Basic Information | |
---|---|
Family ID | F082654 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 41 residues |
Representative Sequence | GEQGAGLALAGLILGWATVILGIALIVVGLAMSVGMHGTMH |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.04 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (51.327 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.088 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.743 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.168 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF00582 | Usp | 3.54 |
PF14789 | THDPS_M | 1.77 |
PF01522 | Polysacc_deac_1 | 1.77 |
PF00486 | Trans_reg_C | 1.77 |
PF06925 | MGDG_synth | 1.77 |
PF02417 | Chromate_transp | 1.77 |
PF01261 | AP_endonuc_2 | 1.77 |
PF00441 | Acyl-CoA_dh_1 | 1.77 |
PF01471 | PG_binding_1 | 0.88 |
PF00543 | P-II | 0.88 |
PF06897 | DUF1269 | 0.88 |
PF13185 | GAF_2 | 0.88 |
PF00821 | PEPCK_GTP | 0.88 |
PF13424 | TPR_12 | 0.88 |
PF03704 | BTAD | 0.88 |
PF12850 | Metallophos_2 | 0.88 |
PF08241 | Methyltransf_11 | 0.88 |
PF10935 | DUF2637 | 0.88 |
PF07690 | MFS_1 | 0.88 |
PF02467 | Whib | 0.88 |
PF00483 | NTP_transferase | 0.88 |
PF13977 | TetR_C_6 | 0.88 |
PF01425 | Amidase | 0.88 |
PF00211 | Guanylate_cyc | 0.88 |
PF00230 | MIP | 0.88 |
PF04972 | BON | 0.88 |
PF01494 | FAD_binding_3 | 0.88 |
PF00101 | RuBisCO_small | 0.88 |
PF01828 | Peptidase_A4 | 0.88 |
PF00027 | cNMP_binding | 0.88 |
PF13602 | ADH_zinc_N_2 | 0.88 |
PF00903 | Glyoxalase | 0.88 |
PF00581 | Rhodanese | 0.88 |
PF13561 | adh_short_C2 | 0.88 |
PF00873 | ACR_tran | 0.88 |
PF09826 | Beta_propel | 0.88 |
PF13191 | AAA_16 | 0.88 |
PF00106 | adh_short | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.77 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 1.77 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.77 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.88 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
COG4451 | Ribulose bisphosphate carboxylase small subunit | Carbohydrate transport and metabolism [G] | 0.88 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.88 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.88 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.88 |
COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.88 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.88 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.88 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.88 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.88 |
COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 51.33 % |
All Organisms | root | All Organisms | 48.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004092|Ga0062389_104495480 | Not Available | 525 | Open in IMG/M |
3300004092|Ga0062389_104995259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300004152|Ga0062386_101268514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
3300005328|Ga0070676_11130753 | Not Available | 593 | Open in IMG/M |
3300005332|Ga0066388_100139955 | Not Available | 2982 | Open in IMG/M |
3300005355|Ga0070671_100972244 | Not Available | 743 | Open in IMG/M |
3300005435|Ga0070714_100542613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1112 | Open in IMG/M |
3300005435|Ga0070714_101034752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
