Basic Information | |
---|---|
Family ID | F082599 |
Family Type | Metagenome |
Number of Sequences | 113 |
Average Sequence Length | 44 residues |
Representative Sequence | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEEE |
Number of Associated Samples | 69 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 80.53 % |
% of genes near scaffold ends (potentially truncated) | 16.81 % |
% of genes from short scaffolds (< 2000 bps) | 67.26 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (52.212 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (23.009 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.593 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.637 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 69.77% β-sheet: 0.00% Coil/Unstructured: 30.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF01381 | HTH_3 | 22.12 |
PF13830 | DUF4192 | 10.62 |
PF00565 | SNase | 1.77 |
PF06067 | DUF932 | 1.77 |
PF07659 | DUF1599 | 0.88 |
PF02467 | Whib | 0.88 |
PF13155 | Toprim_2 | 0.88 |
PF13252 | DUF4043 | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.23 % |
Unclassified | root | N/A | 1.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000558|Draft_11665239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300000882|FwDRAFT_10122669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300002161|JGI24766J26685_10017235 | All Organisms → Viruses → Predicted Viral | 1857 | Open in IMG/M |
3300002306|B570J29618_1003958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
3300004112|Ga0065166_10361659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300004240|Ga0007787_10148433 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
3300005527|Ga0068876_10036447 | All Organisms → Viruses → Predicted Viral | 3045 | Open in IMG/M |
3300005527|Ga0068876_10102271 | All Organisms → Viruses → Predicted Viral | 1707 | Open in IMG/M |
3300005527|Ga0068876_10147301 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
3300005527|Ga0068876_10191594 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
3300005527|Ga0068876_10264121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
3300005662|Ga0078894_10836880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300006639|Ga0079301_1000119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39119 | Open in IMG/M |
3300006641|Ga0075471_10006937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7179 | Open in IMG/M |
3300006863|Ga0075459_1005688 | All Organisms → Viruses → Predicted Viral | 2019 | Open in IMG/M |
3300006863|Ga0075459_1055847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300006875|Ga0075473_10047395 | All Organisms → Viruses → Predicted Viral | 1661 | Open in IMG/M |
3300008055|Ga0108970_10128864 | All Organisms → Viruses → Predicted Viral | 3346 | Open in IMG/M |
3300008055|Ga0108970_11762554 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
3300008107|Ga0114340_1003035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37140 | Open in IMG/M |
3300008107|Ga0114340_1014226 | All Organisms → Viruses → Predicted Viral | 3841 | Open in IMG/M |
3300008107|Ga0114340_1022328 | All Organisms → Viruses → Predicted Viral | 2970 | Open in IMG/M |
3300008107|Ga0114340_1072866 | All Organisms → Viruses → Predicted Viral | 2312 | Open in IMG/M |
3300008107|Ga0114340_1100808 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
3300008107|Ga0114340_1136911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
3300008107|Ga0114340_1194339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300008107|Ga0114340_1222917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300008107|Ga0114340_1238247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300008108|Ga0114341_10082447 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
3300008108|Ga0114341_10239076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
3300008108|Ga0114341_10477957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300008110|Ga0114343_1004593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7476 | Open in IMG/M |
