| Basic Information | |
|---|---|
| Family ID | F082641 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSAGATA |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.11 % |
| % of genes near scaffold ends (potentially truncated) | 30.97 % |
| % of genes from short scaffolds (< 2000 bps) | 79.65 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.035 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands (7.965 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.823 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.78% β-sheet: 0.00% Coil/Unstructured: 51.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00873 | ACR_tran | 41.59 |
| PF02310 | B12-binding | 12.39 |
| PF04055 | Radical_SAM | 9.73 |
| PF13519 | VWA_2 | 3.54 |
| PF13767 | DUF4168 | 2.65 |
| PF00571 | CBS | 2.65 |
| PF00664 | ABC_membrane | 0.88 |
| PF07750 | GcrA | 0.88 |
| PF13533 | Biotin_lipoyl_2 | 0.88 |
| PF03176 | MMPL | 0.88 |
| PF09864 | MliC | 0.88 |
| PF00753 | Lactamase_B | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.88 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.88 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.04 % |
| Unclassified | root | N/A | 7.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8953971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1380 | Open in IMG/M |
| 3300000156|NODE_c0668733 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
| 3300000891|JGI10214J12806_13077089 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 831 | Open in IMG/M |
| 3300000953|JGI11615J12901_11117968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300001976|JGI24752J21851_1008849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1313 | Open in IMG/M |
| 3300001990|JGI24737J22298_10014632 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300003319|soilL2_10068373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1550 | Open in IMG/M |
| 3300003324|soilH2_10294338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1845 | Open in IMG/M |
| 3300003911|JGI25405J52794_10006035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2205 | Open in IMG/M |
| 3300003994|Ga0055435_10129382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300004024|Ga0055436_10045647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1174 | Open in IMG/M |
| 3300004062|Ga0055500_10058896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300004114|Ga0062593_101543265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300004145|Ga0055489_10020113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1592 | Open in IMG/M |
| 3300004156|Ga0062589_101237734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300004157|Ga0062590_100660452 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300004463|Ga0063356_103083617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300004463|Ga0063356_106141087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300004480|Ga0062592_101726086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 610 | Open in IMG/M |
| 3300004643|Ga0062591_102085233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300005093|Ga0062594_100052470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2100 | Open in IMG/M |
| 3300005093|Ga0062594_101347218 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005103|Ga0066813_1001875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 852 | Open in IMG/M |
| 3300005162|Ga0066814_10016487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 981 | Open in IMG/M |
| 3300005162|Ga0066814_10018748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 941 | Open in IMG/M |
