Basic Information | |
---|---|
Family ID | F082638 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 41 residues |
Representative Sequence | KGDRIAEEFQQIVADYVRATYGGEPPAAHLKPEKKTIGVKAVA |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.23 % |
% of genes from short scaffolds (< 2000 bps) | 92.92 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.327 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.080 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.283 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.628 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF13393 | tRNA-synt_His | 75.22 |
PF01128 | IspD | 7.08 |
PF09976 | TPR_21 | 3.54 |
PF00313 | CSD | 1.77 |
PF04551 | GcpE | 1.77 |
PF08534 | Redoxin | 0.88 |
PF10518 | TAT_signal | 0.88 |
PF13185 | GAF_2 | 0.88 |
PF01926 | MMR_HSR1 | 0.88 |
PF16360 | GTP-bdg_M | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 7.08 |
COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 7.08 |
COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 7.08 |
COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 7.08 |
COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 1.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 51.33 % |
Unclassified | root | N/A | 48.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000443|F12B_10082410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1113 | Open in IMG/M |
3300001593|JGI12635J15846_10573320 | Not Available | 659 | Open in IMG/M |
3300004146|Ga0055495_10108051 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300005171|Ga0066677_10341843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 857 | Open in IMG/M |
3300005331|Ga0070670_100830062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 836 | Open in IMG/M |
3300005331|Ga0070670_101124730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 717 | Open in IMG/M |
3300005331|Ga0070670_102260672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 501 | Open in IMG/M |
3300005366|Ga0070659_101957679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 526 | Open in IMG/M |
3300005544|Ga0070686_100349723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1110 | Open in IMG/M |
3300005552|Ga0066701_10452968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
3300005554|Ga0066661_10546651 | Not Available | 694 | Open in IMG/M |
3300005560|Ga0066670_10582540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 682 | Open in IMG/M |
3300005616|Ga0068852_100864369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300005617|Ga0068859_100307368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1679 | Open in IMG/M |
3300005718|Ga0068866_10273673 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300005843|Ga0068860_102231367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 568 | Open in IMG/M |
3300005844|Ga0068862_100467512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1191 | Open in IMG/M |
3300005952|Ga0080026_10106988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 784 | Open in IMG/M |
3300005993|Ga0080027_10089038 | Not Available | 1149 | Open in IMG/M |
3300006050|Ga0075028_101083901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 502 | Open in IMG/M |