3300008110|Ga0114343_1021896 | All Organisms → Viruses → Predicted Viral | 2808 | Open in IMG/M |
3300008110|Ga0114343_1078509 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
3300008110|Ga0114343_1148030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300008110|Ga0114343_1167036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300008113|Ga0114346_1061575 | All Organisms → Viruses → Predicted Viral | 1828 | Open in IMG/M |
3300008113|Ga0114346_1088343 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
3300008113|Ga0114346_1159924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
3300008113|Ga0114346_1208827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300008113|Ga0114346_1212697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
3300008113|Ga0114346_1245107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300008113|Ga0114346_1306974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300008117|Ga0114351_1274569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300008120|Ga0114355_1022584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6120 | Open in IMG/M |
3300008448|Ga0114876_1231244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300009085|Ga0105103_10194905 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300009158|Ga0114977_10448871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300009165|Ga0105102_10088142 | All Organisms → Viruses → Predicted Viral | 1437 | Open in IMG/M |
3300009194|Ga0114983_1109027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300011268|Ga0151620_1009513 | All Organisms → Viruses → Predicted Viral | 3502 | Open in IMG/M |
3300012000|Ga0119951_1001986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11697 | Open in IMG/M |
3300013004|Ga0164293_10037778 | All Organisms → Viruses → Predicted Viral | 3973 | Open in IMG/M |
3300013004|Ga0164293_10353620 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
3300013006|Ga0164294_10116856 | All Organisms → Viruses → Predicted Viral | 1959 | Open in IMG/M |
3300017766|Ga0181343_1101441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300019784|Ga0181359_1065724 | All Organisms → Viruses → Predicted Viral | 1381 | Open in IMG/M |
3300020048|Ga0207193_1004293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23406 | Open in IMG/M |
3300020159|Ga0211734_10506961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11995 | Open in IMG/M |
3300020161|Ga0211726_10651341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300020527|Ga0208232_1001216 | All Organisms → Viruses → Predicted Viral | 4781 | Open in IMG/M |
3300021961|Ga0222714_10215174 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
3300021962|Ga0222713_10225082 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300021963|Ga0222712_10419618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300022179|Ga0181353_1007049 | All Organisms → Viruses → Predicted Viral | 2721 | Open in IMG/M |
3300022752|Ga0214917_10016343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6367 | Open in IMG/M |
3300022752|Ga0214917_10021959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5178 | Open in IMG/M |
3300023174|Ga0214921_10015512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8681 | Open in IMG/M |
3300023174|Ga0214921_10087086 | All Organisms → Viruses → Predicted Viral | 2426 | Open in IMG/M |
3300025635|Ga0208147_1059737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300025732|Ga0208784_1021103 | All Organisms → Viruses → Predicted Viral | 2121 | Open in IMG/M |
3300027114|Ga0208009_1000030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39098 | Open in IMG/M |
3300027129|Ga0255067_1055684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300027139|Ga0255082_1057731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027508|Ga0255072_1082302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300027601|Ga0255079_1000056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25607 | Open in IMG/M |
3300027697|Ga0209033_1072694 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
