| Basic Information | |
|---|---|
| Family ID | F082588 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MDLVAFQYDRSFVLDALRNGEIDYLEHVSEAAEADLFRHLIRRQ |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.96 % |
| % of genes near scaffold ends (potentially truncated) | 96.46 % |
| % of genes from short scaffolds (< 2000 bps) | 96.46 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (12.389 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.894 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (31.858 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 1.77 |
| PF13619 | KTSC | 1.77 |
| PF13620 | CarboxypepD_reg | 0.88 |
| PF13701 | DDE_Tnp_1_4 | 0.88 |
| PF03631 | Virul_fac_BrkB | 0.88 |
| PF08388 | GIIM | 0.88 |
| PF12802 | MarR_2 | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF13358 | DDE_3 | 0.88 |
| PF06271 | RDD | 0.88 |
| PF13411 | MerR_1 | 0.88 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.77 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.77 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.77 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.77 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.77 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.77 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.88 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig125499 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005164|Ga0066815_10043871 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005181|Ga0066678_10804593 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005186|Ga0066676_10614803 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005555|Ga0066692_10910408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005556|Ga0066707_10806894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300005598|Ga0066706_10373845 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300005947|Ga0066794_10120488 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300006640|Ga0075527_10109149 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300006755|Ga0079222_10507893 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300006796|Ga0066665_11538897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300006845|Ga0075421_101032339 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300006864|Ga0066797_1365301 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009012|Ga0066710_101426923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300009039|Ga0105152_10498534 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009053|Ga0105095_10328151 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300009089|Ga0099828_11126413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300009091|Ga0102851_10937803 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300009137|Ga0066709_101582029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300009162|Ga0075423_10440321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1369 | Open in IMG/M |
| 3300009169|Ga0105097_10109597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1511 | Open in IMG/M |
| 3300009523|Ga0116221_1112623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1197 | Open in IMG/M |
| 3300009548|Ga0116107_1077028 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300009629|Ga0116119_1116124 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009630|Ga0116114_1132181 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009634|Ga0116124_1217642 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009672|Ga0116215_1503652 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009700|Ga0116217_10422368 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300009760|Ga0116131_1213551 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009762|Ga0116130_1273257 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009821|Ga0105064_1049803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300009824|Ga0116219_10766921 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010304|Ga0134088_10639986 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010391|Ga0136847_10786809 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300011118|Ga0114922_10839469 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012171|Ga0137342_1066902 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300012207|Ga0137381_11095999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300012355|Ga0137369_10483875 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300012363|Ga0137390_10848798 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300012930|Ga0137407_11506059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300012930|Ga0137407_11864323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300014155|Ga0181524_10462665 | Not Available | 544 | Open in IMG/M |
| 3300014502|Ga0182021_10122650 | All Organisms → cellular organisms → Bacteria | 3019 | Open in IMG/M |