3300006605|Ga0074057_11312075 | Not Available | 956 | Open in IMG/M |
3300006606|Ga0074062_12877836 | Not Available | 649 | Open in IMG/M |
3300006796|Ga0066665_11237071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 571 | Open in IMG/M |
3300006797|Ga0066659_10417185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1059 | Open in IMG/M |
3300006804|Ga0079221_10227608 | Not Available | 1042 | Open in IMG/M |
3300006881|Ga0068865_100125409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1916 | Open in IMG/M |
3300006954|Ga0079219_11469652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
3300009053|Ga0105095_10484280 | Not Available | 686 | Open in IMG/M |
3300009101|Ga0105247_10009581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 5878 | Open in IMG/M |
3300009137|Ga0066709_100062205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 4314 | Open in IMG/M |
3300009165|Ga0105102_10506916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 656 | Open in IMG/M |
3300009179|Ga0115028_10515761 | Not Available | 872 | Open in IMG/M |
3300009685|Ga0116142_10528312 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300010339|Ga0074046_10455467 | Not Available | 767 | Open in IMG/M |
3300010366|Ga0126379_13022518 | Not Available | 563 | Open in IMG/M |
3300010401|Ga0134121_11717968 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300010403|Ga0134123_10132470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2035 | Open in IMG/M |
3300011119|Ga0105246_11565014 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300012469|Ga0150984_118045635 | Not Available | 540 | Open in IMG/M |
3300012479|Ga0157348_1018107 | Not Available | 575 | Open in IMG/M |
3300012683|Ga0137398_11131664 | Not Available | 538 | Open in IMG/M |
3300012986|Ga0164304_10219878 | Not Available | 1253 | Open in IMG/M |
3300013102|Ga0157371_10450439 | Not Available | 946 | Open in IMG/M |
3300013306|Ga0163162_10034056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 5067 | Open in IMG/M |
3300014323|Ga0075356_1174456 | Not Available | 566 | Open in IMG/M |
3300014874|Ga0180084_1114138 | Not Available | 565 | Open in IMG/M |
3300014968|Ga0157379_11020185 | Not Available | 789 | Open in IMG/M |
3300014969|Ga0157376_11216817 | Not Available | 782 | Open in IMG/M |
3300014969|Ga0157376_11250195 | Not Available | 772 | Open in IMG/M |
3300015372|Ga0132256_103263664 | Not Available | 545 | Open in IMG/M |
3300015373|Ga0132257_101611767 | Not Available | 830 | Open in IMG/M |
3300015373|Ga0132257_103120703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 603 | Open in IMG/M |
3300016319|Ga0182033_10978512 | Not Available | 752 | Open in IMG/M |
3300016357|Ga0182032_10874300 | Not Available | 763 | Open in IMG/M |
3300017944|Ga0187786_10364554 | Not Available | 615 | Open in IMG/M |
3300017974|Ga0187777_11299042 | Not Available | 534 | Open in IMG/M |
3300018060|Ga0187765_10677448 | Not Available | 674 | Open in IMG/M |
3300018064|Ga0187773_10114217 | Not Available | 1349 | Open in IMG/M |
3300018083|Ga0184628_10157436 | Not Available | 1183 | Open in IMG/M |
3300019362|Ga0173479_10256387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 773 | Open in IMG/M |