3300027710|Ga0209599_10013374 | All Organisms → Viruses → Predicted Viral | 2438 | Open in IMG/M |
3300027793|Ga0209972_10122332 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
3300027805|Ga0209229_10025719 | All Organisms → Viruses → Predicted Viral | 2561 | Open in IMG/M |
3300027805|Ga0209229_10056356 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
3300027805|Ga0209229_10255648 | Not Available | 778 | Open in IMG/M |
3300027805|Ga0209229_10415194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300029349|Ga0238435_102236 | All Organisms → Viruses → Predicted Viral | 2919 | Open in IMG/M |
3300031758|Ga0315907_10332489 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300031784|Ga0315899_10367097 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
3300031784|Ga0315899_11722100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300031787|Ga0315900_10132677 | All Organisms → Viruses → Predicted Viral | 2344 | Open in IMG/M |
3300031857|Ga0315909_10081894 | All Organisms → Viruses → Predicted Viral | 2844 | Open in IMG/M |
3300031857|Ga0315909_10409594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
3300031857|Ga0315909_10428048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
3300031857|Ga0315909_10518094 | Not Available | 819 | Open in IMG/M |
3300031857|Ga0315909_10616618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300031857|Ga0315909_10875550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300031963|Ga0315901_11055978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300032092|Ga0315905_10086865 | All Organisms → Viruses → Predicted Viral | 3160 | Open in IMG/M |
3300032092|Ga0315905_10706054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
3300032092|Ga0315905_11238143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300033979|Ga0334978_0165764 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
3300033979|Ga0334978_0173950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300033981|Ga0334982_0081890 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
3300033981|Ga0334982_0249175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300034012|Ga0334986_0160774 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
3300034018|Ga0334985_0032508 | All Organisms → Viruses → Predicted Viral | 3976 | Open in IMG/M |
3300034020|Ga0335002_0195210 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
3300034061|Ga0334987_0078567 | All Organisms → Viruses → Predicted Viral | 2611 | Open in IMG/M |
3300034066|Ga0335019_0193744 | All Organisms → Viruses → Predicted Viral | 1318 | Open in IMG/M |
3300034071|Ga0335028_0439316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300034101|Ga0335027_0029459 | All Organisms → Viruses → Predicted Viral | 4598 | Open in IMG/M |
3300034102|Ga0335029_0072743 | All Organisms → Viruses → Predicted Viral | 2475 | Open in IMG/M |
3300034200|Ga0335065_0011517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6259 | Open in IMG/M |
3300034200|Ga0335065_0486201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300034200|Ga0335065_0704623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 23.01% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.47% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.39% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.50% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.31% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 4.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.54% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.54% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.54% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.77% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.77% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.89% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.89% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.89% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.89% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_116652392 | 3300000558 | Hydrocarbon Resource Environments | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDDNE* |