3300005439|Ga0070711_100717632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 843 | Open in IMG/M |
3300005610|Ga0070763_10079908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1616 | Open in IMG/M |
3300005764|Ga0066903_107161049 | Not Available | 578 | Open in IMG/M |
3300006050|Ga0075028_101028014 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Candidatus Halobonum → Candidatus Halobonum tyrrellensis | 514 | Open in IMG/M |
3300006578|Ga0074059_11902198 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300009098|Ga0105245_11797799 | Not Available | 666 | Open in IMG/M |
3300009520|Ga0116214_1218369 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300009524|Ga0116225_1439530 | Not Available | 579 | Open in IMG/M |
3300009764|Ga0116134_1028088 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
3300009839|Ga0116223_10129330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1580 | Open in IMG/M |
3300009839|Ga0116223_10869867 | Not Available | 514 | Open in IMG/M |
3300010043|Ga0126380_10037519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rhizocola → Rhizocola hellebori | 2513 | Open in IMG/M |
3300010048|Ga0126373_12274546 | Not Available | 603 | Open in IMG/M |
3300010341|Ga0074045_10088626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2155 | Open in IMG/M |
3300010341|Ga0074045_10984416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
3300010376|Ga0126381_102782956 | Not Available | 698 | Open in IMG/M |
3300010379|Ga0136449_100291084 | Not Available | 2988 | Open in IMG/M |
3300010379|Ga0136449_102627775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
3300010398|Ga0126383_11605592 | Not Available | 740 | Open in IMG/M |
3300010880|Ga0126350_11270910 | Not Available | 590 | Open in IMG/M |
3300011120|Ga0150983_10068367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium | 802 | Open in IMG/M |
3300012285|Ga0137370_10350581 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300012363|Ga0137390_11950450 | Not Available | 514 | Open in IMG/M |
3300013296|Ga0157374_12753696 | Not Available | 519 | Open in IMG/M |
3300014492|Ga0182013_10494689 | Not Available | 638 | Open in IMG/M |
3300015372|Ga0132256_101910374 | Not Available | 701 | Open in IMG/M |
3300016270|Ga0182036_11542034 | Not Available | 558 | Open in IMG/M |
3300016341|Ga0182035_11270526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → Marmoricola pocheonensis | 659 | Open in IMG/M |
3300016387|Ga0182040_10118830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter | 1830 | Open in IMG/M |
3300016387|Ga0182040_10188010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1508 | Open in IMG/M |
3300016387|Ga0182040_10611867 | Not Available | 883 | Open in IMG/M |
3300017821|Ga0187812_1146864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300017821|Ga0187812_1221792 | Not Available | 603 | Open in IMG/M |
3300017822|Ga0187802_10421707 | Not Available | 529 | Open in IMG/M |
3300017823|Ga0187818_10486064 | Not Available | 553 | Open in IMG/M |
3300017926|Ga0187807_1075655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1050 | Open in IMG/M |
3300017932|Ga0187814_10032004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1957 | Open in IMG/M |
3300017933|Ga0187801_10049574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1523 | Open in IMG/M |
