| Basic Information | |
|---|---|
| Family ID | F082662 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 50 residues |
| Representative Sequence | ELLTLYSTTSSLAALPPDERAALFARVRPLLAGPYRLPLRHELTWTRLSR |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.85 % |
| % of genes near scaffold ends (potentially truncated) | 94.69 % |
| % of genes from short scaffolds (< 2000 bps) | 92.92 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.956 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.354 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.513 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.62% β-sheet: 0.00% Coil/Unstructured: 65.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13450 | NAD_binding_8 | 21.24 |
| PF10604 | Polyketide_cyc2 | 4.42 |
| PF14520 | HHH_5 | 1.77 |
| PF02371 | Transposase_20 | 0.88 |
| PF01896 | DNA_primase_S | 0.88 |
| PF05147 | LANC_like | 0.88 |
| PF00211 | Guanylate_cyc | 0.88 |
| PF01636 | APH | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.88 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.96 % |
| Unclassified | root | N/A | 15.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_13971362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300004114|Ga0062593_103229107 | Not Available | 522 | Open in IMG/M |
| 3300004153|Ga0063455_100463094 | Not Available | 774 | Open in IMG/M |
| 3300005329|Ga0070683_100160891 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
| 3300005329|Ga0070683_100552872 | Not Available | 1101 | Open in IMG/M |
| 3300005338|Ga0068868_101058736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
| 3300005365|Ga0070688_101796168 | Not Available | 503 | Open in IMG/M |
| 3300005366|Ga0070659_100795722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 822 | Open in IMG/M |
| 3300005437|Ga0070710_10440481 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005437|Ga0070710_11479970 | Not Available | 510 | Open in IMG/M |
| 3300005440|Ga0070705_101361558 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005445|Ga0070708_100280673 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300005456|Ga0070678_100603769 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005456|Ga0070678_102111104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300005459|Ga0068867_101712211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300005545|Ga0070695_100313292 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300005549|Ga0070704_101914914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300005549|Ga0070704_101972386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300005560|Ga0066670_10854422 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005569|Ga0066705_10908336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300005713|Ga0066905_100392767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1122 | Open in IMG/M |