FwDRAFT_101226694 | 3300000882 | Freshwater And Marine | MSYTVEEIAQLNESMEAAILSIKSANAILEEMMATGRIYVEEE* |
JGI24766J26685_100172353 | 3300002161 | Freshwater And Sediment | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEGEEE* |
B570J29618_10039584 | 3300002306 | Freshwater | MCMDQDRRKQMSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE* |
Ga0065166_103616592 | 3300004112 | Freshwater Lake | MSYTVHEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDDEL* |
Ga0007787_101484333 | 3300004240 | Freshwater Lake | MSYTVHEIADLNESIDRAILSLKAANTILEEMMATGRIYVEGGEE* |
Ga0068876_100364474 | 3300005527 | Freshwater Lake | MSYTVNEIAELNESIDTAIASIKKANAILEEMMATGRIYVEEE* |
Ga0068876_101022717 | 3300005527 | Freshwater Lake | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDDDE* |
Ga0068876_101473014 | 3300005527 | Freshwater Lake | MSYTVHEIADLNESIDQAITSIKKANAILEEMMATGRIYIEGDDDV* |
Ga0068876_101915942 | 3300005527 | Freshwater Lake | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEED* |
Ga0068876_102641212 | 3300005527 | Freshwater Lake | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEEE* |
Ga0078894_108368803 | 3300005662 | Freshwater Lake | MSYTVHEIADLNESIDTAIASIKKANAILEEMMATGRIYVEGGEE* |
Ga0079301_100011951 | 3300006639 | Deep Subsurface | MSYTVHEIADLNESIDAAIASIKKANAILEEMMATGRIYIEGEDNEW* |
Ga0075471_1000693712 | 3300006641 | Aqueous | MSYTVHEIADLNESIDQAITSIKKANAILEEMMATGRIYVEE* |
Ga0075459_10056881 | 3300006863 | Aqueous | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYV |
Ga0075459_10558473 | 3300006863 | Aqueous | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEGGEE* |
Ga0075473_100473951 | 3300006875 | Aqueous | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEE |
Ga0108970_101288645 | 3300008055 | Estuary | MAYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEE* |
Ga0108970_117625544 | 3300008055 | Estuary | PTMSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEEE* |
Ga0114340_10030353 | 3300008107 | Freshwater, Plankton | MSYTVHEIADLNESIDTAIASIKKANAILEEMMATGRIYVEEE* |
Ga0114340_10142264 | 3300008107 | Freshwater, Plankton | MGKTRSNEMSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDDNE* |
Ga0114340_10223283 | 3300008107 | Freshwater, Plankton | MGKVRSNEMSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGGEE* |
Ga0114340_10728664 | 3300008107 | Freshwater, Plankton | MDQNRRKQMSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE* |
Ga0114340_11008083 | 3300008107 | Freshwater, Plankton | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGGDDEL* |
Ga0114340_11369111 | 3300008107 | Freshwater, Plankton | EEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE* |
Ga0114340_11943391 | 3300008107 | Freshwater, Plankton | QTMSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDNDE* |
Ga0114340_12229172 | 3300008107 | Freshwater, Plankton | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE* |
Ga0114340_12382471 | 3300008107 | Freshwater, Plankton | EEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEED* |
Ga0114341_100824475 | 3300008108 | Freshwater, Plankton | MSYTVNEIADLNESIDTAIASIKKANAILEEMMATGRIYVEEE* |
Ga0114341_102390762 | 3300008108 | Freshwater, Plankton | MSYTVEEIAQMNESMEAAILSIKAANNILEEMMATGRIYVEEE* |
Ga0114341_104779571 | 3300008108 | Freshwater, Plankton | VEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEED* |
Ga0114343_10045934 | 3300008110 | Freshwater, Plankton | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGEDNEW* |
Ga0114343_10218963 | 3300008110 | Freshwater, Plankton | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGGEE* |
Ga0114343_10785093 | 3300008110 | Freshwater, Plankton | MSYTVNEIADLNESIDTAITSIKKANAILEEMMATGRIYVEEE* |
Ga0114343_11480303 | 3300008110 | Freshwater, Plankton | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDNDE* |
Ga0114343_11670361 | 3300008110 | Freshwater, Plankton | ADLNESIDKAILSLKAANNILEEMMATGRIYVEEE* |
Ga0114346_10615752 | 3300008113 | Freshwater, Plankton | MSYTVHEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDEE* |