3300017933|Ga0187801_10232383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
3300017933|Ga0187801_10506691 | Not Available | 509 | Open in IMG/M |
3300017955|Ga0187817_10062454 | Not Available | 2307 | Open in IMG/M |
3300017955|Ga0187817_11096010 | Not Available | 511 | Open in IMG/M |
3300017972|Ga0187781_11479507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300017974|Ga0187777_10717824 | Not Available | 710 | Open in IMG/M |
3300018001|Ga0187815_10252903 | Not Available | 746 | Open in IMG/M |
3300018040|Ga0187862_10238240 | Not Available | 1175 | Open in IMG/M |
3300018088|Ga0187771_10571380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 958 | Open in IMG/M |
3300020582|Ga0210395_10914997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium | 651 | Open in IMG/M |
3300021088|Ga0210404_10176174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
3300021180|Ga0210396_10388581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1227 | Open in IMG/M |
3300021560|Ga0126371_10533438 | Not Available | 1322 | Open in IMG/M |
3300022557|Ga0212123_10134254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1940 | Open in IMG/M |
3300025916|Ga0207663_10526848 | Not Available | 921 | Open in IMG/M |
3300025929|Ga0207664_10386992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1242 | Open in IMG/M |
3300025929|Ga0207664_11032818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
3300027854|Ga0209517_10413937 | Not Available | 754 | Open in IMG/M |
3300027884|Ga0209275_10153011 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300027905|Ga0209415_10152237 | Not Available | 2321 | Open in IMG/M |
3300027905|Ga0209415_10857727 | Not Available | 624 | Open in IMG/M |
3300028806|Ga0302221_10385252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → Blastococcus endophyticus | 611 | Open in IMG/M |
3300030053|Ga0302177_10038489 | All Organisms → cellular organisms → Bacteria | 2954 | Open in IMG/M |
3300030054|Ga0302182_10267126 | Not Available | 724 | Open in IMG/M |
3300030617|Ga0311356_10728484 | Not Available | 947 | Open in IMG/M |
3300030706|Ga0310039_10194052 | Not Available | 803 | Open in IMG/M |
3300031040|Ga0265754_1001012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1304 | Open in IMG/M |
3300031543|Ga0318516_10380038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 814 | Open in IMG/M |
3300031549|Ga0318571_10354462 | Not Available | 563 | Open in IMG/M |
3300031680|Ga0318574_10908438 | Not Available | 516 | Open in IMG/M |
3300031736|Ga0318501_10279840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 887 | Open in IMG/M |
3300031751|Ga0318494_10172145 | Not Available | 1226 | Open in IMG/M |
3300031771|Ga0318546_10837186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → Blastococcus litoris | 648 | Open in IMG/M |
3300031778|Ga0318498_10390387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
3300031779|Ga0318566_10086600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1527 | Open in IMG/M |
3300031781|Ga0318547_10966493 | Not Available | 532 | Open in IMG/M |
3300031782|Ga0318552_10609128 | Not Available | 557 | Open in IMG/M |
3300031782|Ga0318552_10648586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
3300031793|Ga0318548_10269128 | Not Available | 837 | Open in IMG/M |