| 3300005168|Ga0066809_10050288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300005183|Ga0068993_10058137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1146 | Open in IMG/M |
| 3300005276|Ga0065717_1000133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2951 | Open in IMG/M |
| 3300005280|Ga0065696_1219476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 530 | Open in IMG/M |
| 3300005329|Ga0070683_101359142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300005332|Ga0066388_100324543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2185 | Open in IMG/M |
| 3300005332|Ga0066388_101570268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1156 | Open in IMG/M |
| 3300005340|Ga0070689_101361096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300005438|Ga0070701_10938955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300005440|Ga0070705_100164460 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300005440|Ga0070705_100480702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 938 | Open in IMG/M |
| 3300005529|Ga0070741_10004486 | All Organisms → cellular organisms → Bacteria | 32540 | Open in IMG/M |
| 3300005530|Ga0070679_101701108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300005547|Ga0070693_100217758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1249 | Open in IMG/M |
| 3300005618|Ga0068864_102239769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300005764|Ga0066903_106276184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300005764|Ga0066903_107961437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300005841|Ga0068863_102573140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300005842|Ga0068858_100637966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1035 | Open in IMG/M |
| 3300006042|Ga0075368_10150793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 971 | Open in IMG/M |
| 3300006604|Ga0074060_11830025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300006806|Ga0079220_10568146 | Not Available | 796 | Open in IMG/M |
| 3300006845|Ga0075421_102391105 | Not Available | 553 | Open in IMG/M |
| 3300006854|Ga0075425_100084121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3600 | Open in IMG/M |
| 3300009177|Ga0105248_11404683 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300009553|Ga0105249_10115097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2547 | Open in IMG/M |
| 3300010359|Ga0126376_12248094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300010362|Ga0126377_10032984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4393 | Open in IMG/M |
| 3300010362|Ga0126377_10159459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2127 | Open in IMG/M |
| 3300010371|Ga0134125_11396665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
| 3300010371|Ga0134125_12727841 | Not Available | 537 | Open in IMG/M |
| 3300010396|Ga0134126_11850463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 661 | Open in IMG/M |
| 3300012489|Ga0157349_1036791 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012494|Ga0157341_1018883 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012508|Ga0157315_1002548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1149 | Open in IMG/M |
| 3300012513|Ga0157326_1006829 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300012896|Ga0157303_10000934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3894 | Open in IMG/M |
| 3300012901|Ga0157288_10000021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15444 | Open in IMG/M |