Ga0114346_10883435 | 3300008113 | Freshwater, Plankton | MSYTVDEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGEE* |
Ga0114346_11599243 | 3300008113 | Freshwater, Plankton | MSYTVDEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDDDSADV* |
Ga0114346_12088274 | 3300008113 | Freshwater, Plankton | MDQDRRKQMSYTVEEIAQRNESMEAAILSIKAANNILEEMMATGRIYVEGEDNEW* |
Ga0114346_12126973 | 3300008113 | Freshwater, Plankton | MSYTVDEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDDDSADVQ* |
Ga0114346_12451071 | 3300008113 | Freshwater, Plankton | MDQDRRKQMSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE* |
Ga0114346_13069741 | 3300008113 | Freshwater, Plankton | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGGDDDSADV |
Ga0114351_12745692 | 3300008117 | Freshwater, Plankton | MSYTVHEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGEE* |
Ga0114355_10225846 | 3300008120 | Freshwater, Plankton | MAYTVNEIADLNESIDRAIVSLKAANNILEEMMATGRIYVEEE* |
Ga0114876_12312441 | 3300008448 | Freshwater Lake | MSYTVHEIADLNESIDKAILSLKAANTILEEMMATGRIYVEEE* |
Ga0105103_101949053 | 3300009085 | Freshwater Sediment | MSYTVNEIAELNESIDTAITSIKKANAILEEMMATGRIYVEE* |
Ga0114977_104488711 | 3300009158 | Freshwater Lake | MSYTVEEIAQLNESMESAILSIKAANNILEEMMATGRIYVEGENNEW* |
Ga0105102_100881422 | 3300009165 | Freshwater Sediment | VNEIAELNESIDTAITSIKKANAILEEMMATGRIYVEE* |
Ga0114983_11090272 | 3300009194 | Deep Subsurface | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATRRIYVEEE* |
Ga0151620_10095134 | 3300011268 | Freshwater | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEEE* |
Ga0119951_10019868 | 3300012000 | Freshwater | MSYTVNEIADLNESIDKAILSLKAANNILEEMMATGRIYVEEE* |
Ga0164293_100377787 | 3300013004 | Freshwater | MSYTVNEIAELNESIDTAITSIKKANAILEEMMATGRIYVEEE* |
Ga0164293_103536202 | 3300013004 | Freshwater | MSYTVHEIADLNESIDAAIASIKKANAILEEMMATGRIYVEEE* |
Ga0164294_101168566 | 3300013006 | Freshwater | MSYTVHEIADLNESIDAAITSIKKANAILEEMMATGRIYVEGGEE* |
Ga0181343_11014412 | 3300017766 | Freshwater Lake | MSYTVHEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDDEL |
Ga0181359_10657243 | 3300019784 | Freshwater Lake | MSYTVHEIADLNESIDRAILSLKAANNILEEMMTTGRIYVEGGEE |
Ga0207193_10042935 | 3300020048 | Freshwater Lake Sediment | MSYTVEEIAQLNESMEAAILSIKSANAILEEMMATGRIYVEEE |
Ga0211734_1050696116 | 3300020159 | Freshwater | MAYTVEEIAQLNESMEAAIISIKAANNILEEMMATGRIYVEEE |
Ga0211726_106513411 | 3300020161 | Freshwater | MSYTFEEIAQLNESMAAAILSIKAANNILEEMMATGRIYVEEE |
Ga0208232_10012169 | 3300020527 | Freshwater | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE |
Ga0222714_102151742 | 3300021961 | Estuarine Water | MSYTVNEIADLNESIDQAIASIKKANAILEEMMATGRIYVEEE |
Ga0222713_102250826 | 3300021962 | Estuarine Water | MSYTVNEIADLNESIDQAIASIKKANAILEEMMATGRIYVEGDDNE |
Ga0222712_104196182 | 3300021963 | Estuarine Water | MSYTVNEIADLNESIDQAIASIKKANAILEEMMATGRIYVEE |
Ga0181353_10070493 | 3300022179 | Freshwater Lake | MSYTVHEIADLNESIDRAILSLKAANTILEEMMATGRIYVEGGEE |
Ga0214917_1001634313 | 3300022752 | Freshwater | MSYTVNEIADLNESIDKAILSLKAANTILEEMMATGRIYVEEE |
Ga0214917_100219592 | 3300022752 | Freshwater | MSYTVNEIADLNESIDKAILSLKAANNILEEMMATGRIYVEEE |
Ga0214921_1001551210 | 3300023174 | Freshwater | MSYTVNEIADLNESIDIAIASIKKANAILEEMMATGRIYVEEE |
Ga0214921_100870864 | 3300023174 | Freshwater | MSYTVHEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGEE |
Ga0208147_10597372 | 3300025635 | Aqueous | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEGGEE |
Ga0208784_10211035 | 3300025732 | Aqueous | MSYTVHEIADLNESIDQAITSIKKANAILEEMMATGRIYVEE |
Ga0208009_100003026 | 3300027114 | Deep Subsurface | MSYTVHEIADLNESIDAAIASIKKANAILEEMMATGRIYIEGEDNEW |
Ga0255067_10556841 | 3300027129 | Freshwater | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDGDE |
Ga0255082_10577311 | 3300027139 | Freshwater | SYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE |
Ga0255072_10823025 | 3300027508 | Freshwater | IAQLNESMEAAILSIKAANNILEEMMATGRIYVEE |