3300031795|Ga0318557_10444519 | Not Available | 596 | Open in IMG/M |
3300031798|Ga0318523_10181762 | Not Available | 1049 | Open in IMG/M |
3300031798|Ga0318523_10248899 | Not Available | 888 | Open in IMG/M |
3300031823|Ga0307478_10305072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1305 | Open in IMG/M |
3300031832|Ga0318499_10126232 | Not Available | 995 | Open in IMG/M |
3300031832|Ga0318499_10280729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
3300031846|Ga0318512_10454792 | Not Available | 647 | Open in IMG/M |
3300031942|Ga0310916_10671214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 878 | Open in IMG/M |
3300031959|Ga0318530_10335081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
3300031981|Ga0318531_10108628 | Not Available | 1226 | Open in IMG/M |
3300032001|Ga0306922_12053402 | Not Available | 555 | Open in IMG/M |
3300032009|Ga0318563_10535912 | Not Available | 632 | Open in IMG/M |
3300032010|Ga0318569_10094546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
3300032025|Ga0318507_10413519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
3300032039|Ga0318559_10111231 | Not Available | 1221 | Open in IMG/M |
3300032042|Ga0318545_10130452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
3300032044|Ga0318558_10559684 | Not Available | 571 | Open in IMG/M |
3300032054|Ga0318570_10574295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
3300032059|Ga0318533_10237018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1315 | Open in IMG/M |
3300032063|Ga0318504_10643365 | Not Available | 510 | Open in IMG/M |
3300032091|Ga0318577_10229197 | Not Available | 889 | Open in IMG/M |
3300032770|Ga0335085_10732877 | Not Available | 1096 | Open in IMG/M |
3300032895|Ga0335074_10190283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2522 | Open in IMG/M |
3300032896|Ga0335075_10643659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1035 | Open in IMG/M |
3300032954|Ga0335083_11237336 | Not Available | 577 | Open in IMG/M |
3300032954|Ga0335083_11276603 | Not Available | 566 | Open in IMG/M |
3300032955|Ga0335076_10442965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea aridisoli | 1182 | Open in IMG/M |
3300032955|Ga0335076_11367708 | Not Available | 593 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.09% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 10.62% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.54% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.54% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.65% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.77% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062389_1044954801 | 3300004092 | Bog Forest Soil | QIKRTGEQGAGLALAGLLLGWAMAILVIVLIVTMSVGMHGTTHTN* |
Ga0062389_1049952591 | 3300004092 | Bog Forest Soil | TGEQGAGLALAGLILGWATVILTILIVVGLATSVGMHGTTH* |
Ga0062386_1012685141 | 3300004152 | Bog Forest Soil | GEQGAGLALAGLILGWAAVILGMVLIVLGLAMSVGMSGSVP* |
Ga0070676_111307531 | 3300005328 | Miscanthus Rhizosphere | EQEAGLALAGLALGWGAVILGIVLIAIGLAIAAGTHGAMPM* |
Ga0066388_1001399552 | 3300005332 | Tropical Forest Soil | QAAGLALAGLIPGWAAVILGIILIVLGLAIPLGIHGTVH* |
Ga0070671_1009722441 | 3300005355 | Switchgrass Rhizosphere | QGAGLAPSGLVPGWGAVILGIVPIAIGPAIAAGTHGAMPMR* |
Ga0070714_1005426131 | 3300005435 | Agricultural Soil | QGAGLALAGLVLGWGAVILGIVLIAVGLAIAAGTHGAMPMR* |