3300021082|Ga0210380_10150886 | Not Available | 1043 | Open in IMG/M |
3300021478|Ga0210402_11839317 | Not Available | 531 | Open in IMG/M |
3300024347|Ga0179591_1025951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4341 | Open in IMG/M |
3300025903|Ga0207680_10453491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 910 | Open in IMG/M |
3300025903|Ga0207680_11132588 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300025903|Ga0207680_11355471 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300025922|Ga0207646_10740816 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300025933|Ga0207706_11567288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300025936|Ga0207670_11347437 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300025937|Ga0207669_10477129 | Not Available | 993 | Open in IMG/M |
3300025945|Ga0207679_11919130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 540 | Open in IMG/M |
3300025960|Ga0207651_10006654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae | 6080 | Open in IMG/M |
3300026041|Ga0207639_11236216 | Not Available | 701 | Open in IMG/M |
3300026078|Ga0207702_11418632 | Not Available | 688 | Open in IMG/M |
3300026310|Ga0209239_1094676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1274 | Open in IMG/M |
3300026335|Ga0209804_1296208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 553 | Open in IMG/M |
3300027885|Ga0209450_10312241 | Not Available | 1137 | Open in IMG/M |
3300027900|Ga0209253_10774326 | Not Available | 685 | Open in IMG/M |
3300028381|Ga0268264_12102376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 573 | Open in IMG/M |
3300028590|Ga0247823_10753552 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300028665|Ga0302160_10085015 | Not Available | 680 | Open in IMG/M |
3300028679|Ga0302169_10129184 | Not Available | 626 | Open in IMG/M |
3300028736|Ga0302214_1065673 | Not Available | 750 | Open in IMG/M |
3300028743|Ga0302262_10232556 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300028856|Ga0302295_1116645 | Not Available | 601 | Open in IMG/M |
3300030339|Ga0311360_10817487 | Not Available | 740 | Open in IMG/M |
3300030838|Ga0311335_10079250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2086 | Open in IMG/M |
3300031720|Ga0307469_11523046 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300031726|Ga0302321_100417497 | Not Available | 1464 | Open in IMG/M |
3300031726|Ga0302321_103180398 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031777|Ga0318543_10472930 | Not Available | 562 | Open in IMG/M |
3300031795|Ga0318557_10307199 | Not Available | 728 | Open in IMG/M |
3300031820|Ga0307473_11479161 | Not Available | 514 | Open in IMG/M |
3300031942|Ga0310916_11274023 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300031943|Ga0310885_10387884 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300031947|Ga0310909_10211505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1614 | Open in IMG/M |
3300031981|Ga0318531_10353524 | Not Available | 664 | Open in IMG/M |
3300031997|Ga0315278_11138411 | Not Available | 769 | Open in IMG/M |
3300031997|Ga0315278_11903820 | Not Available | 558 | Open in IMG/M |
