NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082723

Metagenome / Metatranscriptome Family F082723

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082723
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 115 residues
Representative Sequence MKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDVKVGASFKF
Number of Associated Samples 99
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 74.77 %
% of genes near scaffold ends (potentially truncated) 38.05 %
% of genes from short scaffolds (< 2000 bps) 72.57 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (61.062 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(28.319 % of family members)
Environment Ontology (ENVO) Unclassified
(50.442 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.920 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.85%    β-sheet: 43.22%    Coil/Unstructured: 55.93%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF07486Hydrolase_2 5.31
PF02690Na_Pi_cotrans 4.42
PF05118Asp_Arg_Hydrox 3.54
PF11753DUF3310 2.65
PF01370Epimerase 1.77
PF03796DnaB_C 0.88
PF00145DNA_methylase 0.88
PF06941NT5C 0.88
PF09293RNaseH_C 0.88
PF136402OG-FeII_Oxy_3 0.88
PF00692dUTPase 0.88
PF00565SNase 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 5.31
COG1283Na+/phosphate symporterInorganic ion transport and metabolism [P] 4.42
COG3555Aspartyl/asparaginyl beta-hydroxylase, cupin superfamilyPosttranslational modification, protein turnover, chaperones [O] 3.54
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.88
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.88
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.88
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 0.88
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.88
COG45025'(3')-deoxyribonucleotidaseNucleotide transport and metabolism [F] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A61.06 %
All OrganismsrootAll Organisms38.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10031498Not Available2906Open in IMG/M
3300000101|DelMOSum2010_c10033151All Organisms → cellular organisms → Bacteria2807Open in IMG/M
3300000101|DelMOSum2010_c10046598All Organisms → Viruses → Predicted Viral2205Open in IMG/M
3300000116|DelMOSpr2010_c10093083Not Available1157Open in IMG/M
3300000117|DelMOWin2010_c10000646Not Available22186Open in IMG/M
3300001938|GOS2221_1004895All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium5163Open in IMG/M
3300003301|Ga0005239J48904_1009562Not Available546Open in IMG/M
3300003346|JGI26081J50195_1001296All Organisms → cellular organisms → Bacteria9988Open in IMG/M
3300003580|JGI26260J51721_1012683All Organisms → Viruses → Predicted Viral2083Open in IMG/M
3300003617|JGI26082J51739_10048882Not Available1346Open in IMG/M
3300004097|Ga0055584_102101919Not Available577Open in IMG/M
3300005747|Ga0076924_1050555All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1194Open in IMG/M
3300005747|Ga0076924_1211349Not Available1351Open in IMG/M
3300006403|Ga0075514_1890576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium566Open in IMG/M
3300006752|Ga0098048_1092621Not Available918Open in IMG/M
3300006793|Ga0098055_1214108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium729Open in IMG/M
3300006874|Ga0075475_10137271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1081Open in IMG/M
3300006916|Ga0070750_10247290Not Available775Open in IMG/M
3300006922|Ga0098045_1092968Not Available715Open in IMG/M
3300007276|Ga0070747_1107248Not Available1027Open in IMG/M
3300009000|Ga0102960_1149149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium842Open in IMG/M