Ga0070714_1010347521 | 3300005435 | Agricultural Soil | QGAGLALAGLVLGWGAVILGIVLIAVGLAIAAGTHGAMPIR* |
Ga0070711_1007176322 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RTGEQGAGLALAGLTLGRTAVILGILFIVLGLAISTGMHGTMPMH* |
Ga0070763_100799083 | 3300005610 | Soil | TGEQGAGLALAGLILGWVTVILVIVLIVAMSVGMHGTTHKN* |
Ga0066903_1071610491 | 3300005764 | Tropical Forest Soil | QGAGLALAGLILGWGAVILGIVVIVLGLAISIGMHATMPMH* |
Ga0075028_1010280141 | 3300006050 | Watersheds | LALAGLVLGWGAVILGIVLIAVGLAVAAGMHGAMPMR* |
Ga0074059_119021982 | 3300006578 | Soil | DQGAGLALTGLVLGWAAVILGIILIAVGLAMAAGMHGTMPMR* |
Ga0105245_117977991 | 3300009098 | Miscanthus Rhizosphere | IRRTGEQGAGLAPSGLVPGWGAVILGIVPIAIGPAIAAGTHGAMPMR* |
Ga0116214_12183691 | 3300009520 | Peatlands Soil | QGAGLALAGLILGWAAVILGIALIVVGLALSVGMQATMH* |
Ga0116225_14395301 | 3300009524 | Peatlands Soil | QGAGLALAGLILGWATVILGIVLIVVVGLAVSVGMNGTMH* |
Ga0116134_10280881 | 3300009764 | Peatland | IKRTGEQGAGLALTGLILGWATVILGIVLIVVGLAMSVGMNGTMH* |
Ga0116223_101293301 | 3300009839 | Peatlands Soil | QGAGLALAGLILGWAAVILGILILVLGVAMSARMQGTMH* |
Ga0116223_108698671 | 3300009839 | Peatlands Soil | LALAGLILGWATVILAIVLIVAMSAGMHGTTHTH* |
Ga0126380_100375194 | 3300010043 | Tropical Forest Soil | ALAGLILGWAAVILGIVFIVLGLAISTAMHGTMPMH* |
Ga0126373_122745461 | 3300010048 | Tropical Forest Soil | IKRTGEQGAGLALAGLILGWAAVILGIVLVLGLVAVSVGTQGGTN* |
Ga0074045_100886261 | 3300010341 | Bog Forest Soil | TGEQGAGLALAGLILGWAAVILAIVLIVGLAMSAGIHGPMHTH* |
Ga0074045_109844161 | 3300010341 | Bog Forest Soil | GEQGAGLALAGLILGWATVILGIALIVVGLAMSVGMHGTMH* |
Ga0126381_1027829561 | 3300010376 | Tropical Forest Soil | AGLALAGLILGWAAVILGIILVVGGLAFSVGMNGPMR* |
Ga0136449_1002910843 | 3300010379 | Peatlands Soil | RRTGEQGAGLALAGLILGWAAVILGMILIVVGLAMSVGMSGAVH* |
Ga0136449_1026277751 | 3300010379 | Peatlands Soil | TGEQGAGLALAGLILGWATVILGMVLIVLALAMSVRMSGTVH* |
Ga0126383_116055921 | 3300010398 | Tropical Forest Soil | GAGLALAGLMLGWAAVMLGIVLIVAGLAVSAGMNNGMH* |
Ga0126350_112709101 | 3300010880 | Boreal Forest Soil | AGLALGGLILGWAAVILAIVLIVGLAVSVGIHGTMHMH* |
Ga0150983_100683673 | 3300011120 | Forest Soil | GLALAGLIFGWAAVILGVLLILGVAMSVGMHGSTMH* |
Ga0137370_103505811 | 3300012285 | Vadose Zone Soil | IMRTGEQGAGLALAGLILGWAAVILGIVLLVVGLAISAGMHGTVHMH* |
Ga0137390_119504501 | 3300012363 | Vadose Zone Soil | LAGLVLGWGAVILGIVLIAVGLAIAAGMHGAMPMR* |
Ga0157374_127536961 | 3300013296 | Miscanthus Rhizosphere | QGAGLAPSGLVPGWGAVILGIVPIAIGPAIAAGTHGAIPMR* |
Ga0182013_104946891 | 3300014492 | Bog | MWPGQIKRTGEQGANLALAGLMLGWAAVILAIVLIIGLAMSVGIHGTMHTH* |
Ga0132256_1019103742 | 3300015372 | Arabidopsis Rhizosphere | QGAVLARAGLVLGWGAVVVGIVLIAVGLAIAAGMHGAMPMRGMG* |
Ga0182036_115420341 | 3300016270 | Soil | TGEQGAGLALAGLILGWAAVILGIVLVLGLVAVSVGTQGGTN |
Ga0182035_112705261 | 3300016341 | Soil | QGAGLALAGLVLGWGAVILGIVLIAVGLAVAAGTHGAMPMR |
Ga0182040_101188304 | 3300016387 | Soil | CQIKRTGEQGAGLALAGLILGWATVILAILLLVIVGVAMTAGMNGAMMH |
Ga0182040_101880104 | 3300016387 | Soil | GDGLALAGLILGWATVILGILLLLIVVGVALSAGMHGAMH |
Ga0182040_106118671 | 3300016387 | Soil | TGERGAGLALAGLMLGWAMVILGIVVIVVGLAVSSKMHGPMNMY |
Ga0187812_11468643 | 3300017821 | Freshwater Sediment | GSGLALAGLILGWATVILGVVALIVGLAIASAVTGSMHMH |
Ga0187812_12217922 | 3300017821 | Freshwater Sediment | QGAGLALAGLILGWATVILAILLVFIIGVTMTAGMHGTMH |
