Metagenome / Metatranscriptome Family F082670

Overview

Basic Information

• Family ID: F082670
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 113
• Average Sequence Length: 38 residues
• Representative Sequence: MALSIPIISEFDGKGIDKAIKEFKQLETVGEKAQFAI
• Number of Associated Samples: 89
• Number of Associated Scaffolds: 113

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Viruses
• % of genes with valid RBS motifs: 85.45 %
• % of genes near scaffold ends (potentially truncated): 96.46 %
• % of genes from short scaffolds (< 2000 bps): 92.92 %
• Associated GOLD sequencing projects: 86
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Duplodnaviria (79.646 % of family members)
• NCBI Taxonomy ID: 2731341
• Taxonomy: All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.894 % of family members)
• Environment Ontology (ENVO): Unclassified (51.327 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (47.788 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 47.69%
  β-sheet: 0.00%
  Coil/Unstructured: 52.31%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF04860	Phage_portal	0.88

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	83.19 %
Unclassified	root	N/A	16.81 %

Level 2

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	83.19 %
Unclassified	root	N/A	16.81 %

Level 3

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	79.65 %
Unclassified	root	N/A	16.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.54 %

Level 4

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	79.65 %
Unclassified	root	N/A	16.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.54 %

Level 5

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	79.65 %
Unclassified	root	N/A	16.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.54 %

Level 6

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	79.65 %
Unclassified	root	N/A	16.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.54 %

Level 7

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	69.03 %
Unclassified	root	N/A	16.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.54 %