| 3300014502|Ga0182021_11441806 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300014839|Ga0182027_10428829 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300014839|Ga0182027_10869746 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300014875|Ga0180083_1113153 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300016341|Ga0182035_10625253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300016422|Ga0182039_11254131 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300017924|Ga0187820_1314213 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300017943|Ga0187819_10355871 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300017994|Ga0187822_10233078 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300018006|Ga0187804_10399966 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300018016|Ga0187880_1210363 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300018021|Ga0187882_1103085 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300018022|Ga0187864_10168295 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300018022|Ga0187864_10286816 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300018023|Ga0187889_10127707 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300018054|Ga0184621_10096199 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300018057|Ga0187858_10396983 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300018068|Ga0184636_1319011 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300018085|Ga0187772_10515681 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300018090|Ga0187770_10523167 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300018090|Ga0187770_10992068 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300019785|Ga0182022_1010151 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300021086|Ga0179596_10257883 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300021086|Ga0179596_10528637 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300025409|Ga0208321_1038461 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300025500|Ga0208686_1068923 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300025836|Ga0209748_1049829 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300025843|Ga0209182_10202772 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025854|Ga0209176_10075848 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300026007|Ga0210124_1142052 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300026497|Ga0257164_1019498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300026557|Ga0179587_10736467 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300026959|Ga0207852_1024001 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300027605|Ga0209329_1013740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1575 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10301703 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300027842|Ga0209580_10022587 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
| 3300027882|Ga0209590_10917421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10303551 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031232|Ga0302323_102835408 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031545|Ga0318541_10609938 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031713|Ga0318496_10792845 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031746|Ga0315293_11149763 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031746|Ga0315293_11240438 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031765|Ga0318554_10768059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 539 | Open in IMG/M |
| 3300031772|Ga0315288_11322621 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031819|Ga0318568_10510830 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300031833|Ga0310917_10043296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2730 | Open in IMG/M |
| 3300031834|Ga0315290_10875789 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300031860|Ga0318495_10232860 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031879|Ga0306919_10159658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1651 | Open in IMG/M |
| 3300032046|Ga0315289_10654231 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300032052|Ga0318506_10418661 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032052|Ga0318506_10418764 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032053|Ga0315284_12257857 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032069|Ga0315282_10593084 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032089|Ga0318525_10321870 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300032118|Ga0315277_10986266 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300032143|Ga0315292_11223896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300032143|Ga0315292_11593133 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032275|Ga0315270_10526657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300032397|Ga0315287_10960780 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300032955|Ga0335076_10107929 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300033414|Ga0316619_11784046 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300033418|Ga0316625_101786301 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300033557|Ga0316617_100604820 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300033813|Ga0364928_0088670 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300033820|Ga0334817_060979 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300034125|Ga0370484_0022553 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300034191|Ga0373909_0279512 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300034419|Ga0373914_0167022 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 4.