Ga0187802_104217072 | 3300017822 | Freshwater Sediment | RTGEQGAGLALVGLLLGWFAVILGVAAIAGLAVFAGMHGMPAHGTVRPGPP |
Ga0187818_104860641 | 3300017823 | Freshwater Sediment | EQGAGLALAGLILGWATVILAIVLIIGLAMSVGMHGTTHTH |
Ga0187807_10756552 | 3300017926 | Freshwater Sediment | GASLALAGLVFGWVAVILGIVAIVVGLVVAAGMHGTMPMH |
Ga0187814_100320041 | 3300017932 | Freshwater Sediment | QGAGLALAGLILGWATVILAIVLIVGLAMSAGMHGTTHTH |
Ga0187801_100495741 | 3300017933 | Freshwater Sediment | GEQGAGLALAGLILGWAAVILGILILVLGVAMSVRTGGTMQ |
Ga0187801_102323831 | 3300017933 | Freshwater Sediment | TGEQGAGLALAGLILGWATVVLGIILLIVGVAAFAGIHGTMHMH |
Ga0187801_105066911 | 3300017933 | Freshwater Sediment | GEQGAGLALAGLILGWAAVILGILILVVGMAMSVRMQGTTMH |
Ga0187817_100624545 | 3300017955 | Freshwater Sediment | SGEQGAGLALAGLILGWAAVIVGIIILIAGVAMSVRMQGTMH |
Ga0187817_110960101 | 3300017955 | Freshwater Sediment | GLALAGLILGWAAVILGIVLILGVAMSAGVQGTMHMH |
Ga0187781_114795072 | 3300017972 | Tropical Peatland | QIKRSGEQGAGLALAGLILGWAAVILGILVLVLGMAMSARMQGTTP |
Ga0187777_107178241 | 3300017974 | Tropical Peatland | GLALAGLILGWVVVILAVIVIAVGLAIATAMHGTVPMH |
Ga0187815_102529031 | 3300018001 | Freshwater Sediment | QGAGLALAGLILGWAAVILGIVLILGVAMSAGVQGTMHMH |
Ga0187862_102382401 | 3300018040 | Peatland | GADLALAGLMLGWAAVILVIVLIVGLAMSAGVHGTIH |
Ga0187771_105713801 | 3300018088 | Tropical Peatland | LAGLVLGWAVVILAIVIIVVGLVIAAGMHGAVQMH |
Ga0210395_109149972 | 3300020582 | Soil | HSGEQGAGLALAGLIFGWAAVILGVLLILGVAMSLGVHGSTMH |
Ga0210404_101761745 | 3300021088 | Soil | RSGEQGAGLALAGLIFGWAALILGVLLILGVAMSVGMHGSTMH |
Ga0210396_103885812 | 3300021180 | Soil | VAGLVLGWGAVALGIILMFAVMTVAAGTHGAVQTP |
Ga0126371_105334383 | 3300021560 | Tropical Forest Soil | GAGLALAGLILGWAAVVLGVLIIVLGVAVFAGMSSGAPTH |
Ga0212123_101342543 | 3300022557 | Iron-Sulfur Acid Spring | GLALAGLIFGWAAVILGVLLVLGVAMSVGMHGSTMH |
Ga0207663_105268482 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TGEQGAGLALAGLVLGWGAVILGIVLIAVGLAIAAGTHGAMPMR |
Ga0207664_103869922 | 3300025929 | Agricultural Soil | LALAGLVLGWGAVILGIVLIAVGLAIAAGTHGAMPMR |
Ga0207664_110328182 | 3300025929 | Agricultural Soil | IRRTGEQGAGLALAGLVLGWGAVILGIVLIAVGLAIAAGTHGAMPMR |
Ga0209517_104139373 | 3300027854 | Peatlands Soil | IRRTGEQGAGLALAGLILGWAAVILGMILIVVGLAMSVGMSGAVH |
Ga0209275_101530112 | 3300027884 | Soil | GEQGAGLALAGLILGWVTVILVIVLIVAMSVGMHGSTHAN |
Ga0209415_101522371 | 3300027905 | Peatlands Soil | EQGAGLALVGLILGWGAVILGIILLIVGVAISARMQATMH |
Ga0209415_108577271 | 3300027905 | Peatlands Soil | KRTGEQGAGLALAGLILGWAAVILGIALIVVGLALSVGMQATMH |
Ga0302221_103852522 | 3300028806 | Palsa | TGEQGAGLALAGLMLGWATVILTILIVVGLATSVGMHGTTH |
Ga0302177_100384895 | 3300030053 | Palsa | IKQTGEQGAGLALAGLMLGWATVILTILIVVGLATSVGMHGTTH |
Ga0302182_102671261 | 3300030054 | Palsa | KRTGQQGGDLALAGLMLGWAAVILVIVLIVGLAMSVGVHGTMPTH |
Ga0311356_107284842 | 3300030617 | Palsa | RIKRTGEQGAGLALAGLILGWTTVILIVVVGLVMSVGMHGTVH |
Ga0310039_101940523 | 3300030706 | Peatlands Soil | LALAGLILGWATVILGIVLIVVVGLAVSVGMNGTMH |
Ga0265754_10010121 | 3300031040 | Soil | RIKRTGEQGAALALAGLILGWAAVILAILLIVGVAMFAGMHGTMH |
Ga0318516_103800381 | 3300031543 | Soil | GEQGDGLALAGLILGWATVILGILLLLIVVGVALSAGMHGAMH |
Ga0318571_103544621 | 3300031549 | Soil | RSQIKHTGEQGAGLALAGLILGWGAVILGIVVIVLGLAISIGMHATMPMH |