Level 8

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	69.03 %
Unclassified	root	N/A	16.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.54 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300002408|B570J29032_109490793	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	806
3300002465|LO132_10020640	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2864
3300002835|B570J40625_101175196	Not Available	644
3300005581|Ga0049081_10187274	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	746
3300005943|Ga0073926_10080607	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	652
3300006484|Ga0070744_10193261	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	580
3300006641|Ga0075471_10356337	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	738
3300006802|Ga0070749_10384489	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	776
3300006802|Ga0070749_10441007	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	714
3300006802|Ga0070749_10463232	Not Available	693
3300006802|Ga0070749_10763230	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514
3300006803|Ga0075467_10604327	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	560
3300006803|Ga0075467_10620193	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	552
3300006875|Ga0075473_10223271	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	761
3300006917|Ga0075472_10634816	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	536
3300007234|Ga0075460_10167145	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	760
3300007345|Ga0070752_1079486	All Organisms → Viruses → Predicted Viral	1436
3300007345|Ga0070752_1396287	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	510
3300007540|Ga0099847_1131928	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	749
3300007542|Ga0099846_1187832	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	733
3300007559|Ga0102828_1143869	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	596
3300007624|Ga0102878_1176137	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	616
3300008266|Ga0114363_1053788	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1591
3300009039|Ga0105152_10153522	Not Available	944
3300009039|Ga0105152_10165657	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	907
3300009056|Ga0102860_1177392	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	607
3300009149|Ga0114918_10367698	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	790
3300009529|Ga0114919_10564085	Not Available	782
3300010160|Ga0114967_10237367	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	961
3300010316|Ga0136655_1129593	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	756
3300010316|Ga0136655_1141832	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	718
3300010354|Ga0129333_10289392	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1468
3300010354|Ga0129333_11390763	Not Available	577
3300012017|Ga0153801_1011742	All Organisms → Viruses → Predicted Viral	1587
3300012017|Ga0153801_1097700	Not Available	518
3300013005|Ga0164292_10549997	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	751
(restricted) 3300013131|Ga0172373_10512778	Not Available	728
3300013372|Ga0177922_11248507	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	943
3300015050|Ga0181338_1069273	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	502
3300017707|Ga0181363_1065051	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	636
3300017716|Ga0181350_1090113	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	766
3300017736|Ga0181365_1014643	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1962
3300017774|Ga0181358_1029315	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2157
3300017774|Ga0181358_1234402	Not Available	584
3300017777|Ga0181357_1258117	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	603
3300017778|Ga0181349_1183883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	731
3300017778|Ga0181349_1218296	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	651
3300017780|Ga0181346_1178546	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	778
3300017784|Ga0181348_1008399	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4506
3300017784|Ga0181348_1323119	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	510
3300017785|Ga0181355_1228735	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	720
3300017785|Ga0181355_1254567	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	672
3300018682|Ga0188851_1036158	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	529
3300019784|Ga0181359_1143917	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	826
3300019784|Ga0181359_1160117	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763
3300019784|Ga0181359_1175994	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	711
3300020048|Ga0207193_1589272	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	739
3300020074|Ga0194113_10297246	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1228
3300020074|Ga0194113_10660730	Not Available	730
3300020141|Ga0211732_1034867	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1319
3300020220|Ga0194119_10513362	Not Available	753
3300020221|Ga0194127_10576110	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	720
3300020556|Ga0208486_1063758	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	524
3300020578|Ga0194129_10610779	Not Available	508
3300021376|Ga0194130_10252470	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1007
3300021952|Ga0213921_1025996	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	957
3300021963|Ga0222712_10232495	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1189
3300022053|Ga0212030_1045374	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	622
3300022176|Ga0212031_1062446	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	631
3300022179|Ga0181353_1009995	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2370
3300022190|Ga0181354_1132141	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	794
3300022190|Ga0181354_1167383	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	677
3300024346|Ga0244775_10330178	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1262
3300024348|Ga0244776_10276971	All Organisms → Viruses → Predicted Viral	1156
3300025655|Ga0208795_1145719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	596
3300025671|Ga0208898_1117491	Not Available	774
3300025671|Ga0208898_1158800	Not Available	600
3300025887|Ga0208544_10333501	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	581
3300027140|Ga0255080_1067466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	546
3300027488|Ga0255084_1047054	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	781
3300027601|Ga0255079_1062424	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	772
3300027683|Ga0209392_1184829	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	639
3300027697|Ga0209033_1217494	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	564
3300027707|Ga0209443_1294093	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	541
3300027732|Ga0209442_1296883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	559
3300027782|Ga0209500_10314691	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	658
3300027782|Ga0209500_10409910	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	543
3300027797|Ga0209107_10404525	Not Available	622
3300027798|Ga0209353_10071722	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1576
3300027798|Ga0209353_10328174	Not Available	643
3300027808|Ga0209354_10400247	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	534
3300027917|Ga0209536_103096918	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	533
3300031539|Ga0307380_11078021	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	634
3300031951|Ga0315904_10943920	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	691
3300032118|Ga0315277_11064544	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	732
3300032173|Ga0315268_11020512	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	834
3300033981|Ga0334982_0282566	Not Available	787
3300033993|Ga0334994_0150096	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1311
3300034013|Ga0334991_0311803	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	633
3300034062|Ga0334995_0607211	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	634
3300034062|Ga0334995_0628673	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	618
3300034071|Ga0335028_0573805	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	611
3300034092|Ga0335010_0532364	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	610
3300034105|Ga0335035_0581777	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	596
3300034122|Ga0335060_0330421	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	825
3300034167|Ga0335017_0421083	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	720
3300034200|Ga0335065_0258026	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1115
3300034272|Ga0335049_0132279	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1796
3300034356|Ga0335048_0077703	All Organisms → Viruses → Predicted Viral	2051
3300034356|Ga0335048_0590822	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	516