| 3300005713|Ga0066905_101955031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300005764|Ga0066903_106593199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300005764|Ga0066903_108313025 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006572|Ga0074051_11792885 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300006574|Ga0074056_11697395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300006581|Ga0074048_10053954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300006854|Ga0075425_103027321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300006854|Ga0075425_103027325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300006871|Ga0075434_101977013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300006880|Ga0075429_100739394 | Not Available | 862 | Open in IMG/M |
| 3300006881|Ga0068865_100302930 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300006904|Ga0075424_102746650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300006969|Ga0075419_10131123 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300009094|Ga0111539_11898519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300009098|Ga0105245_12131399 | Not Available | 614 | Open in IMG/M |
| 3300009137|Ga0066709_102167094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300009137|Ga0066709_103272217 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009156|Ga0111538_13857770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300009156|Ga0111538_13858512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300009162|Ga0075423_11130468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300009162|Ga0075423_11370520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300009840|Ga0126313_10236946 | Not Available | 1412 | Open in IMG/M |
| 3300010038|Ga0126315_11175811 | Not Available | 520 | Open in IMG/M |
| 3300010046|Ga0126384_12231004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300010047|Ga0126382_12180368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300010301|Ga0134070_10199108 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300010320|Ga0134109_10386815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300010326|Ga0134065_10260634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300010360|Ga0126372_12164424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300010361|Ga0126378_10546036 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300010373|Ga0134128_10851016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1010 | Open in IMG/M |
| 3300010398|Ga0126383_12184690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300012198|Ga0137364_10207408 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300012350|Ga0137372_11076169 | Not Available | 554 | Open in IMG/M |
| 3300012360|Ga0137375_10943872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300012495|Ga0157323_1023952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300012882|Ga0157304_1014066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 939 | Open in IMG/M |
| 3300012895|Ga0157309_10104925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
| 3300012900|Ga0157292_10126833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300012907|Ga0157283_10288204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300012912|Ga0157306_10351972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300012914|Ga0157297_10024548 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300012914|Ga0157297_10530904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300012951|Ga0164300_10872439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300012985|Ga0164308_10663553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 895 | Open in IMG/M |