3300009001|Ga0102963_1095845All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1210Open in IMG/M
3300009124|Ga0118687_10200193Not Available728Open in IMG/M
3300009495|Ga0115571_1154137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium961Open in IMG/M
3300009507|Ga0115572_10149610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1370Open in IMG/M
3300009543|Ga0115099_10904120Not Available526Open in IMG/M
3300009599|Ga0115103_1335083Not Available563Open in IMG/M
3300009606|Ga0115102_10290687Not Available936Open in IMG/M
3300010149|Ga0098049_1026514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1893Open in IMG/M
3300010368|Ga0129324_10009450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium5210Open in IMG/M
3300010368|Ga0129324_10278075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium662Open in IMG/M
3300012528|Ga0129352_10532333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium560Open in IMG/M
3300016724|Ga0182048_1183523Not Available546Open in IMG/M
3300016734|Ga0182092_1315470Not Available1019Open in IMG/M
3300016741|Ga0182079_1721448Not Available527Open in IMG/M
3300017697|Ga0180120_10017054All Organisms → cellular organisms → Bacteria → Proteobacteria3418Open in IMG/M
3300017708|Ga0181369_1093071Not Available631Open in IMG/M
3300017719|Ga0181390_1003231Not Available6538Open in IMG/M
3300017724|Ga0181388_1121375Not Available622Open in IMG/M
3300017728|Ga0181419_1114845Not Available657Open in IMG/M
3300017729|Ga0181396_1009088Not Available2000Open in IMG/M
3300017742|Ga0181399_1058662Not Available992Open in IMG/M
3300017744|Ga0181397_1004601Not Available4556Open in IMG/M
3300017750|Ga0181405_1031020Not Available1454Open in IMG/M
3300017751|Ga0187219_1023051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2255Open in IMG/M
3300017781|Ga0181423_1213523Not Available728Open in IMG/M
3300017950|Ga0181607_10008278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8594Open in IMG/M
3300018041|Ga0181601_10009128All Organisms → cellular organisms → Bacteria8078Open in IMG/M
3300018048|Ga0181606_10002212Not Available16759Open in IMG/M
3300019274|Ga0182073_1376088Not Available586Open in IMG/M
3300020165|Ga0206125_10046441Not Available2154Open in IMG/M
3300020187|Ga0206130_10314220Not Available669Open in IMG/M
3300021085|Ga0206677_10005144All Organisms → cellular organisms → Bacteria10423Open in IMG/M
3300021085|Ga0206677_10347837Not Available577Open in IMG/M
3300021169|Ga0206687_1683606All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300021185|Ga0206682_10102512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1418Open in IMG/M
3300021957|Ga0222717_10013808All Organisms → cellular organisms → Bacteria5535Open in IMG/M
3300021957|Ga0222717_10045892All Organisms → Viruses → Predicted Viral2846Open in IMG/M
3300021957|Ga0222717_10064426All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2348Open in IMG/M
3300021957|Ga0222717_10226993Not Available1095Open in IMG/M
3300021958|Ga0222718_10000189Not Available63368Open in IMG/M
3300021958|Ga0222718_10299138Not Available836Open in IMG/M
3300021959|Ga0222716_10270757Not Available1038Open in IMG/M
3300022068|Ga0212021_1002337All Organisms → cellular organisms → Bacteria2467Open in IMG/M
3300022169|Ga0196903_1044532Not Available515Open in IMG/M
3300022926|Ga0255753_1010583All Organisms → cellular organisms → Bacteria7679Open in IMG/M
3300023567|Ga0228694_131235Not Available552Open in IMG/M
3300023679|Ga0232113_1014886Not Available819Open in IMG/M
3300023694|Ga0228683_1001998All Organisms → Viruses → Predicted Viral1918Open in IMG/M
3300023695|Ga0228680_1040834Not Available535Open in IMG/M