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.23%
Terrestrial	Environmental → Terrestrial	1.77%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	65.49%
Marine	Environmental → Aquatic → Marine	32.74%
Soil	Environmental → Terrestrial → Soil	1.77%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	30.97%
Lentic	Environmental → Aquatic → Freshwater → Lentic	28.32%
Coastal	Environmental → Aquatic → Marine → Coastal	23.01%
Oceanic	Environmental → Aquatic → Marine → Oceanic	3.54%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.54%
River	Environmental → Aquatic → Freshwater → River	2.65%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.65%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.89%
Microbialites	Environmental → Aquatic → Freshwater → Microbialites	0.89%
Creek	Environmental → Aquatic → Freshwater → Creek	0.89%
Sand	Environmental → Terrestrial → Soil → Sand	0.89%
Clay	Environmental → Terrestrial → Soil → Clay	0.89%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	26.55%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	26.55%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	23.01%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.42%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	3.54%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	3.54%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	2.65%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.65%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.89%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Microbialites → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.89%

Habitat

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	23.89%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	19.47%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	14.16%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	5.31%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.54%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	3.54%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	3.54%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.65%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	2.65%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	2.65%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.77%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.77%
Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment	1.77%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	1.77%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.89%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.89%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.89%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.89%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	0.89%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.89%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.89%
Freshwater Lake	Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake	0.89%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.89%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	0.89%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.89%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.89%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.89%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental
3300002465	Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy	Environmental
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental
3300005943	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14	Environmental
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental
3300006803	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA	Environmental
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental
3300007234	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA	Environmental
3300007345	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30	Environmental
3300007540	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG	Environmental
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental
3300007624	Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02	Environmental
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental
3300009039	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm	Environmental
3300009056	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3	Environmental
3300009149	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG	Environmental
3300009529	Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG	Environmental
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental
3300010316	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA	Environmental
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental
3300018682	Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1	Environmental
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental
3300020220	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m	Environmental
3300020221	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m	Environmental
3300020556	Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes)	Environmental
3300020578	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m	Environmental
3300021376	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface	Environmental
3300021952	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG	Environmental
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental
3300022053	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)	Environmental
3300022176	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)	Environmental
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental
3300022200	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)	Environmental
3300024346	Whole water sample coassembly	Environmental
3300024348	0.2um to 3um size fraction coassembly	Environmental
3300025655	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)	Environmental
3300025671	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)	Environmental
3300025887	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)	Environmental
3300027140	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h	Environmental
3300027488	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d	Environmental
3300027601	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h	Environmental
3300027683	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental
3300027707	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)	Environmental
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental
3300034013	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034	Environmental
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental
3300034105	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127	Environmental
3300034122	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181	Environmental
3300034167	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082	Environmental
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental
3300034356	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29032_1094907933	3300002408	Freshwater	MISIPIVSQFDSKGIKSAIREFKQLETVGQKAQFAIKKA
LO132_100206401	3300002465	Freshwater Lake	MGLSIPIIAEYDGKGIDKAIKDFKQLETAGEKAQFLIKKAA
B570J40625_1011751961	3300002835	Freshwater	MAVYIPIVSEFNSKGIDKAIKEFNSLESVGAKANFALKKA
Ga0049081_101872741	3300005581	Freshwater Lentic	MALSIPIISEFDGKGLDRAIKEFKQLETVGEKAQFAIRKA
Ga0073926_100806071	3300005943	Sand	MAISIPVISDFDSKGTDRAIREFQKLETAGQKAQFAIGKA
Ga0070744_101932612	3300006484	Estuarine	MALSIPIISEFDGKGIDKAIKEFKQLETAGEKAHFLIKKAAI
Ga0075471_103563371	3300006641	Aqueous	MALSIPIISEFDGKGLDRAIKEFKQLETVGEKAQFAI
Ga0070749_103844891	3300006802	Aqueous	MAVTIPIISEFDGKGIKSAIAEFKQLETTGQKAQFALKKSFVPA
Ga0070749_104410071	3300006802	Aqueous	MAINIPIISEFDGKGIKKAIAQFKQLETTGEKAQFAIKK
Ga0070749_104632323	3300006802	Aqueous	MAVTIPIITEFADKGIKSAIAEFKQLETTGQKAQF
Ga0070749_107632301	3300006802	Aqueous	MALSIPIVSEFDGKGIDKAIKEFKQLETVGEKAQFAIKK
Ga0075467_106043272	3300006803	Aqueous	VAIRIPIISEFDDKGLARATRQFKDLETTGQKAQFAIQKAA
Ga0075467_106201931	3300006803	Aqueous	MAINIPIISEFDGTGVKKAVKQFQQLETVGEKAQF
Ga0075473_102232711	3300006875	Aqueous	MALSIPIISEFDGKGIDKAIKEFKQLETAGEKAQFAIKK
Ga0075473_102918761	3300006875	Aqueous	MSLSIPIISEFDGTGVKKAIAQFNDLEGAGAKAGFAL
Ga0075472_106348162	3300006917	Aqueous	MAISIPIISEFADTGVKKAIAQFKQLETTGEKAQFALKKAAI
Ga0075460_101671452	3300007234	Aqueous	MALSIPIVSEFDGKGIDKAIKEFKQLETAGEKAQFAIKK
Ga0070752_10794864	3300007345	Aqueous	MAVSIPIITEFEGKGIKKAIAEFKQLETTGQKAQFALKKAA
Ga0070752_13962872	3300007345	Aqueous	MSIRIPIISEFDGTGIDRAAKQFANLETKGEKAGFVLKKAFLPA
Ga0099847_11319282	3300007540	Aqueous	MALSIPIVSEFDGKGINKVIKEFKQLETAGEKAQFAI
Ga0099846_11878322	3300007542	Aqueous	MALSIPIISEFDGKGIDKAIKEFKQLETAGEKAQFA
Ga0102828_11438691	3300007559	Estuarine	MISIPIVSQFSDAGIKSAIKQFKQLKTTSEKAQFAIKKAA
Ga0102878_11761371	3300007624	Estuarine	MALSIPIISEFDGKGIDKAIKEFQQLETVGEKAQFA
Ga0114363_10537884	3300008266	Freshwater, Plankton	MAVTIPILTEFVGAGVDKAIAQFKQLETTGQKAQFAIKK
Ga0105152_101535223	3300009039	Lake Sediment	MAVIIPIISEFDGKGLNKAIKEFQQLETSGEKAQFA
Ga0105152_101656571	3300009039	Lake Sediment	MISIPIISQFDSKGIKSAIKQFKQLETTSEKAQFAIKKAAI
Ga0102860_11773922	3300009056	Estuarine	MLSIPIISEFDGKGIDKAIKQFKQLETVGEKAQFAIKK
Ga0114918_103676981	3300009149	Deep Subsurface	MAIRIPIISEFDSKGINRAKKEFAQLKTSGEKAQFALKKAAL
Ga0114918_106937532	3300009149	Deep Subsurface	MAVSLPIISEFNGKGIKKAVAEFKQLEGAGKKAQF
Ga0114919_105640851	3300009529	Deep Subsurface	MAIRIPIISEFDSKGINRAKKEFAQLKTTGEKAQFA
Ga0114967_102373673	3300010160	Freshwater Lake	MAITIPIISEFDGKGINKAIAQFKQLETNGQKAQF
Ga0136655_11295933	3300010316	Freshwater To Marine Saline Gradient	MAINIPIISEFDGTGTKKAIAQFKQLETTSEKANF
Ga0136655_11418321	3300010316	Freshwater To Marine Saline Gradient	MAIRIPIISEFDSKGIDRAKKEFAQLKTSGEKAQFALKKAA
Ga0129333_102893921	3300010354	Freshwater To Marine Saline Gradient	MAVFIPIISEFNSKGIDKAKKEFASLEGVGQKAQFALKKAAV
Ga0129333_113907632	3300010354	Freshwater To Marine Saline Gradient	MAVTIPIISEFDGKGIGRALEEFKQLEGVGAKAQFALKK
