIMPVLISAIAHDWVLKNHNYTEQVFKSSLFANKIYEDPSVAQHMQQK* |
| Ga0115102_103758524 | 3300009606 | Marine | VTADPMLMPVLISAIAHDWVKVNHGYEEENFKAALFKHKIYENPEVS* |
| Ga0116228_106316792 | 3300009701 | Host-Associated | MMMPVLISAIAHDWVFKNHGFTEDQFKAALFTHKIYEDPEVAMHMQTK |
| Ga0115001_104929741 | 3300009785 | Marine | MTKDPMIMPVLISAIAHDWVFKNHKRTEEEFKAALFEFKIYEDPAVAQH |
| Ga0114964_105682901 | 3300010157 | Freshwater Lake | MQEDPMIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVA* |
| Ga0133913_113739594 | 3300010885 | Freshwater Lake | MLMPVLISAMAHDWVMINHNFSEDEFKAALFLHKIYENPSVSEHM* |
| Ga0138265_11608723 | 3300012408 | Polar Marine | MMMMPVLISAIAHDWVKVHHGYSEEDFKAALFSFKIYENPEVAQHMQHK* |
| Ga0164294_111303991 | 3300013006 | Freshwater | MQEDPMIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHMQ |
| Ga0163212_10693954 | 3300013087 | Freshwater | MDQLMQDPMLMPVLISALAHDWVLMTHNFTEDEFKAALFQFKIYEN |
| Ga0182014_104748303 | 3300014491 | Bog | MRYDPMIMPVLISAIAHDWVFKNKGYTEEQFKAALFEHKIYEN* |
| Ga0182014_105300452 | 3300014491 | Bog | MMPVLISAIAHDWVLKNHNFNEEQFKAALFTHKIYEDPSVAMHMQ* |
| Ga0182094_11815892 | 3300016731 | Salt Marsh | MIMPVLFSAIAHDYVYKNHGWNEDQFKAALFHHKIYENPTVVQ |
| Ga0169931_102481474 | 3300017788 | Freshwater | MLMPVLISAIAHDWVLKNHGFSEDEFKAALFTHKIYEDPSVSEHMQQK |
| Ga0181606_103050483 | 3300018048 | Salt Marsh | MPVLFSAIAHDYVYKNHGWNEDQFKAALFHHKIYENPTVVQ |
| Ga0192916_101998691 | 3300018996 | Marine | LMPVLISAIAHDWVKINHGYTEDAFKAALFHYKIYENPSVSMHMQEKQ |
| Ga0193569_100737591 | 3300019017 | Marine | MLMPVLISAIAHDWVKVNHGIDEDNFKAALFKHKIYENPEVSEHMQ |
| Ga0192982_101265182 | 3300019021 | Marine | MPVLISAIAHDWVFKNHSWSEENFKAALFEHKIYEDPNVAQHMQKK |
| Ga0192982_101836191 | 3300019021 | Marine | MIMPVLISALAHDWVFKNHNWTEDQFKAALFEHKIYEDPAVAQHM |
| Ga0192945_100283083 | 3300019036 | Marine | MQKDPMIMPVLISAIAHDWVFKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK |
| Ga0193336_104331082 | 3300019045 | Marine | MMPVLISAIAHDWVLMNHGFSEEDFKAALFHYKIYENPEVAQHMQ |
| Ga0180032_10759553 | 3300019201 | Estuarine | MIAPVLISAIAHDWVLVNHNYPEDDFKAALFSHKIYENPEIS |
| Ga0194113_108731591 | 3300020074 | Freshwater Lake | MMMPVLISAIAHDWIYIQHGFSEDQFKSALFAHKIYENPSVSEHMQQK |
| Ga0194049_10392074 | 3300020157 | Anoxic Zone Freshwater | MLLPVLISAIAHDWVLKNHGFTEDEFKAALFAHKIYEEASVSEHM |
| Ga0211734_101614421 | 3300020159 | Freshwater | MIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHMQRK |
| Ga0211726_101530502 | 3300020161 | Freshwater | MLMPVLISAIAHDWVKVNHGYDEDHFKAALFKHRIYENPEVSEHM |
| Ga0194118_100320914 | 3300020190 | Freshwater Lake | MIISVLISAIFHDWVFVQHGFQENQFKSALFTHKIYENPSVS |
| Ga0194128_102653481 | 3300020197 | Freshwater Lake | MMPILISAIAHDWVYVKHGLSEEQFKSALFAHKIYENPQVSEHMQQK |
| Ga0194133_106182242 | 3300021091 | Freshwater Lake | MMPVLISCIAHDWVKMHHGFTEDEFKAALFQHKIYENPKVSEHM |
| Ga0194123_104072961 | 3300021093 | Freshwater Lake | MDQLMQDPMLMPVLISALAHDWVLMTHNFTEDEFKAALFQFKIY |
| Ga0206688_106779171 | 3300021345 | Seawater | MIMPVLISAIAHDWVFKNHGWTEDQFKAALFEHKIYEEPSVAQHMQAK |
| Ga0206692_14104192 | 3300021350 | Seawater | MMMMPVLISAIAHDWVKKHYGHTEEDFKAALFHYKIYENPDVA |
| Ga0063100_10370783 | 3300021910 | Marine | MLKDPMIMPVLISAIAHDWVYKNHKWSEENFKSALFEHKIYEDPNVAQHMQKK |
| Ga0063133_10193073 | 3300021912 | Marine | MDVMSKDPMIMPVLISAIAHDWVFKNHKWTEDEFKAALFEHKIYEDPTVAQHMQKK |