| 3300012987|Ga0164307_11758375 | Not Available | 525 | Open in IMG/M |
| 3300012988|Ga0164306_10733109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
| 3300013096|Ga0157307_1106612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300013306|Ga0163162_10633306 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300014166|Ga0134079_10357534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300014325|Ga0163163_11607268 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300014745|Ga0157377_10509801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 842 | Open in IMG/M |
| 3300015200|Ga0173480_10160467 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300015372|Ga0132256_102587524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300015373|Ga0132257_102201080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300015374|Ga0132255_102962351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300015374|Ga0132255_104067485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300017939|Ga0187775_10019483 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300017966|Ga0187776_10076724 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300018029|Ga0187787_10460977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300018061|Ga0184619_10187335 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300018075|Ga0184632_10203791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
| 3300018482|Ga0066669_10670912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 912 | Open in IMG/M |
| 3300019356|Ga0173481_10008181 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
| 3300021415|Ga0193694_1026178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
| 3300021560|Ga0126371_11044162 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300025898|Ga0207692_10370680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300025934|Ga0207686_10997315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300025945|Ga0207679_10788969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 866 | Open in IMG/M |
| 3300025981|Ga0207640_11816035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300026009|Ga0208530_1021288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300026818|Ga0207634_103480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300027775|Ga0209177_10368606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300028293|Ga0247662_1061984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300028592|Ga0247822_11622765 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300028714|Ga0307309_10203555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300028717|Ga0307298_10175129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300028721|Ga0307315_10146721 | Not Available | 715 | Open in IMG/M |
| 3300028721|Ga0307315_10283203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300028793|Ga0307299_10079406 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300028793|Ga0307299_10264323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300028799|Ga0307284_10394539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300028811|Ga0307292_10462603 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031740|Ga0307468_102366690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300031995|Ga0307409_100048436 | All Organisms → cellular organisms → Bacteria | 3234 | Open in IMG/M |