Ga0153801_10117421	3300012017	Freshwater	MAVSIPIVTEFDGKGISKAMAEFKQLEGAGAKSAF
Ga0153801_10977002	3300012017	Freshwater	MAVYIPIVSEFNSKGIDKAIKEFNSLETVGAKANFA
Ga0164292_105499971	3300013005	Freshwater	MALSIPIVSEFDGKGIDKAIKEFKQLETVGEKAQFAIRKAA
(restricted) Ga0172373_105127781	3300013131	Freshwater	MALGVNILSEFDSRGIEKAIREFSKLETTGEKAQFAI
Ga0177922_112485073	3300013372	Freshwater	MAISIPIVSEFDGKGVSKAIAQFKQLETTGEKAQFALK
Ga0181338_10692732	3300015050	Freshwater Lake	MALSIPIVSEFDGKGIDKAIKEFKQLETVGEKAQFAIRKAAIP
Ga0181363_10650512	3300017707	Freshwater Lake	MAINIPIISEFEGKGIKKAIAQFKQLETTSEKAQFA
Ga0181350_10901131	3300017716	Freshwater Lake	MISIPIVSQFSDAGIKSAIKQFKQLETTSEKAQFAIK
Ga0181365_10146431	3300017736	Freshwater Lake	MALSIPIISEFDGKGISKAVAEFKQLEGAGAKAFS
Ga0181358_10293151	3300017774	Freshwater Lake	MALSIPIISEFDGKGVDRAVKEFQQLEGVANKTGH
Ga0181358_12344021	3300017774	Freshwater Lake	MASVLLPIVSEFDGKGVAKAIKQFQQLETVGAKAQFAIKKAA
Ga0181357_12581171	3300017777	Freshwater Lake	MALSIPIISEFDGKGIDKAIKEFKQLETAGEKAHFLIKKAA
Ga0181349_11838833	3300017778	Freshwater Lake	MLSIPIISEFDGKGIDKAIKEFKQLETVGEKAQFA
Ga0181349_12182962	3300017778	Freshwater Lake	MALSIPIISEYDGKGISKAIAEFKQLETAGEKAQFAIKK
Ga0181346_11785461	3300017780	Freshwater Lake	MALTIPIIAEYDGKGLDKAIKQFSQLEGAGAKSGFAL
Ga0181348_10083991	3300017784	Freshwater Lake	MGLSIPIVAEFDGKGIDKAIKEFQQLETAGEKAQFAI
Ga0181348_13231192	3300017784	Freshwater Lake	MALSIPIISEFDGKGIDKAIKEFKQLETVGEKAQFAI
Ga0181355_12287351	3300017785	Freshwater Lake	MALSIPIVSEFDGKGIDRAIREFKQLETVGEKAQFAIK
Ga0181355_12545672	3300017785	Freshwater Lake	MLSIPIISEFDGKGIDKAIKEFKQLETVGEKAQFAIKK
Ga0188851_10361581	3300018682	Freshwater Lake	MALSIPIISEFQDKGIKKAIAEFKQLETTGKKAQFAL
Ga0181359_11439171	3300019784	Freshwater Lake	MAINIPIISEFDGKGISKAVQEFKQLETAGEKAQFAIN
Ga0181359_11601171	3300019784	Freshwater Lake	MALSIPIVSEFDGKGIDKAIKEFKQLETVGEKAQFAIR
Ga0181359_11759942	3300019784	Freshwater Lake	MASVLLPIVSEFDGKGVAKAIKQFQQLETVGAKAQFAIK
Ga0207193_15892723	3300020048	Freshwater Lake Sediment	MALSIPIISEFDGKGIDKAIKEFQQLETAGEKAQFAIKK
Ga0194113_102972464	3300020074	Freshwater Lake	MALSIPIISEFDGKGIDKAITEFKQLETVGEKAQFAI
Ga0194113_106607302	3300020074	Freshwater Lake	MAVVIPIVSEFDGKGLSRAITEFKQLEGAGEKAQFALKKAA
Ga0211732_10348671	3300020141	Freshwater	MASVNIPIISEFDAKGTQRAIKEFQSLEGASKKAQFAIKKAA
Ga0194119_105133621	3300020220	Freshwater Lake	MAVVIPIVSEFDGKGLSRAITEFKQLEGAGEKAQF
Ga0194127_105761103	3300020221	Freshwater Lake	MALSIPIVSEFDGKGIDKAIKEFKQLETVGEKAQFF
Ga0208486_10637582	3300020556	Freshwater	MAVNIPIISEFDGSGIKKAISQFKDLETNGQKAQFA
Ga0194129_106107791	3300020578	Freshwater Lake	MAVVIPIVSEFDGKGLSRAITEFKQLEGAGEKAQFALKKA
Ga0194130_102524703	3300021376	Freshwater Lake	MALSIPIVSEFDGKGIDKAIKEFKQLETVGEKAQFAI
Ga0213921_10259961	3300021952	Freshwater	MAVVLPIVSEFDGKGIKKAIKQFNDLETTSEKAQFAIKKAA
Ga0222712_102324954	3300021963	Estuarine Water	MGLSIPIVAEYDGKAVDKAIKQFQQLEGAGAKTSF
Ga0212030_10453742	3300022053	Aqueous	MALSIPIISEFQDKGIKKAIAEFKQLETTGKKAQFALKK
Ga0212031_10624461	3300022176	Aqueous	MAVTIPIISEFDGKGINRAIAEFKQLETTGEKAQY
Ga0181353_10099951	3300022179	Freshwater Lake	MAINIPIITEYVGAGVDKAIREFKQLETVGEKAQFA
Ga0181354_11321411	3300022190	Freshwater Lake	MISIPIVSQFDSKGIKSAIKQFKQLETTSEKAQFA
Ga0181354_11673832	3300022190	Freshwater Lake	VALSIPIISEFDGKGISRAIAQFKNLETVGEKTQFA