3300023695|Ga0228680_1044631Not Available512Open in IMG/M
3300023696|Ga0228687_1037854Not Available569Open in IMG/M
3300023698|Ga0228682_1041979Not Available617Open in IMG/M
3300023702|Ga0232119_1051276Not Available623Open in IMG/M
3300024185|Ga0228669_1019856All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1575Open in IMG/M
3300024185|Ga0228669_1020118Not Available1562Open in IMG/M
3300024188|Ga0228602_1069371Not Available590Open in IMG/M
3300024192|Ga0228637_1050285Not Available841Open in IMG/M
(restricted) 3300024264|Ga0233444_10168892All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1040Open in IMG/M
3300024313|Ga0228624_1007135All Organisms → Viruses → Predicted Viral3139Open in IMG/M
3300024318|Ga0233400_1096575Not Available670Open in IMG/M
3300024326|Ga0228652_1009300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3087Open in IMG/M
3300024329|Ga0228631_1107720Not Available653Open in IMG/M
3300025483|Ga0209557_1086137Not Available679Open in IMG/M
3300025658|Ga0209659_1182786Not Available602Open in IMG/M
3300025684|Ga0209652_1000305All Organisms → cellular organisms → Bacteria41629Open in IMG/M
3300025870|Ga0209666_1343894Not Available573Open in IMG/M
3300026390|Ga0247558_117526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium686Open in IMG/M
3300026447|Ga0247607_1084471Not Available562Open in IMG/M
3300026458|Ga0247578_1106692All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300026460|Ga0247604_1067635All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium843Open in IMG/M
3300026471|Ga0247602_1165225Not Available511Open in IMG/M
3300026495|Ga0247571_1129050Not Available593Open in IMG/M
3300026500|Ga0247592_1119799All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium631Open in IMG/M
3300026500|Ga0247592_1167513Not Available522Open in IMG/M
3300026513|Ga0247590_1184648Not Available531Open in IMG/M
3300027081|Ga0208954_1022723Not Available842Open in IMG/M
3300027192|Ga0208673_1070891Not Available545Open in IMG/M
3300027612|Ga0209037_1122758Not Available630Open in IMG/M
3300027612|Ga0209037_1166544Not Available531Open in IMG/M
3300028076|Ga0247562_1006688Not Available1140Open in IMG/M
3300028102|Ga0247586_1048439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium802Open in IMG/M
3300028110|Ga0247584_1058179Not Available976Open in IMG/M
3300028134|Ga0256411_1276935Not Available511Open in IMG/M
3300028280|Ga0228646_1098776Not Available714Open in IMG/M
3300028335|Ga0247566_1081522Not Available547Open in IMG/M
3300028391|Ga0233394_1029077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1434Open in IMG/M
3300031519|Ga0307488_10085833Not Available2330Open in IMG/M
3300031774|Ga0315331_10053490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2992Open in IMG/M
3300031774|Ga0315331_10218691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1413Open in IMG/M
3300031851|Ga0315320_10268628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1229Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater28.32%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine9.73%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.85%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.96%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.19%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water6.19%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.31%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.31%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.42%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.77%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.77%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.77%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.77%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.89%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.89%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.89%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001938Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005EnvironmentalOpen in IMG/M