| 3300012907|Ga0157283_10021215 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300012910|Ga0157308_10308847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300012943|Ga0164241_11042856 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300012948|Ga0126375_10008850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4123 | Open in IMG/M |
| 3300012985|Ga0164308_10510996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300014262|Ga0075301_1067553 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300014321|Ga0075353_1120053 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300015371|Ga0132258_10282287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4075 | Open in IMG/M |
| 3300015371|Ga0132258_13055592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1158 | Open in IMG/M |
| 3300015372|Ga0132256_102575603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300015373|Ga0132257_100955213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300015374|Ga0132255_102697313 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300015374|Ga0132255_104608145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 584 | Open in IMG/M |
| 3300019356|Ga0173481_10000447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8787 | Open in IMG/M |
| 3300021560|Ga0126371_12007911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 696 | Open in IMG/M |
| 3300022737|Ga0247747_1003598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1479 | Open in IMG/M |
| 3300022901|Ga0247788_1005967 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300025538|Ga0210132_1014463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1075 | Open in IMG/M |
| 3300025900|Ga0207710_10072385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1583 | Open in IMG/M |
| 3300025901|Ga0207688_10014620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4264 | Open in IMG/M |
| 3300025907|Ga0207645_10140378 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300025912|Ga0207707_10311679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1359 | Open in IMG/M |
| 3300025917|Ga0207660_10124985 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1952 | Open in IMG/M |
| 3300025925|Ga0207650_10504756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1011 | Open in IMG/M |
| 3300025932|Ga0207690_11696131 | Not Available | 528 | Open in IMG/M |
| 3300025959|Ga0210116_1020079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
| 3300025965|Ga0210090_1016112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1021 | Open in IMG/M |
| 3300025985|Ga0210117_1021267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 949 | Open in IMG/M |
| 3300026035|Ga0207703_10103068 | Not Available | 2422 | Open in IMG/M |
| 3300026116|Ga0207674_11187751 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300026725|Ga0207474_102081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300026995|Ga0208761_1013173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300027765|Ga0209073_10249769 | Not Available | 689 | Open in IMG/M |
| 3300027775|Ga0209177_10486532 | Not Available | 512 | Open in IMG/M |
| 3300027866|Ga0209813_10062847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1189 | Open in IMG/M |
| 3300027876|Ga0209974_10059924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1287 | Open in IMG/M |
| 3300027992|Ga0247750_1002892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1280 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1000248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 7794 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1118363 | Not Available | 579 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10032088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1359 | Open in IMG/M |