Ga0255079_100005629 | 3300027601 | Freshwater | MAYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEE |
Ga0209033_10726943 | 3300027697 | Freshwater Lake | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIY |
Ga0209599_100133743 | 3300027710 | Deep Subsurface | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDDDE |
Ga0209972_101223322 | 3300027793 | Freshwater Lake | MSYTVNEIAELNESIDTAIASIKKANAILEEMMATGRIYVEEE |
Ga0209229_1002571910 | 3300027805 | Freshwater And Sediment | MSYNVEEIAQLNESIDQAIVSIKKANAILEEMMATGRIYVEE |
Ga0209229_100563564 | 3300027805 | Freshwater And Sediment | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEGEEE |
Ga0209229_102556482 | 3300027805 | Freshwater And Sediment | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGR |
Ga0209229_104151942 | 3300027805 | Freshwater And Sediment | MAYTVNEIADLNESIDKAIVSLKAANNILEEMMATGRIYVEE |
Ga0238435_1022362 | 3300029349 | Freshwater | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEGDDNE |
Ga0315907_103324892 | 3300031758 | Freshwater | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEGDGNE |
Ga0315899_103670971 | 3300031784 | Freshwater | MSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEE |
Ga0315899_117221004 | 3300031784 | Freshwater | VHEIADLNESIDTAIASIKKANAILEEMMATGRIYVEEE |
Ga0315900_101326776 | 3300031787 | Freshwater | MSYTVHEIADLNESIDTAIASIKKANAILEEMMATGRIYVEEE |
Ga0315909_100818942 | 3300031857 | Freshwater | MAYTVNEIADLNESIDRAIVSLKAANNILEEMMATGRIYVEEE |
Ga0315909_104095945 | 3300031857 | Freshwater | MSYTVHEIAELNESIDTAIASIKKANAILEEMMATGRIYVEGEDNEW |
Ga0315909_104280485 | 3300031857 | Freshwater | SYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEED |
Ga0315909_105180941 | 3300031857 | Freshwater | MSYTVHEIADLNESIDAAIISIKKANAILEEMMATGYIYVEEE |
Ga0315909_106166184 | 3300031857 | Freshwater | TVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE |
Ga0315909_108755502 | 3300031857 | Freshwater | MAYTVNEIADLNESIDKAILSLKAANNILEEMMATGRIYVEEE |
Ga0315901_110559782 | 3300031963 | Freshwater | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDNDE |
Ga0315905_100868656 | 3300032092 | Freshwater | MSYTVDEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDE |
Ga0315905_107060542 | 3300032092 | Freshwater | MSYTVDEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDDDSADV |
Ga0315905_112381432 | 3300032092 | Freshwater | MSYTVHEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDEE |
Ga0334978_0165764_401_532 | 3300033979 | Freshwater | MSYTVNEIAELNESIDTAITSIKKANAILEEMMATGRIYVEEE |
Ga0334978_0173950_781_912 | 3300033979 | Freshwater | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEEE |
Ga0334982_0081890_1190_1345 | 3300033981 | Freshwater | MSYTVHEIADLNESIDKAILSLKAANNILEEMMATGRIYVEGDDNDSADVQ |
Ga0334982_0249175_114_257 | 3300033981 | Freshwater | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEGGDDEL |
Ga0334986_0160774_1152_1286 | 3300034012 | Freshwater | TVHEIADLNESIDTAIASIKKANAILEEMMATGRIYVEGGDDEL |
Ga0334985_0032508_2520_2651 | 3300034018 | Freshwater | MAYTVEEIAQLNESMEAAITSIKAANNILEEMMATGRIYVEEE |
Ga0335002_0195210_1053_1181 | 3300034020 | Freshwater | MSYTVHEIADLNESIDAAIASIKKANAILEEMMATGIIYVEE |
Ga0334987_0078567_585_713 | 3300034061 | Freshwater | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEE |
Ga0335019_0193744_566_697 | 3300034066 | Freshwater | MSYTVNEIADLNESIDTAITSIKKANAILEEMMATGRIYVEEE |
Ga0335028_0439316_408_536 | 3300034071 | Freshwater | MSYTVNEIAELNESIDTAITSIKKANAILEEMMATGRIYVEE |
Ga0335027_0029459_471_614 | 3300034101 | Freshwater | MSYTVHEIADLNESIDKAILSIKAANAILEEMMATGRIYVEGEDNEW |
Ga0335029_0072743_719_850 | 3300034102 | Freshwater | MSYNVEEIAQLNESIDQAIVSIKKANAILEEMMATGRIYVEEE |
Ga0335065_0011517_4304_4459 | 3300034200 | Freshwater | MDQDRRKQMSYTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE |
Ga0335065_0486201_576_731 | 3300034200 | Freshwater | MSYTVHEIADLNESIDRAILSLKAANNILEEMMATGRIYVEGGDDDSADVQ |
Ga0335065_0704623_449_574 | 3300034200 | Freshwater | YTVEEIAQLNESMEAAILSIKAANNILEEMMATGRIYVEEE |
⦗Top⦘ |