| 3300033004|Ga0335084_10714471 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300034090|Ga0326723_0326252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026009 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
| 3300026818 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_139713622 | 3300000363 | Soil | VDAERLLALYSTTSSLAALESADREALLAGVRPLLAGPYRLPIKHELSWTRLV* |
| Ga0062593_1032291071 | 3300004114 | Soil | LDLYSTTSSLAAIPHEERAALFAAVRPELAGPYRLPIRHELTWTRRAP* |
| Ga0063455_1004630942 | 3300004153 | Soil | DPDALLELYSTTSSLAALPHAERNALFGRVRPLLSGRYRLPIKYELAWTRLAG* |
| Ga0066809_100692501 | 3300005168 | Soil | RADEELTVDPDGLLRLYSTTSSLAALTVDERAALLARVRPQLEGPYRLPLRHELTWTRLSR* |
| Ga0070683_1001608913 | 3300005329 | Corn Rhizosphere | DELLTLYSTTSALASLPPNEREELFDRVRPLLAGPYRLPLKHELTWTRLA* |
| Ga0070683_1005528722 | 3300005329 | Corn Rhizosphere | LLTLYSTTSALATLPVDEREELFDQVRPLLAGPYLLPLKHDLKWTRLAA* |
| Ga0068868_1010587361 | 3300005338 | Miscanthus Rhizosphere | VLELYSTTSSLAAISRKEREQLFTAVRPLLAGPYTLPLKHELTWTRLV* |
| Ga0070688_1017961681 | 3300005365 | Switchgrass Rhizosphere | TTSSLAALDRGEREALFAEVRALLSGSYRLPLKHELTWTRLAP* |
| Ga0070659_1007957221 | 3300005366 | Corn Rhizosphere | TLYSTTSSLAALGGDERDALFARVRPLLAGPYLLPLKHELTWTRLAV* |
| Ga0070710_104404813 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DELLELYSTTSSLAALAPDEREDLFARVRALLDRDYRLPLRHELTWTRLN* |
| Ga0070710_114799702 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DELLELYSTTSSLAAISSGERSELFAQVRALLGGAYRLPIKYELAWTRLA* |
| Ga0070705_1013615581 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IAIGPDDLLELYSTTSSLAALEPDERAALFANVRPLLGSEYVLPIKHELTWTRLAR* |
| Ga0070708_1002806733 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YSTTSSLAAISREEREALFAAVRPLVAGPYRLPLNHELTWTRLV* |
| Ga0070678_1006037691 | 3300005456 | Miscanthus Rhizosphere | DELLTLYSTTSALATLSTDEREALFGRIRPLLAGPYRLPLKHELTWTRLAA* |
| Ga0070678_1021111041 | 3300005456 | Miscanthus Rhizosphere | DELLTLYSTTSALATLPADEREALFSRVRPLLAGPYRLPLKHDLTWTKLAA* |
| Ga0068867_1017122111 | 3300005459 | Miscanthus Rhizosphere | AMVVEPDELLELYSTTSSLAAIPREEREAIFAEVRPLLAGPYRLPLKHELTWTRLA* |
| Ga0070706_1001689781 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SERFEEDVTVDADALLELYSTTSSLAALPRDERAVLFAEVRAQLGGPYRLPIRHELTWTRLA* |
| Ga0070695_1003132922 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DPDELLTLYSTTSSFASLPPNERDALVDCVRPMLAGPYRLPLKHELTWTRLAT* |
| Ga0070704_1019149141 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | DDLLTLYSTTSALATLPPDEREALFARVRPLLTGPYRLPLKHDLTWTRLAA* |
| Ga0070704_1019723861 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | SSFASLSTNEREALFVRVRPLLAGPYRLPLKHDLTWTRLAA* |
| Ga0066670_108544221 | 3300005560 | Soil | TVAPDMLLAMYSTQSSFAVLPDDERTELFERVRPLLAGSYRLPIKHELTWTRLRAGG* |
| Ga0066705_109083362 | 3300005569 | Soil | STTSSLAALPRDERAGLLAALRPLLAGPYRLPIKHELVWTRLA* |
| Ga0066905_1003927672 | 3300005713 | Tropical Forest Soil | TLLTLYSTTSSLAALPPEERVALFERVRPFLSGPYGLPLRHELVWTRLIR* |