3300003301Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI073_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003346Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNAEnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300003617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016724Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016733Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300023567Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023702Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024185Seawater microbial communities from Monterey Bay, California, United States - 84DEnvironmentalOpen in IMG/M
3300024188Seawater microbial communities from Monterey Bay, California, United States - 2DEnvironmentalOpen in IMG/M
3300024192Seawater microbial communities from Monterey Bay, California, United States - 47DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024313Seawater microbial communities from Monterey Bay, California, United States - 29DEnvironmentalOpen in IMG/M
3300024318Seawater microbial communities from Monterey Bay, California, United States - 46DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026390Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026460Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027081Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027612Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028076Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 10R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028280Seawater microbial communities from Monterey Bay, California, United States - 58DEnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028391Seawater microbial communities from Monterey Bay, California, United States - 24DEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1003149853300000101MarineMKLAVIATAALMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDSDFEFGDIKVGASFKF*
DelMOSum2010_1003315143300000101MarineMKLTVIATAATLLVATQASAIDLGNGLSAGAEFDMNYTTGTEIWALEATPEVGLGIMGTDLSVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF*
DelMOSum2010_1004659813300000101MarineMKLAVIATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASFKF*
DelMOSpr2010_1009308313300000116MarineVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGLAMFGVDLTVGSTFDLMNLNGDDTFKGLDFSTEYAIGNTGLTGYGEVSTDSDFEFGDVKVGAKFAF*
DelMOWin2010_10000646253300000117MarineMKLAVIATAATLLVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGMGLMGAQVTVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVATDSDFEFGDFKVGAKFAF*
GOS2221_100489583300001938MarineGCTQASAVDLGNGLTVGGEVDMNYTTGTELWALEATPEVGLGVMGADFTVGSTFDLMDLNGDETFKGLDFAAEYAIGATGLTAYGEISTDADFEFGDLKVGASFAF*
Ga0005239J48904_100956213300003301MarineMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASFKF*
JGI26081J50195_1001296153300003346MarineMKLAVIATAATLLVATQASAIDLGYGLTAGGEVDMNYTTGTELWALEATPEVGMGLMGAQVTVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVATDSDFEFGDVKVGAKFAF*
JGI26260J51721_101268313300003580MarineMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPLGMGLTAYGEVSTDADFEFGDIKVGASFKF*
JGI26082J51739_1004888233300003617MarineMKLAVIATAATLLVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGLAMFGVDLTVGSTFDLMNLNGDDTFKGLDFSTEYAIGNTGLTGYGEVSTDSDFEFGDVKVGAKFAF*