3300032060|Ga0318505_10493858 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300032060|Ga0318505_10619441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 508 | Open in IMG/M |
3300032076|Ga0306924_11243067 | Not Available | 803 | Open in IMG/M |
3300032122|Ga0310895_10087224 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300032143|Ga0315292_10671914 | Not Available | 871 | Open in IMG/M |
3300032397|Ga0315287_10391417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1646 | Open in IMG/M |
3300032401|Ga0315275_10971115 | Not Available | 935 | Open in IMG/M |
3300032770|Ga0335085_10378334 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
3300033481|Ga0316600_10159300 | Not Available | 1442 | Open in IMG/M |
3300033483|Ga0316629_11005392 | Not Available | 655 | Open in IMG/M |
3300033485|Ga0316626_10033981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3330 | Open in IMG/M |
3300033488|Ga0316621_11199696 | Not Available | 573 | Open in IMG/M |
3300033513|Ga0316628_101332723 | Not Available | 956 | Open in IMG/M |
3300034354|Ga0364943_0419159 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.08% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.08% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.31% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.77% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.77% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.77% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.77% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.89% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.89% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012479 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610 | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
3300028856 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4 | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F12B_100824102 | 3300000443 | Soil | EEFQRIVDDYLRATYGGEPRAAHLSPAKKTITVKAIG* |
JGI12635J15846_105733201 | 3300001593 | Forest Soil | EFQQIVADYVRATYGGEPATAHLKPTARTNTIAIKAVG* |
Ga0055495_101080511 | 3300004146 | Natural And Restored Wetlands | KGERIAEEFQRIVEDYVRATYGGEARAPALDPERRTIALKAHA* |
Ga0066677_103418432 | 3300005171 | Soil | TLKGDRIAEEFMAIVTDYIRATYGGEPATAALKPAAKAIDLKALA* |
Ga0070670_1008300622 | 3300005331 | Switchgrass Rhizosphere | KGGRIAEEFEALVEAYVRATYGGEPGSPALKPQKKTIAVKAVA* |
Ga0070670_1011247302 | 3300005331 | Switchgrass Rhizosphere | TLKGDNIAIEFQRIVDDYVRATYGGEPRAAHLTPEKKSAGKAIA* |
Ga0070670_1022606722 | 3300005331 | Switchgrass Rhizosphere | GGRIAEEFEALVDAYVRATYGGEAAPPSLKPQKKTIAVKAVA* |
Ga0070659_1019576791 | 3300005366 | Corn Rhizosphere | KTVTLKGAGIAEEFQEIVADYVRSTYGGEPPSAHLKPEKKSIQLKAVG* |
Ga0070686_1003497232 | 3300005544 | Switchgrass Rhizosphere | KGDHIAEEFERIVFDYVRATYGGEPAAPHLRPEKKWIGIRHA* |
Ga0066701_104529681 | 3300005552 | Soil | ERIAEEFQQIVADYVRATYGGEPPGRHLKPDRKSVAIKAVA* |
Ga0066661_105466512 | 3300005554 | Soil | EFIAIVTDYVRATYGGEPATPSLRPAAKSIVLKALA* |
Ga0066670_105825402 | 3300005560 | Soil | ERIAEEFQQIVADYVRATYGGEPATAHLKPAARTNTIAIAVKAII* |
Ga0068852_1008643691 | 3300005616 | Corn Rhizosphere | LKGDSIAREFQVIVNDYVRATYGGEEPAPHLRPERKVTPIHHA* |