Ga0318574_109084382 | 3300031680 | Soil | IRRTGEQGAGLALAGLILGWATVILAILLVLIIGVALTAGMHGTMN |
Ga0318501_102798401 | 3300031736 | Soil | AGLALAGLVLGWGAVILAIVIIAVGLAIAAGTHGAMAMR |
Ga0318494_101721451 | 3300031751 | Soil | RTGEQGAGLALAGLVLGWGAVILGIVLIAVGLAIAAGTHGAMPMR |
Ga0318546_108371863 | 3300031771 | Soil | GLALAGLILGWGAVILGILLIAVGLAIAAGMHGTMPTN |
Ga0318498_103903871 | 3300031778 | Soil | EQGAGLALAGLVLGWGAVILGIVLIAVGLAIAAGTHGAMPMQ |
Ga0318566_100866001 | 3300031779 | Soil | EQGDGLALAGLILGWATVILGILLLLIVVGVALSAGMHGAMH |
Ga0318547_109664932 | 3300031781 | Soil | IKRTGEQGAGLALAGLILGWATVILAIVLIVVVGLALSAGTNSMMH |
Ga0318552_106091281 | 3300031782 | Soil | IKRTGEQGAGLALAGLTLGRTAVILGILFIVLGLAISIRMHGTMPIP |
Ga0318552_106485862 | 3300031782 | Soil | RTGEQEAGLALAGLVLGWGAVILGIVLIAVGLAIAAGTHGAMPMQ |
Ga0318548_102691281 | 3300031793 | Soil | GEQGAGLALAGLILGWGAVILGIVVIVLGLAISIGMHATMPIH |
Ga0318557_104445192 | 3300031795 | Soil | LALAGLILGWAAVVLGVLIIVFGVAVFAGMSSSGAPTH |
Ga0318523_101817622 | 3300031798 | Soil | IKHTGEQGAGLALAGLILGWGAVILGIVVIVLGLAISIGMHATMPIH |
Ga0318523_102488992 | 3300031798 | Soil | GLALAGLILGWVVVILGIVVIVIGLAIAIGMHGSMPMH |
Ga0307478_103050722 | 3300031823 | Hardwood Forest Soil | AGLALAGLVLGWGAVALGIILMVAVMTVAAGTHGAVQAP |
Ga0318499_101262322 | 3300031832 | Soil | GEQGAGLALAGLILGWGAVILGILLIAVGLAIAAGMHGTMPTQ |
Ga0318499_102807291 | 3300031832 | Soil | GAGLALAGLILGWGAVILGILLIAVGLAIAAGMHGTMTTQ |
Ga0318512_104547922 | 3300031846 | Soil | EQGAGLALTGLVLGWGAVILGIVLIAVGLAIAAGTHGSMPMR |
Ga0310916_106712141 | 3300031942 | Soil | AGLALAGLILGWAAVVLGVLLVVFGLAVFAGMSSGAPTH |
Ga0318530_103350812 | 3300031959 | Soil | QGAGLALAGLALGWGAVILGIVLIAVGVAIAAGMHGAMPMQ |
Ga0318531_101086283 | 3300031981 | Soil | GEQGAGLALAGLILGWAAVVLGVLVIVFGLALFAGMSTSGAPTH |
Ga0306922_120534021 | 3300032001 | Soil | EQGDGLALAGLMLGWAAVILGIVLIVVGLAIAAGTHGAMGMH |
Ga0318563_105359122 | 3300032009 | Soil | IKRTGEQGAGLALAGLILGWATVILAIVLIVVVGLALSAGTHSMMQ |
Ga0318569_100945461 | 3300032010 | Soil | RQGRGRGLILGWATVILGILLLLIVVGVALSAGMNGTMH |
Ga0318507_104135191 | 3300032025 | Soil | LALAGLILGWATVILGILLLLIVVGVALSAGMHGAMH |
Ga0318559_101112311 | 3300032039 | Soil | TGEQGAGLALAGLVLGWGAVILAIVIIAVGLAIAAGTHGAMAMR |
Ga0318545_101304521 | 3300032042 | Soil | AGLALAGLILGWAAVVLGVLIIVFGVAVFAGMSSSGAPTH |
Ga0318558_105596841 | 3300032044 | Soil | RTGEQGAGLALAGLILGWGAVILGILLIAVGLAIAAGMHGTMTTQ |
Ga0318570_105742952 | 3300032054 | Soil | GLALAGLILGWATVILGILVVLVIVGVAMSAGMHGTTH |
Ga0318533_102370183 | 3300032059 | Soil | AGLALAGLILGWGAVISGIVLIAVGLAIAAGTHGAMPMR |
Ga0318504_106433652 | 3300032063 | Soil | GLALAGLILGWVAVILGIVVIVIGLAIAIGMHGSMPMH |
Ga0318577_102291971 | 3300032091 | Soil | GEQGAGLALAGLILGWATVILAIVLIVVVGLALSAGTHSMMQ |
Ga0335085_107328771 | 3300032770 | Soil | KRTGEQGAGLALAGLILGWATVILAIVLIVVIGLVMSVGMQGTMQ |
Ga0335074_101902831 | 3300032895 | Soil | ERGAGLALAGLVLGWGAVIFAIILMTVAITVAARTQGPLQTP |
Ga0335075_106436591 | 3300032896 | Soil | TGEQGTGLALAGLILGWAALVLGILLIVAASTSAGMPGTMH |
Ga0335083_112373362 | 3300032954 | Soil | REQGAGLALAGLILGWATVILAVVLILVVGVALSAGMHGSMH |
Ga0335083_112766031 | 3300032954 | Soil | AGLALAGLILGWATVILAIVLIVVIGLVMSVGMQGTMQ |
Ga0335076_104429652 | 3300032955 | Soil | GAGLALAGLILGWGAVILGIVLIAVGLAIAAGMHGTMPAQ |
Ga0335076_113677081 | 3300032955 | Soil | LAGLILGWGAVILGIVLIAVGLAIAAGMHGTMPTQ |
⦗Top⦘ |