Ga0055584_10210191913300004097Pelagic MarineMKLAVLATAATLLVATQASAVDLGNGLTAGAEVDMNYTTGTEIWALEATPEVGMGIMGANLTVGSTFDLMNLNGDDVFKGLDFSAEYAVGNTGLTAYGEVGTDSDFEFGDVKVGAKFAF*
Ga0076924_105055543300005747MarineVIATAATLLVATQASAIDLGNGLSAGAEFDMNYTTGTEIWALEATPEVGLGIMGTDLSVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF*
Ga0076924_121134943300005747MarineVIATAATLLVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGLAMFGVDLTVGSTFDLMNLNGDDTFKGLDFSTEYAIGNTGLTGYGEVSTDSDFEFGDVKVGAKFAF*
Ga0075514_189057613300006403AqueousMKLAVLATAAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNDDDVFKGIDFEVEYPIGMTGLEAYGEVSTDSDFEFGDVKIGASFKF*
Ga0098048_109262123300006752MarineMKLAVITTAALMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDNTFKGLDFDASYPMGMGLTAYGEVSTDADFEFGDIKVGASFKF*
Ga0098055_121410823300006793MarineMKLAVLATAATLLVATQASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGFSTFGANLIVGSTFDLMKLNEDDVFKGIDFEAEYPIGMTGLTAYGEVSTDSDFEFGDIKIGASFKF*
Ga0075475_1013727123300006874AqueousMKLAVLATAATLLVATQASAIDLGNGLSAAAEVDMNYTTGVETWALEATPEIGFSTFGANLSVGSTFDLMKLNDDDVFKGIDFEATYPIGMTGLTAYGEVSTDSDFEFGDIKVGASFKF*
Ga0070750_1024729013300006916AqueousMKLAVLATAATLLVATQASAIDLGNGLSAGAEVDMNYTTGVETWALEATPEIGFSTFGANLSVGSTFDLMKLNDDDVFKGIDFEATYPIGMTGLTAYGEVSTDSDFEFG
Ga0098045_109296813300006922MarineMKLAVLATAATLLVATQASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGFSTFGANLTVGSTFDLMKLNEDDVFKGIDFEAEYPIGMTGLTAYGEVSTDSDFEFGDVTIGASFKF*
Ga0070747_110724833300007276AqueousMKLAVIATAATLLVATQASAIDLGNGLSAGAEFDMNYTTGTEIWALEATPEVGLGIMGTDLSVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF*
Ga0102960_114914913300009000Pond WaterQFIMFLTQSRKSKMKLAVIATAATLLVATQASAIDLGNGLSAGAEVDMNYTTGTEIWALEATPEVGMGIMGANLTVGSTFDLMNLNGDDVFKGLDFSAEYAVGNTGLTAYGEVGTDSDFEFGDVKVGAKFAF*
Ga0102963_109584523300009001Pond WaterMFLTQSRKSKMKLAVIATAATLLVATQASAIDLGNGLSAGAEVDMNYTTGTEIWALEATPEVGMGIMGANLTVGSTFDLMNLNGDDVFKGLDFSAEYAVGNTGLTAYGEVGTDSDFEFGDVKVGAKFAF*
Ga0118687_1020019313300009124SedimentMKLAVFATAATLLVATQASAVDLGNGLTVGGEVDMNYTTGTELWALEATPEVGLGLMGAEVTVGSTFDLMNLNGDDTFKGLDFSAEYAIGATGLTAYGEVSTDSDFEFGNVKMGASFAF*
Ga0115571_115413723300009495Pelagic MarineMKLAVIATAATLLVATQASAVDLGNGLTVGGEVDMNYTTGTELWALEATPEVGLAMFGVDLTVGSTFDLMNLNGDNTFKGLDFSTEYAIGNTGLTGYGEVSTDSDFEFGDVTVGAKFAF*
Ga0115572_1014961033300009507Pelagic MarineMKLAVIATAATLLVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGLAMFGVDLTVGSTFDLMNLNGDDTFKGLDFSTEYAIGNTGLTAYGEVATDSDFEFGDVTVGAKFAF*
Ga0115099_1090412013300009543MarineMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGVGLSVGSTFDLMKLNESDSFTGLDFDASYPLGMGLTAYGEVSTDADFEFGDVKVGASFKF*
Ga0115103_133508313300009599MarineMKLAVLATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNDNDVFKGVDFEATYPIGMTGLEAYGEVSTDSDFEFGDVKIGASFKF*
Ga0115102_1029068723300009606MarineMKLAVLATTATLMVATQASAFDLGNGLSAGAEVDMNYTTGVETWALEATPELGLSMMGAAFTVGSTFDLMKLNEDDVFKGVDFEASYPIGMTGLTAYGEVSTDSDFEFGDVKIG
Ga0098049_102651453300010149MarineMKLAVLATAATLLVATQASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGFSTFGANLTVGSTFDLMKLNEDDVFKGIDFEAEYPIGMTGLTAYGEVSTDSDFEFGDIKIGASFKF*
Ga0129324_1000945033300010368Freshwater To Marine Saline GradientMKLAVIAAAATLLVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGLAMFGVDFTVGSTFDLMNLNGDDTFKGLDFSTEYAIGNTGLTGYGEVSTDSDFEFGDVKVGAKFAF*
Ga0129324_1027807513300010368Freshwater To Marine Saline GradientVDLGYGLTAGGEVDMNYTTGTELWALEATPEVGMDLMGAQVTVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVATDSDFEFGDFKVGAKFAF*
Ga0129352_1053233313300012528AqueousMKLAVLATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNDDDVFKGIDFEVEYPIGMTGLEAYGEVSTDSDFEFGDVKIGASFKF*
Ga0182048_118352313300016724Salt MarshMKLAVLATAATLLVATQASAIDLGNGLSAGAEFDMNYTTGVETWALEATPEVGFSTFGANLTVGSTFDLMKLNDDDVFKGIDFEAEYPIGMTGLTAYGEVSTDSDFEFGDVKLGASFKF