| Ga0066905_1019550312 | 3300005713 | Tropical Forest Soil | DDLLTLYSTTSALATLPPFEREELFGQVRPLLEGPYRLPLKHDLKWTRLAA* |
| Ga0066903_1065931992 | 3300005764 | Tropical Forest Soil | FEDETTVDADRLLALYSTTSSCAALAADERRALFAAVRPLLAGPYRLPIKHELCWTRLA* |
| Ga0066903_1083130252 | 3300005764 | Tropical Forest Soil | EEAVELETDRLLELYSTTSSLAALSPEERAALFARVRPLLEDAYRLPVKHELAWTRLA* |
| Ga0074051_117928851 | 3300006572 | Soil | ELLTLYSTTSSLAALPPDERAALFARVRPLLAGPYRLPLRHELTWTRLSR* |
| Ga0074056_116973952 | 3300006574 | Soil | TTSSLAALTVDERAALLARVRPQLEGPYRLPLRHELTWTRLSR* |
| Ga0074050_120949462 | 3300006577 | Soil | ERADEELTVDPDGLLRLYSTTSSLAALTVDERAALLARVRPQLEGPYRLPLRHELTWTRLSR* |
| Ga0074048_100539542 | 3300006581 | Soil | ALLALYSTTSSLAALPPDERTALFAGVRPHLTGPYRLPLRHELVWTRLA* |
| Ga0075425_1030273212 | 3300006854 | Populus Rhizosphere | TTSSLAALPPEERASLFERVRPLLAGPYRLPLRHELVWTRLAR* |
| Ga0075425_1030273252 | 3300006854 | Populus Rhizosphere | TTSSLAALPPEERASLFERVRPLLAGPYRLPLRHELVWTRLARCATS* |
| Ga0075434_1019770132 | 3300006871 | Populus Rhizosphere | LPPEERASLFERVRPLLAGPYRLPLRHELVWTRLAR* |
| Ga0075429_1007393941 | 3300006880 | Populus Rhizosphere | LYSTTSSLAALPHEERAALFAAVRPELAGPYRLPIRHELTWTRRAP* |
| Ga0068865_1003029301 | 3300006881 | Miscanthus Rhizosphere | TSSLAAISREEREQLFAAVRPSLAGPYSLPLKHELTWTRLV* |
| Ga0075424_1027466502 | 3300006904 | Populus Rhizosphere | TTSSLAALPPEERASLFERVRPLLAGPYRLPLRHELVWTRLDR* |
| Ga0075419_101311233 | 3300006969 | Populus Rhizosphere | DDETLLTLYSTTSSLAALPPEERASLFERVRPLLAGPYRLPLRHELVWTRLARCATS* |
| Ga0111539_118985192 | 3300009094 | Populus Rhizosphere | LYSTTSALATLAPNEREALFARVRPLLAVSYRLPLKHELTWTRLAA* |
| Ga0111539_130480771 | 3300009094 | Populus Rhizosphere | ERFEEEMTVDVDTLLDLYSTTSSLAALPHEERAALFAAVRPELAGPYRLPIRHELTWTRRAS* |
| Ga0105245_121313992 | 3300009098 | Miscanthus Rhizosphere | ELYSTTSSLAATAADERTALFAQVRPLLLDVYRLPIKHELTWTRLAR* |
| Ga0066709_1021670941 | 3300009137 | Grasslands Soil | TVDPDLLLAMYSTTSSFAVLPDDERTALFDRVRPLLAGPYRLPIKHELTWTRLCGD* |
| Ga0066709_1032722172 | 3300009137 | Grasslands Soil | ADTLLELYSTTSSLAALPHDERALLFAQVRAQLGGPYRLPIRHELTWTRLA* |
| Ga0111538_138577702 | 3300009156 | Populus Rhizosphere | STTSSLAALPPEERASLFERVRPLLAGPYRLPLRHELVWTRLAR* |
| Ga0111538_138585122 | 3300009156 | Populus Rhizosphere | STTSSLAALPPEERASLFERVRPLLAGPYRLPLRHELVWTRLARCATS* |
| Ga0075423_111304681 | 3300009162 | Populus Rhizosphere | LASLSPVDRATLIADVRPLLAGPYRLPLKHELWWTRLIG* |
| Ga0075423_113705202 | 3300009162 | Populus Rhizosphere | YSTTSSLALLPAEEREALFAQVRPLLGDSYRLPLKHELTWTRLK* |
| Ga0126313_102369462 | 3300009840 | Serpentine Soil | SSLAALPHDERNALFARVRPLLYGHYRLPTKSELAWTRLVR* |
| Ga0126315_111758111 | 3300010038 | Serpentine Soil | LYSTTSSLAALPHHERNALFARVRPLLSGRYRLPTKSELAWTRLVR* |
| Ga0126384_122310042 | 3300010046 | Tropical Forest Soil | EITLDPDDLLTLYSTTSALATLPPVEREELFGQVRPLLEGHYRLPLKHDLKWTRLAA* |
| Ga0126382_121803681 | 3300010047 | Tropical Forest Soil | EITIDSDDLLTLYSTTSALATLPANEREALFARVRPLLAGPYRLPLKHDLTWTRLPA* |
| Ga0134070_101991082 | 3300010301 | Grasslands Soil | MDGELRIDTETLLTLYSTTSALATLPAEECTALFARVRPLLAASYRLPLRHELTWTRLA* |
| Ga0134109_103868151 | 3300010320 | Grasslands Soil | MYSTTSSLAAISREEREALFAAVRPLLAGRYRLPLKHELTWTRLA* |
| Ga0134065_102606342 | 3300010326 | Grasslands Soil | DELLELYSTTSSLAAISPKEREALFAAVRPLLKGPYRLPLKHELTWTRLA* |