Ga0068859_1003073681 | 3300005617 | Switchgrass Rhizosphere | RIAEDFQRIVEDYVRATYGGEARAAHLSPRSKTIAVKALT* |
Ga0068866_102736733 | 3300005718 | Miscanthus Rhizosphere | TLKGERIAEEFGRIVDDYVRATYGGETPAPHLRPERKSIAVKAV* |
Ga0068860_1022313671 | 3300005843 | Switchgrass Rhizosphere | IGEEFLQIVADYVRATYGGEPSAPHLRPAKRTIAIKNS* |
Ga0068862_1004675123 | 3300005844 | Switchgrass Rhizosphere | HKTVTLKGDHIAEEFERIVFDYVRATYGGEPAAPHLRPEKKWIGIRHA* |
Ga0080026_101069882 | 3300005952 | Permafrost Soil | LKGERIAEEFQQIVADYVRATYGGEPATAHLKPTARTVPIAIAVKAVV* |
Ga0080027_100890381 | 3300005993 | Prmafrost Soil | FHVIVEDYVRATYGGEPPAAHLKPERKSVALKVVA* |
Ga0075028_1010839012 | 3300006050 | Watersheds | KGDRIAEEFQALVHDYVRATYGGEEPAAHLKPDRKTIPLKAAV* |
Ga0074057_113120752 | 3300006605 | Soil | LRAIVEDYVRATYGGEPAAAHLKPDRKSLALKVVA* |
Ga0074062_128778362 | 3300006606 | Soil | EEFQAIVEDYVRATYGGEPPTAHLKPDRKSLALKVIA* |
Ga0066665_112370711 | 3300006796 | Soil | LRGERIAEEFQLIVEDYVRATYGGEPPAPHLKPDRKSTALKVVAKVT* |
Ga0066659_104171851 | 3300006797 | Soil | KGDRIAEEFIAIVTDYVRATYGGEPATSNLRPAAKSIALKALA* |
Ga0079221_102276081 | 3300006804 | Agricultural Soil | EAFQEIVADYVRATYGGEPPSAHLKPEKKSIQLKAVG* |
Ga0068865_1001254091 | 3300006881 | Miscanthus Rhizosphere | KTVTLKGERIAEEFEQIVFDYVRATYGGEPAAPHLRPEKKWIGIKHI* |
Ga0079219_114696521 | 3300006954 | Agricultural Soil | GERIAEEFQQIVADYVRATYGDEPAAAHLKPEKKSIAVKAIG* |
Ga0105095_104842801 | 3300009053 | Freshwater Sediment | KGERIAEEFQRIVEDYVRATYGGEARTSALDPERRTIALKAHA* |
Ga0105247_100095817 | 3300009101 | Switchgrass Rhizosphere | VTLKGAGIAEEFQEIVADYVRSTYGGEPPSAHLKPEKKSIQLKAVG* |
Ga0066709_1000622051 | 3300009137 | Grasslands Soil | EFIAIVTDYVRATYGGEPATFNLRPTAKSIAVEALAWNRQ* |
Ga0105102_105069162 | 3300009165 | Freshwater Sediment | QFQQIVDDYVRATYGGEPRTSALDPDRRTIGVKAVV* |
Ga0115028_105157612 | 3300009179 | Wetland | LRGEGIADEFQRIVDDYVRATYGGEPRAAHLTPERRTIGVKSLL* |
Ga0116142_105283123 | 3300009685 | Anaerobic Digestor Sludge | FGVIVADYVRATYGGEEPAPHLRPERATIGLKVVTGH* |
Ga0074046_104554672 | 3300010339 | Bog Forest Soil | EFQQIIFDYVRATYGGEVPAPHLKPDRQAINVKAIA* |
Ga0126379_130225182 | 3300010366 | Tropical Forest Soil | AAEFQRIVDDYVRATYGGEPRAAHLSPEKKATAGKAIA* |
Ga0134121_117179681 | 3300010401 | Terrestrial Soil | ERIAEEFQALVHDYVRATYGGESPGPHLKPDRKTIAIKSATAQVP* |
Ga0134123_101324701 | 3300010403 | Terrestrial Soil | IAEEFQQLVADYVRSTYGGEPPSAHLKPEKKSIQLKAVG* |
Ga0105246_115650141 | 3300011119 | Miscanthus Rhizosphere | TLKGERIAQEFQELVHDYVRATYGGESPGPHLKPDRKTIAIKSATAQVP* |
Ga0150984_1180456351 | 3300012469 | Avena Fatua Rhizosphere | QSLVDAYVRSTYGGEPAAPELLPAKKTIAVKAIA* |
Ga0157348_10181072 | 3300012479 | Unplanted Soil | KGDDIAAELQRIVDDYVRATYGGEPRDAHLTPEKKTAGKVVA* |
Ga0137398_111316641 | 3300012683 | Vadose Zone Soil | RGERIAEEFQLIVEDYVRATYGGEPPAPHLKPDRKSTALKVVAKVT* |
Ga0164304_102198781 | 3300012986 | Soil | IAEEFERIVVDYVRATYGGEAKSAALVPQQKTIAVKAIA* |
Ga0157371_104504391 | 3300013102 | Corn Rhizosphere | QQLVADYVRSTYGGEPPSAHLKPEKKSIQLKAVG* |
Ga0163162_100340561 | 3300013306 | Switchgrass Rhizosphere | KTVTLKGDHIAEEFERIVFDYVRATYGGEPAAPHLRPEKKWIGIRHA* |
Ga0075356_11744561 | 3300014323 | Natural And Restored Wetlands | FQQIVEDYVRTTYGGALRAPHLTPERRTIAIKAQ* |