Ga0182042_126968213300016733Salt MarshMKLAAIATTAAVLVATQAAAIDLGGGLSAGAEIDMNYTTGVDSWALEATPEVGFSTMGAQLTVGSTFDMLKLNDDDLFKGLDFEATYPLAT
Ga0182092_131547023300016734Salt MarshMKLAAIATTAAVLVATQAAAIDLGGGLSAGAEIDMNYTTGVDSWALEATPEVGFSTMGAQLTVGSTFDMLKLNDDDLFKGLDFEATYPLATTGVSLYGEVSTDDDLEFGDVTVGATFK
Ga0182079_172144813300016741Salt MarshMKLAAIATTAAVLVATQAAAIDLGGGLSAGAEIDMNYTTGVDSWALEATPEVGFSTMGAQLTVGSTFDMLKLNDDDLFKGLDFEATYPLATTGVSLYGEVSTDDDLEFGDVTVGA
Ga0180120_1001705443300017697Freshwater To Marine Saline GradientMKLAVIAAAATLLVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGLAMFGVDFTVGSTFDLMNLNGDDTFKGLDFSTEYAIGNTGLTGYGEVSTDSDFEFGDVKVGAKFAF
Ga0181369_109307113300017708MarineMKIAVIATAATLLVATQASAIDLGNGLSAGAEVDMNYTTGTEVWALEATPEVGFGLMGTDLTVGSTFDLMNLNGDDVFQGLDFAAEYAVGATGLTAYGEVSTDSDFEFGDVKVGAKFAF
Ga0181390_100323143300017719SeawaterMKIAVIATAATLLVATQASAIDLGNGLSAGAEVDMNYTTGTEVWALEATPEVGLGLMGTDVTVGSTFDLMNLNGDDVFQGLDFAAEYAVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF
Ga0181388_112137513300017724SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPITGTGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0181419_111484513300017728SeawaterTAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDTDFEFGDIKVGASFKF
Ga0181396_100908823300017729SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMKLNESDSFTGLDFDASYPLGMGLTADGEVSTDADFEFGDVKVGASFKF
Ga0181399_105866223300017742SeawaterMKLAVLATTATLMVATQASAFDLGNGLSAGAEVDMNYTTGVETWALEATPELGLSMMGAAFTVGSTFDLMKLNEDDVFKGVDFEASYPIGMTGLTAYGEVSTDSDFEFGDVKIGASFKF
Ga0181397_100460153300017744SeawaterMKLAVIATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEAKPELAFSTMGAALSVGSTFDLMKLNESDSFTGLDFDASYPLGMGLTAYGEVSTDADFEFGDVKVGASFKF
Ga0181405_103102043300017750SeawaterMKLAVIATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEAKPELAFSTMGAALSVGSTFDLMKLNESDSFTGLDFDASYPLGMGLTAYGEV
Ga0187219_102305143300017751SeawaterMKIAVIATAATLLVATQASAIDLGNGLTVGAEVDMNYTTGTEVWALEATPEVGLGLMGTDVTVGSTFDLMNLNGDDVFQGLDFAAEYAVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF
Ga0181423_121352323300017781SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGTELWALEAKPELALSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIGATGLTAYGEVSTDTDFEFGDIKVGASFKF
Ga0181607_1000827873300017950Salt MarshMKLAVIATAATLLVATQASAIDLGNGLSAGAEFDMNYTTGTEIWALEATPEVGLGFMGTDLAVGSTFDLMNLNGDDVFKGLDFSAEYSVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF
Ga0181571_1025389113300017957Salt MarshAEAIELGGGLKAGAEIDMNYTTGIEEWALEATPEVGFEAYGADLTVGSTFDLMGLNEDDVFKGLDFGAEYNIGVIPGLTAYGEIGTDADFEFGDATMGVKFAF
Ga0181601_1000912853300018041Salt MarshMKLAVIATAATLLVATQASAIDLGNGLSAGAEFDMNYTTGTEIWALEATPEVGLGFMGTDLSVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF
Ga0181606_10002212283300018048Salt MarshMKLAVIATAATLLVATQASAIDLGNGLSAGAEFDMNYTTGTEIWALEATPEVGLGIMGTDLSVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF
Ga0182073_137608813300019274Salt MarshMKLAAIATTAAVLVATQAAAIDLGGGLSAGAEIDMNYTTGVDSWALEATPEVGFSTMGAQLTVGSTFDMLKLNDDDLFKGLDFEATYPLATTGVSLYGEVSTDDDLEFGDVTVGATFKF
Ga0206125_1004644133300020165SeawaterMKLAVIATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEAKPELAFSTMGLGLSVGSTFDLMKLNESDSFTGLDFDASYPLGMGLTAYGEVSTDADFEFGDVKVGASFKF
Ga0206130_1031422013300020187SeawaterMKLAVFATAATLLVATQASAVDLGNGLTVGGEVDMNYTTGVELWALEATPEVGLGVMGADFTVGSTFDLMNLNGDDTFKGLDFAAEYAIGATGLTAYGEISTDADFGFGDLKVGTSFAF
Ga0206677_10005144203300021085SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDTDFEFGDIKVGASFKF
Ga0206677_1034783713300021085SeawaterMKLAVLATAATLLVATQASAVDLGNGLSAGAEVDMNYTTGVGTWALEAKPEVGFSTFGAELTVGSTFDLMKLNDDDVFKGVDFEVEYPIGMTGLEAYGEVSTNSDFEFGDIKIGASFKF