Ga0196901_11273741	3300022200	Aqueous	MSVVLPIVTEFNSKGIDRAVKEFQSLEGAGKKAQFA
Ga0244775_103301781	3300024346	Estuarine	MALSIPIISEFDGKGIDRAIKEFKSLETAGEKAHFAIGKAAIP
Ga0244776_102769711	3300024348	Estuarine	MALSIPIVSEFDGKGIDKAIKEFQQLETVGEKAQFA
Ga0208795_11457191	3300025655	Aqueous	MALSIPIVSEFDGKGIDKAIKEFKQLETAGEKAQFAI
Ga0208898_11174911	3300025671	Aqueous	MAIRIPIVSDFDSKGIERAKKEFAQLTTVGQKAQFA
Ga0208898_11588001	3300025671	Aqueous	MAVSIPIITEFEGKGLKKAIAEFKQLETTGQKAQFALKK
Ga0208544_103335011	3300025887	Aqueous	MAINIPIISEFDGTGVKKAVKQFQQLETVGEKAQFA
Ga0255080_10674662	3300027140	Freshwater	MAISIPIISEFDGKGVQKAVKQFKQLETTGEKAQFALKKAAI
Ga0255084_10470542	3300027488	Freshwater	MISIPIISDFNDKGIKSAIREFKQLETVGQKAQFAIK
Ga0255079_10624241	3300027601	Freshwater	MAISIPIISEFDGKGVQKAVKQFKQLETTGEKAQFA
Ga0209392_11848291	3300027683	Freshwater Sediment	MAINIPIISEFDGKGIEKAVKQFKQLETTSEKAQFAIKK
Ga0209033_12174942	3300027697	Freshwater Lake	MALSIPIVSEFDGKGIDKAIKEFKQLETVGEKAQFAIK
Ga0209443_12940931	3300027707	Freshwater Lake	MLSIPIISEFDGKGINKAIKEFKQLETAGEKAQFAIK
Ga0209442_12968831	3300027732	Freshwater Lake	MISIPIVSQFDSKGIKSAIREFKQLETVGQKAQFAIKK
Ga0209500_103146912	3300027782	Freshwater Lake	MALSIPIISEYDGKGISRAIAEFKNLETAGEKAQFAIKK
Ga0209500_104099102	3300027782	Freshwater Lake	MALSIPIISEYDGKGISRAIAEFKQLETAGEKAQFA
Ga0209107_104045252	3300027797	Freshwater And Sediment	MAVVIPIISEFDGKGLNKAIKEFKQLETSGEKAQFA
Ga0209353_100717221	3300027798	Freshwater Lake	MLSIPIISEFDGKGIDKAIREFKQLETAGEKAQFAIK
Ga0209353_103281741	3300027798	Freshwater Lake	MASVLLPIVSEFDGKGVAKAIKQFQQLETVGEKAQF
Ga0209354_104002471	3300027808	Freshwater Lake	VALSIPIISEFDGKGISRAIAQFKNLETVGEKTQFAIKKAAI
Ga0209536_1030969181	3300027917	Marine Sediment	MAVVLPIVSEFDGRGIKKAIAQFKQLETTSEKDQFAIKKA
Ga0307380_110780212	3300031539	Soil	MALTIPIISEFGDKGIKRAIAEFKQLKTTGEKAQFAIKKAA
Ga0315904_109439201	3300031951	Freshwater	MAVSLPIVSEFDGTGIKKAIAEFKQLETTGEKAQFAL
Ga0315277_110645441	3300032118	Sediment	MALSIPIISEFDGKGLDRAIKEFKQLETVGEKAQFAIKK
Ga0315268_110205122	3300032173	Sediment	MASVLLPIVSEFDGKGVAKAIKQFQQLETVGEKAQFELKKLPFLPLPR
Ga0334982_0282566_2_121	3300033981	Freshwater	MAVYIPIVSEFNSKGIDKAIKEFNSLETVGAKANFALKKA
Ga0334994_0150096_1_111	3300033993	Freshwater	VAITIPIITEFAGAGIDKAVQQFKQLETTGEKAQFAI
Ga0334991_0311803_520_633	3300034013	Freshwater	MAINIPIISEFDGKGIKKAIAQFKQLETTSEKAQFAIK
Ga0334995_0607211_528_632	3300034062	Freshwater	MAINIPIISEFDGKGIKKAIAQFKQLETTSEKAQF
Ga0334995_0628673_511_618	3300034062	Freshwater	MAISIPVISDFNSKGIDSAIREFKKLETAGEKAQFA
Ga0335028_0573805_495_611	3300034071	Freshwater	MAISIPIISEFDGKGVSKAIAQFKQLETTGEKAQFALKK
Ga0335010_0532364_1_114	3300034092	Freshwater	MAISIPIISEFDGKGIDKALQQFKQLETAGEKAQFAIK
Ga0335035_0581777_477_596	3300034105	Freshwater	MALSIPIVSEFDGKGIDKAIKEFKQLETVGEKAQFAIKKT
Ga0335060_0330421_2_115	3300034122	Freshwater	MAISIPIVSEFNAKGIDKAVREFQKLETAGQKAQFVLQ
Ga0335017_0421083_3_119	3300034167	Freshwater	MTIAIPIITEFNGAGIDKAVKEFKNLETNGEKAQFAIKK
Ga0335065_0258026_1001_1114	3300034200	Freshwater	MAVFIPIISEFDSKGIDKAKKEFASLEGAGAKAQFAIK
Ga0335049_0132279_1690_1794	3300034272	Freshwater	MALSIPIISEFQGGGVDKAIKQFQQLDGVGAKTGF
Ga0335048_0077703_1935_2051	3300034356	Freshwater	MLSIPIIAEYDGKALDRAITQFKQLETVGAKTQFAIKKA
Ga0335048_0590822_3_119	3300034356	Freshwater	MAINIPIISDFDGKGIDKAIKEFQQLETAGEKAQFAIKK