Ga0180084_11141381 | 3300014874 | Soil | EFEEIIVDYVRATYGGEEPAPHLKPDRKTIAVKAAM* |
Ga0157379_110201851 | 3300014968 | Switchgrass Rhizosphere | QRMVEDYVRATYGGEARAAHLSPRSKTIAVKAVT* |
Ga0157376_112168171 | 3300014969 | Miscanthus Rhizosphere | DDIATEFQRIVDDYVRTTYGGEPRAAHLTPGKKTSGKVVA* |
Ga0157376_112501951 | 3300014969 | Miscanthus Rhizosphere | EFQRIVDDYVRATYGGEPAAAHLKPERKTINVKAVV* |
Ga0132256_1032636642 | 3300015372 | Arabidopsis Rhizosphere | AQEFQALVHDYVRATYGGETPGPHLKPDRKTIAIKTAAAQVP* |
Ga0132257_1016117671 | 3300015373 | Arabidopsis Rhizosphere | AEEFQQIVADYVAATYGGAPRAAHLTPAKKTIAVKAVE* |
Ga0132257_1031207031 | 3300015373 | Arabidopsis Rhizosphere | KTVTLKGDAIAEEFQRIVTDYVRTAYGGEPAAPHLWPAKKQIALVRKA* |
Ga0182033_109785121 | 3300016319 | Soil | KGDRIAEEFQQIVADYVRATYGGEPPAAHLKPEKKTIGVKAVA |
Ga0182032_108743002 | 3300016357 | Soil | VTLKGDNIATEFQRIVDDYVRTTYGGEPRAAHLTPEKKTTAGKAIA |
Ga0187786_103645542 | 3300017944 | Tropical Peatland | TLKGERIAEDFTGIVEDYVRATYGGEPRAAHLDPERRTIAVKALA |
Ga0187777_112990422 | 3300017974 | Tropical Peatland | EEFQALVDDYVRATYGGEPMSPSLTPAKKTIAVKAIA |
Ga0187765_106774482 | 3300018060 | Tropical Peatland | GERIAEEFQAIVEDYVRATYGGEPPAAHLKPERKSLALKVVA |
Ga0187773_101142172 | 3300018064 | Tropical Peatland | DNIAAEFQRIVDDYVRATYGGEPRAPHLTPEKKTATGKAIA |
Ga0184628_101574361 | 3300018083 | Groundwater Sediment | FQQIVLDYVRATYGGEARAAHLSPRQKTIGVKAVA |
Ga0173479_102563871 | 3300019362 | Soil | TVTLKGDHIAEEFERIVFDYVRATYGGEPAAPHLRPEKKWIGIRHA |
Ga0210380_101508862 | 3300021082 | Groundwater Sediment | QALVHDYVRATYGGETPGPHLKPDRKTIAIKSAAAQVP |
Ga0210402_118393172 | 3300021478 | Soil | AEEFQQIVADYVRATYGGEPATAHLKPTVKTIAVKAVI |
Ga0179591_10259513 | 3300024347 | Vadose Zone Soil | MDKRTVTLKGDTIAEDFERIIADYVRATYGGEPPAPHLRPEKKSIAIRSLK |
Ga0207680_104534911 | 3300025903 | Switchgrass Rhizosphere | TLKGDAIGEEFLQIVGDYVRATYGGEPPAPHLRPAKKTIAIKNSQ |
Ga0207680_111325883 | 3300025903 | Switchgrass Rhizosphere | KGERIAEEFGAIVDDYVRATYGGETPAPHLRPERKSIAVKAV |
Ga0207680_113554712 | 3300025903 | Switchgrass Rhizosphere | TVTLKGERIAEEFEQIVFDYVRATYGGEPAAPHLRPEKKWIGIKHI |
Ga0207646_107408161 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GIAEAFQEIVADYVRATYGGEPPSAHLKPEKKSIQLKAVG |
Ga0207706_115672882 | 3300025933 | Corn Rhizosphere | LKGDGIAEEFQRIVTDYVRTAYGGEPAAPHLRPAKKQIALVRKL |
Ga0207670_113474371 | 3300025936 | Switchgrass Rhizosphere | RIAQEFQELVHDYVRATYGGESPGPHLKPDRKTIAIKSATAQVP |
Ga0207669_104771291 | 3300025937 | Miscanthus Rhizosphere | ALVHDYVRATYGGETPGPHLKPDRRTIAIKPAAAQVP |
Ga0207679_119191301 | 3300025945 | Corn Rhizosphere | VTLKGNSIAEEFEKIVLDYVRATYGGEPAGPHLRPEKKWIGIKQS |
Ga0207651_100066541 | 3300025960 | Switchgrass Rhizosphere | KGAGIAEEFQEIVADYVRSTYGGEPPSAHLKPEKKSIQLKAVG |
Ga0207639_112362162 | 3300026041 | Corn Rhizosphere | AEEFEALVEAYVRATYGGEPAVPALKPQHKTIAVKAVA |
Ga0207702_114186322 | 3300026078 | Corn Rhizosphere | LKGAGIAEAFQEIVADYVRATYGGEPPSAHLKPEKKSIQLKAVG |
Ga0209239_10946762 | 3300026310 | Grasslands Soil | TLKGERIAEEFQQIVADYVRATYGGEPATAHLKPAARTNTIAIAVKAII |
Ga0209804_12962082 | 3300026335 | Soil | ERIAEEFQQIVADYVRATYGGEPATAHLKPAARTNTIAIAVKAII |
Ga0209450_103122411 | 3300027885 | Freshwater Lake Sediment | RIAEEFQRIVEDYVRATYGGEARTSALDPERRTIALKAQA |