Ga0206687_168360613300021169SeawaterMKLAVLATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNDNDVFKGIDFEVEYPIGMTGLEAYGEVSTDSDFEFGDVKIGASFKF
Ga0206682_1010251213300021185SeawaterMKLAVLATAATLLVATQASAVDLGNGLSAGAEVDMNYTTGVGTWALEAKPEVGFSTFGAELTVGSTFDLMKLNDDDVFKGVDFEVEYPIGMTGLEAYGEVSTNSDFEFGDIKIGASFNF
Ga0222717_1001380843300021957Estuarine WaterMKLAVIATAATLLVATQASAIDLGNGLSAGAEVDMNYTTGTEIWALEATPEVGMGIMGANLTVGSTFDLMNLNGDDVFKGLDFSAEYAVGNTGLTAYGEVGTDSDFEFGDVKVGAKFAF
Ga0222717_1004589213300021957Estuarine WaterMKLAVLATAATLLVATQASAVDLGNGLSAGAEVDMNYTTGVETWALEATPEVGFSTFGANLTVGSTFDLMKLNEDDVFKGIDFEVEYPIGMTGLEAYGEVSTDSDFEFGDIKIGASFKF
Ga0222717_1006442653300021957Estuarine WaterMKLAVLATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNDNDVFKGVDFEATYPIGMTGLEAYGEVSTDSDFEFGDVKIGASFKF
Ga0222717_1022699313300021957Estuarine WaterMKLAVIATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEAKPELAFSTMGVGLSVGSTFDLMKLNESDSFTGLDFDASYPLGMGLTAYGEVSTDADFEFGDVKVGASFKF
Ga0222718_10000189973300021958Estuarine WaterMKLAVFATAATLLVATQASAVDLGNGLTVGGEVDMNYTTGTELWALEATPEVGLGLMGAEVTVGSTFDLMNLNGDDTFKGLDFSAEYAIGATGLTAYGEVSTDSDFEFGNVKMGASFAF
Ga0222718_1029913813300021958Estuarine WaterMKLAVIATAATLLVATQASAIDLGNGLSAGAEVDMNYTTGTEIWALEATPEVGMGIMGANLTVGSTFDLMNLNGDDVFKGLDFSAEYAVGNTGLTAYGEVGTDSDFEFGDVK
Ga0222716_1027075713300021959Estuarine WaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0212021_100233733300022068AqueousMKLAVIATAATLLVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGMGLMGAQVTVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVATDSDFEFGDFKVGAKFAF
Ga0196903_104453213300022169AqueousLIMFLTQSRKSKMKLTVIATVATLLVATQASAVDLGYGLTAGGEVDMNYTTGTELWALEATPEVGMDLMGAQVTVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVATDSDFEFGDFKVGAKFAF
Ga0255753_1010583133300022926Salt MarshMKLAVIATAATLLVATQASAIDLGNGLSAGAEFDMNYTTGTEIWALEATPEVGLGFMGTDLAVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVSTDSDFEFGDVKVGAKFAF
Ga0228694_13123513300023567SeawaterMKLAVLATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNEDDAFKGIDFEAKYPIGMTGLEAYGEVSTDSDFEFGDVKIGASFKF
Ga0232113_101488623300023679SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDVKVGASFKF
Ga0228683_100199813300023694SeawaterVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0228680_104083413300023695SeawaterMKLAVLATAATLLVATQASAVDLGNGLSAGAEVDMNYTTGVGTWALEAKPEVGFSTFGAELTVGSTFDLMKLNDDDVFKGVDFEVEYPIGMTGLEAYGEVSTNSDFEFGDIKIG
Ga0228680_104463113300023695SeawaterVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDTDFEFGDIKVGASFKF
Ga0228687_103785413300023696SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGEEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0228682_104197913300023698SeawaterAVMVASTASAFDLGNGLTAGAEVDMNYTTGVETWALEAKPELAFSTMGVGLSVGSTFDLMKLNESDSFTGLDFDASYPLGMGLTAYGEVSTDADFEFGDVKVGASFKF
Ga0232119_105127613300023702SeawaterMKLAVLATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNEDDAFKGIDFEAKYPIGMTGLEAYGEVSTDSDFEFGDVTIGASFKF
Ga0228669_101985623300024185SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0228669_102011813300024185SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGD
Ga0228602_106937113300024188SeawaterNRNKKMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0228637_105028513300024192SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVS
(restricted) Ga0233444_1016889213300024264SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPLGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0228624_100713513300024313SeawaterTAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0233400_109657513300024318SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDVKVGASF
Ga0228652_100930063300024326SeawaterAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0228631_110772013300024329SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDVKVG
Ga0209557_108613713300025483MarineMKLAVIATAATLLVATQASAIDLGNGMTVGGEVDMNYTTGTELWALEATPEVGLAMFGVDLTVGSTFDLMNLNGDDTFKGLDFSTEYAIGNTGLTGYGEVSTDSDFEFGDVKVGAKFAF
Ga0209659_118278623300025658MarineTMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0209652_100030533300025684MarineMKLAVIATAATLLVATQASAIDLGYGLTAGGEVDMNYTTGTELWALEATPEVGMGLMGAQVTVGSTFDLMNLNGDDVFKGLDFSAEYAVGTTGLTAYGEVATDSDFEFGDVKVGAKFAF
Ga0209666_134389413300025870MarineLLVATQASAFDLGNGLTAGAEIDMNYTTGVETWALEATPEVGLALMGASMTVGSTFDLMKLNENDVFSGLDFEASYPIGVTGLTAYGEVSTDSDFEFGDVKIGASFKF
Ga0247558_11752623300026390SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGA
Ga0247607_108447113300026447SeawaterMKLKIGIKKMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0247578_110669213300026458SeawaterMKLAVLATAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNDNDVFKGIDFEVEYPIGMTGLEAYGEVSTDSDFEFGDVTIGASFKF
Ga0247604_106763523300026460SeawaterAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0247602_116522523300026471SeawaterKKMKLAVLATAATLLVATQASAVDLGNGLSAGAEVDMNYTTGVGTWALEAKPEVGFSTFGAELTVGSTFDLMKLNDDDVFKGVDFEVEYPIGMTGLEAYGEVSTNSDFEFGDIKIGASFK
Ga0247571_112905013300026495SeawaterMKLKTGIKKMKLAVLATAATLLVATQASAVDLGNGLSAGAEVDMNYTTGVGTWALEAKPEVGFSTFGAELTVGSTFDLMKLNDDDVFKGVDFEVEYPIGMTGLEAYGEVSTNSDFEFGDIKIGASFKF
Ga0247592_111979913300026500SeawaterVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0247592_116751313300026500SeawaterMKLAVLATAATLLVATQASAVDLGNGLSAGAEVDMNYTTGVGTWALEAKPEVGFSTFGAELTVGSTFDLMKLNDDDVFKGVDFEVEYPIGTTGLEAYGEVSTNSDFEFGDIKIG
Ga0247590_118464813300026513SeawaterMKLAVLATAATLLVATQASAVDPGNGLSAGAEVDMNYTTGVGTWALEAKPEVGFSTFGAELTVGSTFDLMKLNDDDVFKGVDFEVEYPIGMTGLEAYGEVSTNSDFEFGDIKI
Ga0208954_102272323300027081MarineMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDVKVGASFKF
Ga0208673_107089113300027192EstuarineMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTD
Ga0209037_112275813300027612MarineTVATLLVATSASAVDLGNGLTAGAEIDMNYTTGTELWALEATPEVGLGLMGAQVTVGSTFDLMNLNGDDTFKGIDFEAKYPIGSTGLTAYGEVSTDSDFEFGNVKMGASFAF
Ga0209037_116654423300027612MarineMKLTVIAAAATMFVATQASAFDLGNGLTAGAEVDMNYTTGTELWALEATPEVGLGLLGAEVTVGSTFDLMNLNGDDTFKGLDFSAEYAVGATGLTAYGEVST
Ga0247562_100668833300028076SeawaterMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDVKVGASFKF
Ga0247586_104843923300028102SeawaterATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0247584_105817913300028110SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDADFEFGDIKVGASF
Ga0256411_127693513300028134SeawaterMKLKIGKYNETRSNRIAAVMVASTASAFDLGNGLSAGAEVDMNYTTGVETWALEATPEVGLAVMGAAVTVGSTFDLMKLNEDDAFKGIDFEAKYPIGMTGLEAYGEVSTYSDFEFGDVKIGASFKF
Ga0228646_109877613300028280SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDI
Ga0247566_108152213300028335SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEARPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPIAGTGLTAYGEVSTDTDFEFGDIKVGASFKF
Ga0233394_102907713300028391SeawaterAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0307488_1008583353300031519Sackhole BrineMKLAVIATAALMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDSDFEFGDIKVGASFKF
Ga0315331_1005349013300031774SeawaterFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGEVSTDADFEFGDIKVGASFKF
Ga0315331_1021869143300031774SeawaterMKLAVIATAAVMVASTASAFDLGNGLTAGAEVDMNYTTGVELWALEAKPELAFSTMGAALSVGSTFDLMNLNGDDTFKGLDFDASYPVGMGLTAYGDVSTDA
Ga0315320_1026862843300031851SeawaterTLLVATQASAFDLGNGLTAGAEVDMNYTTGVETWALEATPEVGLALMGASLTVGSTFDLMKLNEDDVFSGVDFEASYPIGVTGLTAYGEVSTDSDFEFGDVKIGASFKF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.