| Ga0063869_10930332 | 3300021922 | Marine | MPVLISAIAHDWVKVNHGYDEDSFKAALFKHKIYENPEVSEHM |
| Ga0222713_101699772 | 3300021962 | Estuarine Water | MSSDPMIMPVLISAIAHDWVFKNHNWTEDQFKAALFEHKIYEDPQVAQHMQSKQIELMML |
| Ga0214923_103521321 | 3300023179 | Freshwater | MIMPVLISAIAHDWVMKNHSWTEDQFKASLFEHKIYEDPTVATH |
| Ga0208259_10439402 | 3300025375 | Freshwater | MLMPVLISAIAHDWVKINHGFTEDEFKAALFAHKIYEDP |
| Ga0209617_100636911 | 3300027720 | Freshwater And Sediment | MIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHMQRKQFELMMMAQ |
| Ga0209085_10746364 | 3300027741 | Freshwater Lake | MIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHMQRKQFELMMMA |
| Ga0208671_103191151 | 3300027757 | Estuarine | MPVLISAIAHDWVWTNHKIPEDDFKAALFEHKIYEDPAVAQHMQQK |
| Ga0209598_100843534 | 3300027760 | Freshwater Lake | MIMPVLISAIAHDWVYKNHNWTEDQFKAALFEHRIYEDPNVAQHM |
| Ga0209175_100957063 | 3300027781 | Wastewater Effluent | MMMPVLISAIAHDWVFKNHGFTEDQFKAALFTHKIYEDPDVAMHMQ |
| Ga0209092_102995102 | 3300027833 | Marine | MSKDPMIMPVLISAIAHDWVFKNHNWKEEQFKSALFEHKIYEDPGVA |
| Ga0209298_103138601 | 3300027973 | Freshwater Lake | MLMPVLISAMAHDWVMIHHNFTEDEFKAALFLHKIYENPSVSEH |
| Ga0210256_103675052 | 3300030564 | Soil | MMMPIVISAIAHDWVLKNHGYTEDQFKGALFGFKIHEDPELAMFMQ |
| Ga0210258_101479481 | 3300030572 | Soil | MSQVNEDPMLMPVLISAIAHDWVFKNHGFCEEAFKGALFSHKIYEDP |
| Ga0247629_100895851 | 3300030628 | Soil | MIMPVLISAIAHDWVYKNHGFNEEQFKAALFQHKIYEDPEVAMHMQSKQMELL |
| Ga0307401_104326252 | 3300030670 | Marine | MMMMPVLISAIAHDWVKKHYGHSEEDFKAALFHYKIYENPDVA |
| Ga0307403_100781202 | 3300030671 | Marine | MLKDPMIMPVLISAIAHDWVFKNHSWSEENFKAALFEHKIYEDPNVAQHMQKK |
| Ga0307399_101380131 | 3300030702 | Marine | MMMMPVLISAIAHDWVKVNHGHSEEDFKAALFAFKIYENP |
| Ga0307399_104109862 | 3300030702 | Marine | MPVLISAIAHDWVKINHGFSEEDFKAALFHYKIYENPEVA |
| Ga0307400_103776933 | 3300030709 | Marine | MIMPVLISAIAHDWVLKNHNYTEQVFKSSLFANKIYEDPSVAQHMQQK |
| Ga0307400_105531133 | 3300030709 | Marine | MPVLISAIAHDWIFKNHNWKEDAFKAALFEFKIYEDRKVAEHMQKKQFELMMM |
| Ga0075375_118615653 | 3300030971 | Soil | MMMPVLISAIAHDWVFKERGYTEEEFKAALFEHKIYEDEGVAMHM |
| Ga0307388_106059602 | 3300031522 | Marine | MMMMPVLISAIAHDWVKINHGFSEEDFKAALFHYKIYENPEVA |
| Ga0307489_102220762 | 3300031569 | Sackhole Brine | VTQDPMLMPVLISAIAHDWVKMNHGYDEDHFKAALFKHRIYENPEVSEHM |
| Ga0307489_114184292 | 3300031569 | Sackhole Brine | MLMPVLISAIAHDWVKMNHGYDEDHFKAALFKFRIYENPEVSEHM |
| Ga0307404_100790641 | 3300031752 | Marine | MMMMPVLISAIAHDWVKVHHGYSEEDFKAALFSFKIYENPEVAQHMQMKQME |
| Ga0315899_100951754 | 3300031784 | Freshwater | MMMPVLISAIAHDWVYVKHGFSEDQFKSALYTHRIYENP |
| Ga0302319_112068962 | 3300031788 | Bog | MLMPVLISAIAHDWVFKNHGYTEDAFKAALFVHKIYEDQSVAMHMQ |
| Ga0314689_100918034 | 3300032518 | Seawater | MIMPVLISAIAHDWVYKNHKWTEDEFKAALFEHKIYEDPNVAQHMQKK |
| Ga0307390_101589441 | 3300033572 | Marine | MMPVLISAIAHDWVLMNHGFSEEDFKAALFHYKIYENPEVAQHMQQKQM |
| Ga0334983_0249861_54_173 | 3300034060 | Freshwater | MMMPVLISCIAHDWVRVHHGFTEDEFKAALFHHKIYENP |
| Ga0334990_0145122_1_120 | 3300034068 | Freshwater | MLMPVLISALAHDWVMINHNFTEDEFKAALFLHKIYENPS |
| Ga0334997_0794520_23_169 | 3300034280 | Freshwater | MMMPVLISCIAHDWVKMHHGWTEDEFKAALFQHKIYENPRVSEHMQMK |
| ⦗Top⦘ |