| Ga0126372_121644241 | 3300010360 | Tropical Forest Soil | TTSALATLSPFERDELFGQVRPLLGGPYRLPLKHDLKWTRLAA* |
| Ga0126378_105460363 | 3300010361 | Tropical Forest Soil | EDETTVDADRLLALYSTTSSCAALAADEREALFAAVRPHLAGPYRLPIKHELCWTRLA* |
| Ga0134128_108510161 | 3300010373 | Terrestrial Soil | ITVGVDELLTLYSTTSSLAAIGDDEREALFARVRPLLAGPYRLPLKHELTWTRLV* |
| Ga0126383_121846902 | 3300010398 | Tropical Forest Soil | YSTTSALAALPHDERAALFARVRPLLGGTYRLPIKGELAWTRLAR* |
| Ga0137364_102074084 | 3300012198 | Vadose Zone Soil | ADTLLELYSTTSPLAALPRDDRAGLLAVLRPLLAGPYRLPIKHELIWTRLA* |
| Ga0137372_110761691 | 3300012350 | Vadose Zone Soil | ISVGSHTLLGLSSTTSSLAALPQAERAELFAEVRAHLVGPYRLPIEHELTWTRLA* |
| Ga0137375_109438722 | 3300012360 | Vadose Zone Soil | YSTTSSLAAISPEEREALFAAVRPLLRGPYRLPLKHELTWTRLA* |
| Ga0157323_10239522 | 3300012495 | Arabidopsis Rhizosphere | YSTTSSLAALPAEERDALFARVLPLLEGPYRLPLRHELVWTRLAA* |
| Ga0157304_10140662 | 3300012882 | Soil | LYSTTSSLAALSPEERAALFERVRPFLAGPFRLPLRHELVWTRLAR* |
| Ga0157309_101049251 | 3300012895 | Soil | TSSFASLSTNEREALFVRVRPLLAGPYRLPLKHELTWTRLAA* |
| Ga0157292_101268332 | 3300012900 | Soil | LLTLYSTTSSLAALPPEERASLFERVRPLLAGPYRLPLRHELVWTRLAR* |
| Ga0157283_102882041 | 3300012907 | Soil | DEITIDADDLLTLYSTTSALATLPADEREALLGRIRPLLAGPYRLPLKHELTWTRLAA* |
| Ga0157306_103519721 | 3300012912 | Soil | TLYSTTSSLAALPPEERASLFERVRPLLAGPYRLPLRHELVWTRLAR* |
| Ga0157297_100245481 | 3300012914 | Soil | ERDTDEITVDPDELLTLYSTTSSFASLSTNEREALFVRVRPLLAGPYRLPLKHELTWTRLAT* |
| Ga0157297_105309042 | 3300012914 | Soil | EITIDADDLLTLYSTTSALATLPADEREALYARVRPLLDGPYQLPLKHSLTWPRLVA* |
| Ga0164300_108724391 | 3300012951 | Soil | ERLTEAIVVEPDELLELYSTTSSLAAISREEREAIFAAVRPLLAGPYRLPLKHELTWTRLA* |
| Ga0164308_106635531 | 3300012985 | Soil | ELLELYSTTSSLAAIPREEREAIFAAVRPLLAGPYRLPLKHELTWTRLA* |
| Ga0164307_117583752 | 3300012987 | Soil | GPDDLLELYSTTSSLAALEPDERAALFANVRPLLGGEYVLPIKHELTWTRLAR* |
| Ga0164306_107331091 | 3300012988 | Soil | DEEAITIGADDLLTLYSTTSSLAAVGPEEREALFRQVRPLLAGPYVLPLRHELWWTRLA* |
| Ga0157307_11066122 | 3300013096 | Soil | QVEHDTGEITVDPDELLTLYSTTSSFASLPANEREALFDRVRPLLAGPYRLPLKHDLTWTRLTA* |
| Ga0163162_106333061 | 3300013306 | Switchgrass Rhizosphere | DDETLLTLYSTTSSLAALPPEDRASLFERVRPLLAGPYRLPLRHELVWTRLAR* |
| Ga0134079_103575341 | 3300014166 | Grasslands Soil | LLEMYSTTSSLAAISREERETLFEAVRPLLAGPYRLPLKHELTWTRLA* |
| Ga0163163_116072682 | 3300014325 | Switchgrass Rhizosphere | SSLAALEPDERAALFANVRPLLGGEYVLPIKHELTWTRLAR* |
| Ga0157377_105098012 | 3300014745 | Miscanthus Rhizosphere | DLLTLYSTTSALATLPADEREALFARVRPLLTGPYRLPLKHDLTWTRLAA* |
| Ga0173480_101604673 | 3300015200 | Soil | SLAALPPEERASLFERVRPLLAGRYRLPLRHELVWTRLAR* |
| Ga0132256_1025875242 | 3300015372 | Arabidopsis Rhizosphere | RIERDTGEITVDVDVLLTLYSTTSAFASLPASERERLFERVRPLLDGPYRLPLEHELTWTRLA* |
| Ga0132257_1022010801 | 3300015373 | Arabidopsis Rhizosphere | EVTVDADELLTLYSTVSAFASLPKHQREALFDRVRPLLAGPYRLPLKHDLTWTRLAA* |
| Ga0132255_1029623511 | 3300015374 | Arabidopsis Rhizosphere | DLLTLYSTTSALASLTANERTELFDRVRPLLAGPYQLPLKHELTWTRLAA* |
| Ga0132255_1040674851 | 3300015374 | Arabidopsis Rhizosphere | QVEADTDEITIDADELLTLYSTTSALATLSTDEREALFGRIRPLLAGPYRLPLKHDLTWTRLAA* |