Ga0209253_107743262 | 3300027900 | Freshwater Lake Sediment | AEEFQRIVDDYVRATYGGLPRTAQLDPERKTIAVKAIA |
Ga0268264_121023761 | 3300028381 | Switchgrass Rhizosphere | KGDHIAEEFERIVFDYVRATYGGEPAAPHLRPEKKWIGIRHV |
Ga0247823_107535521 | 3300028590 | Soil | AEEFGTIVADYVRATYGGETPAPHLRPERKSIAVKQA |
Ga0302160_100850151 | 3300028665 | Fen | FQALVHDYVRATYGGEEPAAHLKPERKTIAVKAVA |
Ga0302169_101291842 | 3300028679 | Fen | AEEFQRIVDDYVRATWGGEPRAAHLDPERRSIALKVTG |
Ga0302214_10656731 | 3300028736 | Fen | VTLKGDHIAREFQELVHDYVRATYGGEEPAPHLKPDRKTIAVKAVV |
Ga0302262_102325562 | 3300028743 | Fen | FQALVHDYVRATYGGEEPAAHLKPERRTIAVKAVA |
Ga0302295_11166452 | 3300028856 | Fen | TLKGDRIAEEFQRIVDDYVRATWGGEPRAAHLDPERRSIALKAVG |
Ga0311360_108174872 | 3300030339 | Bog | VTLKGDRIAEEFQRIVDDYVRATWGGEPRAAHLDPERRSIALKAVG |
Ga0311335_100792501 | 3300030838 | Fen | LKGDHIAQDFQALVHDYVRATYGGEEPAAHLKPERRTIAVKAVA |
Ga0307469_115230461 | 3300031720 | Hardwood Forest Soil | GEHIAEEFQQIVADYVRATYGGEPATAHLKPTVKTIAVKAVI |
Ga0302321_1004174971 | 3300031726 | Fen | DHIAQEFQALVHDYVRATYGGEEPAAHLKPERKTIAVKAVA |
Ga0302321_1031803982 | 3300031726 | Fen | LKGDHIAQEFQALVHDYVRATYGGEEPAAHLKPERRTIAVKAAV |
Ga0318543_104729301 | 3300031777 | Soil | TVTLKGARIAEEFQRIVEDYVRAKYGGEPPTPELLPASRTIPMKAVV |
Ga0318557_103071992 | 3300031795 | Soil | IATEFQRIVDDYVRTTYGGEPRAAHLTPEKKTTAGKAIA |
Ga0307473_114791612 | 3300031820 | Hardwood Forest Soil | KTVTLKGERVAEEFQQIIAAYVRATYGGEPSELPLKGAKKTINIKAVA |
Ga0310916_112740232 | 3300031942 | Soil | KGERIAEEFLEIVTDYVRATYGGEPPGPHLKPDRKSLSIKAIA |
Ga0310885_103878843 | 3300031943 | Soil | TLKGERIAEEFGTIVADYVRATYGGETPAPHLRPERKSIAVKQA |
Ga0310909_102115051 | 3300031947 | Soil | VTLKGARIAEEFQRIVEDYVRAKYGGEPPTPELLPASRTIPMKAVV |
Ga0318531_103535242 | 3300031981 | Soil | FLEIVTDYVRATYGGEPPGPHLKPDRKSLSIKAIA |
Ga0315278_111384112 | 3300031997 | Sediment | GDGIAVEFQRIVDDYVRATYGGEPRAAHLTPEKKTIAVKAIA |
Ga0315278_119038202 | 3300031997 | Sediment | RGDGIAVEFQRIVDDYVRATYGGEPRAAHLTPERKSIPVKALI |
Ga0318505_104938581 | 3300032060 | Soil | FQKIVADYVRATYGGEPPAAHLKPEKKTIGVKAVA |
Ga0318505_106194411 | 3300032060 | Soil | AEEFQQIVADYVRATYGGEPPAAHLKPEKKTIGVKAVV |
Ga0306924_112430672 | 3300032076 | Soil | ERIAEEFLEIVTDYVRATYGGEPPGPHLKPDRKSLSIKAIA |
Ga0310895_100872241 | 3300032122 | Soil | KGERIAEEFGAIVADYVRATYGGETPAPHLRPERKSIAVKQV |
Ga0315292_106719141 | 3300032143 | Sediment | RGDGIAVEFQRIVDDYVRATYGGEPRAAHLTPERKSIPVKALL |
Ga0315287_103914173 | 3300032397 | Sediment | GERIAEEFEQIVLDYVRATYGGEARAAHLSPRPKTIPLKAIA |
Ga0315275_109711152 | 3300032401 | Sediment | RIAEDFQRIVEDYVRATYGGEARAAHLSPARKTIAVKAVA |
Ga0335085_103783341 | 3300032770 | Soil | EEFQQIVADYVRATYGGEAPAAHLKPEKKSIPLKAAV |
Ga0316600_101593002 | 3300033481 | Soil | FQRIVEDYVRATYGGEARTSALDPERRTIAVKRVVA |
Ga0316629_110053921 | 3300033483 | Soil | ERIAEEFQQIVDDYVRATYGGEARAAHLSPAQRTIAVKALA |
Ga0316626_100339814 | 3300033485 | Soil | IAEEFQQIVDDYVRATYGGEARAAHLTPAQRTIAVKALA |
Ga0316621_111996961 | 3300033488 | Soil | LKGERIAEEFQRIVEDYVRATYGGEARTSALDPERRTIALKAHA |
Ga0316628_1013327231 | 3300033513 | Soil | ERIAEEFERIVEDYVRATYGGEPRSPALTPQQKTIAVKALA |
Ga0364943_0419159_1_132 | 3300034354 | Sediment | RIAQEFQALVHDYVRATYGGETPGPHLKPDRKTIAIKSAAQVP |
⦗Top⦘ |