| 3300031716|Ga0310813_10019258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4624 | Open in IMG/M |
| 3300031720|Ga0307469_12475719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300031740|Ga0307468_100014791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3225 | Open in IMG/M |
| 3300031858|Ga0310892_10544185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 779 | Open in IMG/M |
| 3300031913|Ga0310891_10004295 | All Organisms → cellular organisms → Bacteria | 3005 | Open in IMG/M |
| 3300031913|Ga0310891_10123950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300032174|Ga0307470_10650175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 3300032174|Ga0307470_11675422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300032205|Ga0307472_100623568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 956 | Open in IMG/M |
| 3300033513|Ga0316628_100252183 | Not Available | 2162 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.65% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.65% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.77% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere Bulk Soil | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
| 3300005280 | Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026725 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027992 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_03018530 | 2088090015 | Soil | MKCWREPSLEDILSDPITQAVISADGVDTGELEAMLRQVAHKRRSVRRSAGATA |
| NODE_06687335 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MKCWREPSLEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVSRSGATAWL* |
| JGI10214J12806_130770891 | 3300000891 | Soil | ILSDPITQAVISADRVDTGELDAMLRQVAHKRRSVRRSAGATA* |
| JGI11615J12901_111179682 | 3300000953 | Soil | MKYCREPSLEDILADPIIQAVIDADGVDAHELDAMLRGVARKRRSAERTASFAPW* |
| JGI24752J21851_10088492 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLEDMLADPIIQAVIDADGVDANELDAMLRGVAHERRSAERMASAAWRR* |
| JGI24737J22298_100146321 | 3300001990 | Corn Rhizosphere | WREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA* |
| soilL2_100683732 | 3300003319 | Sugarcane Root And Bulk Soil | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRQIAHKRRSVRRSAGATT* |
| soilH2_102943382 | 3300003324 | Sugarcane Root And Bulk Soil | MNCCREPSLEDILSDPIVKAVIDADGLDANELDAMLRGVAQRRRSVQRTVGARP* |
| JGI25405J52794_100060352 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MHFLPVRQSKVNPMTCWREPSLEDILSDPITKAVISADGVDTGELDAMLRCVAQKRRSAERSTGAAVWRR* |
| Ga0055435_101293821 | 3300003994 | Natural And Restored Wetlands | MKCWREPSLEDILSDPLTQAVISADGVDANELDAMLRRVAHKRRSAAGGKGDGVGVVS* |
| Ga0055436_100456471 | 3300004024 | Natural And Restored Wetlands | MKCWREPSLEDILSDPLTQAVISADGVDANELDAMLRRVAHQRRSAAGSIGRGR* |
| Ga0055500_100588961 | 3300004062 | Natural And Restored Wetlands | MKCWRELSLEDILSDPLTQAVISADGVDANELDAMLRRVAHQRRSAADSIGRGR* |
| Ga0062593_1015432652 | 3300004114 | Soil | MKCWREPSLEDILSDPITQAVISADGVDANELDAMLRRVEHKRRSAPDSIGRGR* |
| Ga0055489_100201132 | 3300004145 | Natural And Restored Wetlands | MKCWREPSLEDILSDPLTQAVISADGVDANELDAMLRRVAHKRRSAAGGKGDGIGVVS* |
| Ga0062589_1012377342 | 3300004156 | Soil | MRCYREPSLEDILADPIIQAVIDADGVDANELDAMLRGVAHERRSAEGMASAAWRRW* |
| Ga0062590_1006604522 | 3300004157 | Soil | MRCWREPSLEEILSDPITQAVISADGVDTGELDAMLRQVAHKRRSVRRSAGATA* |
| Ga0063356_1030836172 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCYRELSLEDMLADPIIQAVIDADGVDANELDAMLRGVAHERRSAERMASAAWRR* |
| Ga0063356_1061410872 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDANELDAMLRHVAHKRRSTADSIGRGR* |
| Ga0062592_1017260862 | 3300004480 | Soil | MNYCREPSLEDILSDPIIKAVIDADGVDANELGAMLRRVANTRRLAADSVGRRW* |