| Ga0187775_100194834 | 3300017939 | Tropical Peatland | IEVGPDELLAMYSTTSSFALLPEVERETILAQARPLLAGPYTLPLRHELTWTRLAA |
| Ga0187776_100767241 | 3300017966 | Tropical Peatland | EVIEVGPDELLAMYSTTSSFALLPEVERETILAQARPLLAGPYTLPLRHELTWTRLAA |
| Ga0187787_104609771 | 3300018029 | Tropical Peatland | LLALYSTTSSLAALPDDEREALLARVRPLLEGPFRLPLRHELTWTRLSR |
| Ga0184619_101873351 | 3300018061 | Groundwater Sediment | FEDEISVDADTLLELYSTTSSLAALPQGERAELFTEVRAHLGCQYRLPIKHELTWTRLA |
| Ga0184632_102037911 | 3300018075 | Groundwater Sediment | VHQRQPVRPDELLELYSTTSSLAVISREEREQLFAVVRPLLAGPYSLPLKH |
| Ga0066669_106709122 | 3300018482 | Grasslands Soil | HELLEMYSTTSSLAAISREEREALFAAVRPLLAGRYRLPLKHELTWTRLA |
| Ga0173481_100081814 | 3300019356 | Soil | ASDEITVGPDELLTLYSTTSSLAALLPEERASLFERVRPLLAGPYRLPLRHELVWTRLAR |
| Ga0193694_10261781 | 3300021415 | Soil | YSTTSSLAALGEDERDALFARVRPLLAGPYRLPLKHELTWTRLQ |
| Ga0126371_110441621 | 3300021560 | Tropical Forest Soil | STTSSCAALAADEREALFAAVRPHLAGPYRLPIKHELCWTRLA |
| Ga0207692_103706801 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DDAIVVDPDELLELYSTTSSLAALAPDEREDLFARVRALLDRDYRLPLRHELTWTRLN |
| Ga0207663_114171542 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YERFDDAIVVDPEELLELYSTTSSLAALAPDEREDLFARVRALLDRDYRLPLRHELTWTRLN |
| Ga0207686_109973151 | 3300025934 | Miscanthus Rhizosphere | VVEPDELLELYSTTSSLAAIPREEREAIFAGVRPLLAGPYRLPLKHELTWTRLA |
| Ga0207679_107889692 | 3300025945 | Corn Rhizosphere | SFLAAIPREEREAIFAGVRPLLAGPYRLPLKHELTWTRLA |
| Ga0207640_118160351 | 3300025981 | Corn Rhizosphere | TSSLAALGGDERDALFARVRPLLAGPYLLPLKHELTWTRLAV |
| Ga0208530_10212882 | 3300026009 | Rice Paddy Soil | STTSSLAAISREEREALFTMVRPLLEGTYRLPLKHELTWTRLA |
| Ga0207634_1034801 | 3300026818 | Soil | LYSTTSALATLLTDEREALFGRIRPLLAGPYRLPLKHDLTWTRLAA |
| Ga0209177_103686062 | 3300027775 | Agricultural Soil | TLYSTTSALATLPAYEREALFARVRPLLDGPYQLPLKHSLTWTRLAA |
| Ga0247662_10619841 | 3300028293 | Soil | MYSTTSSFAVLPDDERSELFDRVRPLLAGPYRLPIKHQLTWTRVRAG |
| Ga0247822_116227651 | 3300028592 | Soil | YATTSSLAAISSEEREQVFARVRPLLAGPYSLPLKLEVRQDASR |
| Ga0307309_102035552 | 3300028714 | Soil | LELYSTTSSLAAISREEREQLFAAVRPLLAGPYSLPLKHELTWTRLV |
| Ga0307298_101751292 | 3300028717 | Soil | TSSFASLPANEREALFVRVRPLLAGPYRLPLKHELTWTRLAA |
| Ga0307315_101467211 | 3300028721 | Soil | RLLEMYSTTSSLAALDADERMSLLTKVRALLTGSFALSLKHELAWTRLR |
| Ga0307315_102832032 | 3300028721 | Soil | DPDELLTLYSTTSALATLPADEREALFSRVRPLLAGPYQLPLKHDLTWTRLAA |
| Ga0307299_100794061 | 3300028793 | Soil | SSLAALGEDERDALFARVRPLLAGPYRLPLKHELTWTRLQ |
| Ga0307299_102643231 | 3300028793 | Soil | YSTTSSLAAISREEREQLFAAVRPLLAGPYSLPLKHELTWTRLV |
| Ga0307284_103945391 | 3300028799 | Soil | YSTTSAMAVLGDEERAELIARVRPLLAGPHRLPLKHELRWTRLA |
| Ga0307292_104626031 | 3300028811 | Soil | AALPDEERADLFTAVRAELAGPYRLPIRHELSWTRLA |
| Ga0307468_1023666902 | 3300031740 | Hardwood Forest Soil | EDEITVDPDELLTLYSTTSALALLDREERSDLFARVRPLLAGPYRLPLKHELRWTRLK |
| Ga0307409_1000484364 | 3300031995 | Rhizosphere | DMLLTLYSTTSSLAALPPDERAVLFERVRPLLAGPYRLPLRHELVWTRLAE |
| Ga0335084_107144711 | 3300033004 | Soil | DRDALTIGPDALLELYSTTSSLAALPQAERDALFAEVRPLLRDEYVLPLKHELTWTRLAA |
| Ga0326723_0326252_3_143 | 3300034090 | Peat Soil | ALYSTTSSLAALPVDERVALFAHVRPLLGGSYRLPLRHELTWTRLG |
| ⦗Top⦘ |