| Ga0062591_1020852331 | 3300004643 | Soil | IRSRFMKCWREPSLEDILSDPITQAVISADRVDASELDAMLRRVAQSRRLVGDSIGQGR* |
| Ga0062594_1000524702 | 3300005093 | Soil | MKCWREPSLEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVGRSGATAWL* |
| Ga0062594_1013472182 | 3300005093 | Soil | ILSDPITQAVISADGVDTGELDAMLRQVAHKRRSVRRSAGATA* |
| Ga0066813_10018752 | 3300005103 | Soil | MRACREPSLQDILSDPITRAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA* |
| Ga0066814_100164872 | 3300005162 | Soil | MRACREPSLHDILSDPITQAVISADGVDTGELEAMLRQVAQKRRSAADSMGRGR* |
| Ga0066814_100187482 | 3300005162 | Soil | MKCWREPSLEDILSDPITQAVISADGVNTGELDAMLRWVAHKRRSAQRSASATA* |
| Ga0066809_100502881 | 3300005168 | Soil | MRACREPSLQDILSDPITQAVISADGVDTGELDPMLRQVAQKRRSAADSMGRGR* |
| Ga0068993_100581372 | 3300005183 | Natural And Restored Wetlands | MKCWREPSLEDILSDPLTQAVISADGVDANELDAMLRRVAHQRRSAADSIGRGR* |
| Ga0065717_10001333 | 3300005276 | Arabidopsis Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA* |
| Ga0065696_12194761 | 3300005280 | Switchgrass Rhizosphere Bulk Soil | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSAGATA* |
| Ga0070683_1013591421 | 3300005329 | Corn Rhizosphere | MKCWREPSLEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVGRS |
| Ga0066388_1003245434 | 3300005332 | Tropical Forest Soil | MTCWREPSLEDILSDPIVKAVIDADDVDTNELDAMLRRVAHKRRVDFGATMRQ* |
| Ga0066388_1015702682 | 3300005332 | Tropical Forest Soil | MNCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAQKRRSAERSMGASVWRR* |
| Ga0070689_1013610962 | 3300005340 | Switchgrass Rhizosphere | EDILSDPITQAVISADGVDTGELDALLRRVAHKRRSAQRSASATA* |
| Ga0070701_109389551 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDTGELDALLRRVAHKRRSAQRSASATA* |
| Ga0070705_1001644601 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRQVAHKRRSVRRSAGATA* |
| Ga0070705_1004807022 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDANELDAMLRRVAHKRRSAANSIGHGR* |
| Ga0070741_1000448637 | 3300005529 | Surface Soil | MKCCREPSLEDILSDPIVKAVIDADGVDTNELNAMLRCVAHRRRSLERGAPLVARR* |
| Ga0070679_1017011082 | 3300005530 | Corn Rhizosphere | MKCWREPSLEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVGRSGA |
| Ga0070693_1002177582 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCWREPSPEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVGRSGAMAWL* |
| Ga0068864_1022397691 | 3300005618 | Switchgrass Rhizosphere | AIRSRFMKCWREPSLEDILSDPITQAVISADRVDASELDAMLRRVAQSRRLVGDSIGQGR |
| Ga0066903_1062761842 | 3300005764 | Tropical Forest Soil | MTCWREPSLEDILSDPIVKAVIEADDVDTNELDAMLRRVAHKRRVGLGATARQ* |
| Ga0066903_1079614371 | 3300005764 | Tropical Forest Soil | MTCWREPSLEDILSDPIIRAVIEADGVDTTELNAMLRRIAHKRGAAAAGATH* |
| Ga0068863_1025731401 | 3300005841 | Switchgrass Rhizosphere | PSLEDILSDPITQAVISADRVDASELDAMLRRVAQSRRLVGDSIGQGR* |
| Ga0068858_1006379662 | 3300005842 | Switchgrass Rhizosphere | MKCWREPSLEDILSDPITQAVISADRVDASELDAMLRRVAQSRRLVGDSIGQGR* |
| Ga0075368_101507932 | 3300006042 | Populus Endosphere | MKCYRELSLEDMLADPIIQAVIDAVGVDANELDAMLRGVAHERRSAERMASAAWRR* |
| Ga0074060_118300252 | 3300006604 | Soil | MKCWREPSLEDILSDPITQAVISADGVNTGELDAMLRWVAHKRRSAQRS |
| Ga0079220_105681461 | 3300006806 | Agricultural Soil | SLEDILSDPITQAVISADGVDTGELDAMLRGVVQKRRSAERATGAAFWRR* |
| Ga0075421_1023911051 | 3300006845 | Populus Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDTGELEAMLRQVAHKRRSVRRSAGATA* |
| Ga0075425_1000841212 | 3300006854 | Populus Rhizosphere | MNCWREPSLEDILSDPITQAVISADGVDTGELDAMLRCVAQKRRSAERSMGATVWRR* |
| Ga0105248_114046831 | 3300009177 | Switchgrass Rhizosphere | IRSRFMKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA* |
| Ga0105249_101150972 | 3300009553 | Switchgrass Rhizosphere | MKCWREPSLEDILSDPITQAVISADAVDTGELDALLRRVAHKRRSAQRSASATA* |
| Ga0126376_122480942 | 3300010359 | Tropical Forest Soil | MNCWREPSLEDILSDPITKAVIEADGVDMHELGAMLRQIAQQRRTGVSATMRV* |
| Ga0126377_100329842 | 3300010362 | Tropical Forest Soil | MTCWREPSLEDILSDPIVKAVIEADGVDTNELDAMLRRVAHKRRVGFSAATRQ* |
| Ga0126377_101594592 | 3300010362 | Tropical Forest Soil | MNCWREPSLEDILSDPITQAVISADGVDTGELDAMLRCVAHKRRKAEGALLTKMR* |
| Ga0134125_113966652 | 3300010371 | Terrestrial Soil | MKCWREPSLEDILSDPITQAVISADGVDTNKLDAMLRHVANTRRSTANSIGRGG* |
| Ga0134125_127278412 | 3300010371 | Terrestrial Soil | MKCWREPSLEDILSDPITQAVISADRVDANELDAMLRRVAQSRRLVADSIGQGR* |
| Ga0134126_118504632 | 3300010396 | Terrestrial Soil | MKCWREPSPEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVGRSGATAWL* |
| Ga0157349_10367911 | 3300012489 | Unplanted Soil | LEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA* |
| Ga0157341_10188831 | 3300012494 | Arabidopsis Rhizosphere | EPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA* |
| Ga0157315_10025482 | 3300012508 | Arabidopsis Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASAT |
| Ga0157326_10068292 | 3300012513 | Arabidopsis Rhizosphere | SLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA* |
| Ga0157303_100009341 | 3300012896 | Soil | MKCWREPSLEDILSDPITQAVISADRVDASELDAMLRRVAQSRR |
| Ga0157288_1000002112 | 3300012901 | Soil | MKCYRELCLEDMLADPIIQAVIGADGVDANELDAMLRGVAHERRSAERMASAAWRR* |
| Ga0157283_100212151 | 3300012907 | Soil | QAIRSRFMKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA* |
| Ga0157308_103088472 | 3300012910 | Soil | MNYCREPSLEDILSDPIIKAVIDADGVDANELGAMLRRVANARRLAADSVGRGW* |
| Ga0164241_110428562 | 3300012943 | Soil | MNYCREPSLEDILSDPIIKAVIDADGVDANELGAMLRRVANTRRLAADSVGRGW* |
| Ga0126375_100088506 | 3300012948 | Tropical Forest Soil | MTYWREPSLEDILSDPIVKAVIDADDVDTNELDAMLRRVAHKRRVDFGATMRQ* |
| Ga0164308_105109961 | 3300012985 | Soil | MKCWREPSLEDILSDPITQAVISADGVDENELDAMLRRVAHTRRSTADSIGRGR* |
| Ga0075301_10675531 | 3300014262 | Natural And Restored Wetlands | CWREPSLEDILSDPLTQAVISADGVDANELDAMLRRVAHKRRSAAGGKGDGVGVVS* |
| Ga0075353_11200531 | 3300014321 | Natural And Restored Wetlands | RSRSMKCWRELSLEDILSDPLTQAVISADGVDANELDAMLRRVAHQRRSAADSIGRGR* |
| Ga0132258_102822872 | 3300015371 | Arabidopsis Rhizosphere | MIFCRNKKPGVSPMRECREPSLQDILSDPITQAVISADGVDTGELDAMLRQVAQKRRSAADSMGRGR* |
| Ga0132258_130555922 | 3300015371 | Arabidopsis Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDANELDAMLRRVAHKRRSAANSIGRGR* |
| Ga0132256_1025756032 | 3300015372 | Arabidopsis Rhizosphere | MIFCRNKKPGVSPMRACREPSLQDILSDPITQAVISADGVDTGELDAMLRQVAQKRRSAADSMGRGR* |
| Ga0132257_1009552132 | 3300015373 | Arabidopsis Rhizosphere | MKCYRELSLEDMLADPIIQAVIDADGVDANELDAMLRGVAHERRSAERMASAAWRRW* |
| Ga0132255_1026973132 | 3300015374 | Arabidopsis Rhizosphere | CWREPSLEDILSDPITQAVISADRVDASELDAMLRRVAQSRRLVGDSIGQGR* |
| Ga0132255_1046081451 | 3300015374 | Arabidopsis Rhizosphere | MKCWREPSLEDILSDPITQAVISADRVDANELDDMLRRLAQSRRLV |
| Ga0173481_100004472 | 3300019356 | Soil | MKCYRELSLEDMLADPIIQAVIDADGVDANELDAMLRGVAHERRSAERMASAAWRR |
| Ga0126371_120079111 | 3300021560 | Tropical Forest Soil | MKCWREPSLEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVGHSGATAWL |
| Ga0247747_10035981 | 3300022737 | Soil | MKCWREPSLEDILSDPITQAVISADGVDTGELDALLRRVAHKRRSAQ |
| Ga0247788_10059672 | 3300022901 | Soil | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA |
| Ga0210132_10144632 | 3300025538 | Natural And Restored Wetlands | MKCWREPSLEDILSDPLTQAVISADGVDANELDAMLRRVAHKRRSAAGGKGDGVGVVS |
| Ga0207710_100723852 | 3300025900 | Switchgrass Rhizosphere | MKCWREPSLEDILSDPITQAVISADRVDASELDAMLRRVAQSRRLVGDSIGQGR |
| Ga0207688_100146202 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDTGELDALLRRVAHKRRSAQRSASATA |
| Ga0207645_101403781 | 3300025907 | Miscanthus Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDANELDAMLRRVEHKRRSAPDSIGRGR |
| Ga0207707_103116792 | 3300025912 | Corn Rhizosphere | MKCWREPSLEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVGRSGATAWL |
| Ga0207660_101249852 | 3300025917 | Corn Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRQVAHKRRSVRRSAGATA |
| Ga0207650_105047561 | 3300025925 | Switchgrass Rhizosphere | DAMKCYRELSLEDMLADPIIQAVIDADGVDANELDAMLRGVAHERRSAERMASAAWRR |
| Ga0207690_116961311 | 3300025932 | Corn Rhizosphere | MKCWREPSPEDILSDPIVKAVIEADGVDTNELDAMLRQIAHKRSVGRSGATAWL |
| Ga0210116_10200792 | 3300025959 | Natural And Restored Wetlands | MKCWREPSLEDILSDPLTQAVISADGVDANELDAMLRRVAHKRRSAAGGKGDGIGVVS |
| Ga0210090_10161123 | 3300025965 | Natural And Restored Wetlands | MKCWRELSLEDILSDPLTQAVISADGVDANELDAMLRRVAHQRRSAADSIGRGR |
| Ga0210117_10212672 | 3300025985 | Natural And Restored Wetlands | MKCWRELSLEDILSDPLTQAVISADGVDANELDAMLRCVAHQRRSAADSIGRGR |
| Ga0207703_101030681 | 3300026035 | Switchgrass Rhizosphere | MKCWREPSLEDILSDPITQAVISADRVDASELDAMLRRVAQSRRLVGDSIG |
| Ga0207674_111877511 | 3300026116 | Corn Rhizosphere | CWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSASATA |
| Ga0207474_1020811 | 3300026725 | Soil | MKCYRELSLEDMLADPIIQAVIDADGVDANELDAMLRGVAHERRSAERMASAA |
| Ga0208761_10131732 | 3300026995 | Soil | MKCWREPSLEDILSDPITQAVISADGVNTGELDAMLRWVAHKRRSAQRSASATA |
| Ga0209073_102497692 | 3300027765 | Agricultural Soil | LEDILSDPITQAVISADGVDTGELDAMLRGVVQKRRSAERATGAAFWRR |
| Ga0209177_104865321 | 3300027775 | Agricultural Soil | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRGVVQKRRSAERATGAAFW |
| Ga0209813_100628472 | 3300027866 | Populus Endosphere | MKCYRELSLEDMLADPIIQAVIDAVGVDANELDAMLRGVAHERRSAERMASAAWRR |
| Ga0209974_100599242 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MKCWREPSLEDILSDPITQAVISADGVDTGELDAMLRRVAHKRRSAQRSAGATA |
| Ga0247750_10028921 | 3300027992 | Soil | MKCYRELSLEDMLADPIIQAVIDADGVDANELDAMLRGVAHERRSAERMASA |
| (restricted) Ga0255311_10002486 | 3300031150 | Sandy Soil | MKCWREPSLEDILSDPITQAVISADGVDIGELDAMLRQVAHKRRSARRSAGATA |
| (restricted) Ga0255311_11183631 | 3300031150 | Sandy Soil | MKCWREPSLEDILSDPITQAVISADGVDTGVLDAMLRQVAHKRRSARRSAGATA |
| (restricted) Ga0255310_100320882 | 3300031197 | Sandy Soil | MKCWREPSLEDILSDPITQAVISADGVDANELDAMLRRVAHKRRSAADSIGRGR |
| Ga0310813_100192582 | 3300031716 | Soil | MKCWREPSLEDILSDPITQAVISADGVDANELDAMLRHVAHKRRSTADSIGRGR |
| Ga0307469_124757191 | 3300031720 | Hardwood Forest Soil | KPGVSPMRACREPSLQDILSDPIIQAVISADGVDPGELDLMLRQVAQKRRSVADSIGRGR |
| Ga0307468_1000147913 | 3300031740 | Hardwood Forest Soil | MNYCREPSLEDILSDPIIKAVIDADGVNANELGAMLRRIANTRRLAAESASRGW |
| Ga0310892_105441852 | 3300031858 | Soil | MRACREPSLQDILSDPITQAVISADGVDTGELDAMLRQVAQKRRSAADSMGRGR |
| Ga0310891_100042952 | 3300031913 | Soil | MKCWREPSLEDILSDPITQAVISADAVDTGELDALLRRVAHKRRSAQRSASATA |
| Ga0310891_101239502 | 3300031913 | Soil | MKCYRELSLEDMLADPIIQAVIDADGVDANELDAMLRGVAHERRSAE |
| Ga0307470_106501752 | 3300032174 | Hardwood Forest Soil | MNYCREPSLEDILSDPIIKAVIDADGVNANELGAMLRRIANTRRLAA |
| Ga0307470_116754222 | 3300032174 | Hardwood Forest Soil | MRACREPSLQDILSDPIIQAVISADGVDPGELDAMLRQVAQKRRSTADSIGRGR |
| Ga0307472_1006235682 | 3300032205 | Hardwood Forest Soil | MNCWREPSLEDILSDPITQAVISADGVDTGELDAMLRCVAQKRRSAERSAGAALWRR |
| Ga0316628_1002521831 | 3300033513 | Soil | MTCYREPSLEDILSDPITQAVISADGVDPGQLNTMLRCVAQKRRSAEAAQRFQK |
| ⦗Top⦘ |