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.54% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.77% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.77% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.77% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300026007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034191 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.1 | Engineered | Open in IMG/M |
| 3300034419 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_01574830 | 2140918007 | Soil | MDLISFQYDRSFVLEALRQGDIDYLEHVSEAAEADLFRH |
| Ga0066815_100438712 | 3300005164 | Soil | MDLAAFQYDRSFVLDALRHGNLDYLEHVSEAAEADLFRHLIRR |
| Ga0066678_108045932 | 3300005181 | Soil | VDLLAFQYDRSFVLDALRQGEIDCLEHVSEAAEADLFRHLIRRQVIQ |
| Ga0066676_106148032 | 3300005186 | Soil | MDLISFPYDRSFVLEALRHGDIDYLEPVSEAAEADLFRHL |
| Ga0066692_109104081 | 3300005555 | Soil | MDLVAFENDRKFVLEGLRQGQVDYVEHVSEAAEADLFRHLV |
| Ga0066707_108068941 | 3300005556 | Soil | MDFAAFEYDRTFVIEALRRGAIDYLENISEAEEADLFRHLLGRDVWERLAEHYPTP |
| Ga0066706_103738453 | 3300005598 | Soil | MDLLGFQYDRSFVLAALRQGNIDYLEHVSEAAEADLFRHLIRRQ |
| Ga0066794_101204883 | 3300005947 | Soil | MDLVAFHFDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIGRQ |
| Ga0075527_101091492 | 3300006640 | Arctic Peat Soil | MDLVAFHFDRSFVLEALRQGEIDYLEHVSEAAEADLFRH |
| Ga0079222_105078932 | 3300006755 | Agricultural Soil | MDLISFHYDRSFALEALRNGDIDYLEHVSEAAEADLFRHL |
| Ga0066665_115388971 | 3300006796 | Soil | MDFVAFEHDRPLVIEALRRGEVDYLEHVSEAAEAD |
| Ga0075421_1010323392 | 3300006845 | Populus Rhizosphere | MHLVTFQYDRSFVLEALRQGNIDYLEHVSEAAEADLFRHLFRRQVI |
| Ga0066797_13653011 | 3300006864 | Soil | MDLVAFHYDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIGRQ |
| Ga0066710_1014269232 | 3300009012 | Grasslands Soil | MDFDAFEYDRKFVIEALRCGEIDYLENVSEAEEADLFRHLLGRDVLERLAEHYP |
| Ga0105152_104985341 | 3300009039 | Lake Sediment | MNAILFDHDRPFVIDALRRGEVDYLENVGQAVEAD |
| Ga0105095_103281512 | 3300009053 | Freshwater Sediment | MDLISFQYDRSFVLNALRNGDIDYLEHVSEAAEADLFRHLI |
| Ga0099828_111264132 | 3300009089 | Vadose Zone Soil | MDLAAFEHDRQFVIEALRRGEIDYLENVSEAAEADLFRHL |
| Ga0102851_109378031 | 3300009091 | Freshwater Wetlands | MDLIAFQYDRSLVLEALRRGEIDYLENVSEAAEADFCRHLIRRDV |
| Ga0066709_1015820293 | 3300009137 | Grasslands Soil | MDLAAFELDRQFVIDALYRGQIHFLENVSQAAEADFFRHLIGR |
| Ga0075423_104403213 | 3300009162 | Populus Rhizosphere | MDLIAFQYDRSFVLEALRRGEIDCLEHVSEAAEADLFRHLIRRQVIQRLAETFP* |
| Ga0105097_101095971 | 3300009169 | Freshwater Sediment | TLMDLVAFQYDRSFVLDALRRGEIDYLENVSEAA* |
| Ga0116221_11126231 | 3300009523 | Peatlands Soil | MDLAAFEHDRKFVIEALRRGEIDYLENVSEAAEADLFRHLLGRDVL |
| Ga0116107_10770281 | 3300009548 | Peatland | MDLVAFHYDRAFVLDALHQGEIDYLEHVSEAAEADLF |
| Ga0116119_11161242 | 3300009629 | Peatland | VNLTVFEHDRPFVIGDLRRGEGDYLENVSEAAEANLCRH |
| Ga0116114_11321812 | 3300009630 | Peatland | VNLTVFEHDRPFVIDALRRGEVDYLENVSEAAEANLFRHLIDRRVL |
| Ga0116124_12176421 | 3300009634 | Peatland | VNLTLFEHDRQFVIDALRRGELDYLENVSEAAEANLFRHLIDRRVLQRLAESYPSP |
| Ga0116215_15036521 | 3300009672 | Peatlands Soil | VNLTVFEHDRQFGIAALRRGEVDYRENVSEAAEANWFRHLIDRRV |
| Ga0116217_104223682 | 3300009700 | Peatlands Soil | VNLTVFEHDRPFVIEALRQGEVDYLENVSEAAEANLFRHLIDRRVLERLAESYPSP |
| Ga0116131_12135512 | 3300009760 | Peatland | MVNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHPIDRRVLARLAE |
| Ga0116130_12732572 | 3300009762 | Peatland | VNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHLID |
| Ga0105064_10498033 | 3300009821 | Groundwater Sand | MAFVAFEHDRPFVIDALRHGEVDYLESVTEAAEADLFRHLISRDV |
| Ga0116219_107669211 | 3300009824 | Peatlands Soil | VNLTVFEHDRQFVIEALRQGEVDYLENVSEAAEANLFRHLIDRRVLERLAESYPS |
| Ga0134088_106399862 | 3300010304 | Grasslands Soil | MDLVSFQYDRSFVLEALRQGDVDYLEHVSEAAEADWFRHLIRRQVIQRLA |
| Ga0136847_107868092 | 3300010391 | Freshwater Sediment | MDLVAFHYNRSFVLEALRHGEIDYGEHVCEAAEADLFRHLLRR |
| Ga0114922_108394691 | 3300011118 | Deep Subsurface | MDLLAFEHDRGFVVKALRRGEIDYLEPVTEAVEAD |
| Ga0137342_10669022 | 3300012171 | Soil | MDLVAFHYDRSFVLDALRQGEIDYLEQVSEAAEADLFR |
| Ga0137381_110959991 | 3300012207 | Vadose Zone Soil | MDFVAFENDRKFVLEGLRHGEVDYVESVSEAAEADL |
| Ga0137369_104838752 | 3300012355 | Vadose Zone Soil | MDLVSFQYDRSFVLEALRQGDIDYLEHVSEAAEADLFRHLIRR |
| Ga0137390_108487982 | 3300012363 | Vadose Zone Soil | MDLISFQHDRSFVLDALRQGDVDYLEHVSEAAEADLFRHL |
| Ga0137407_115060592 | 3300012930 | Vadose Zone Soil | MDFVAFENDRKFVLEGLRRGEVDYVEHVSEAAEADLFRHLI |
| Ga0137407_118643231 | 3300012930 | Vadose Zone Soil | MDWVAFENDRQFVLEGLRRGEVDYVEHVSEAAEADLFR |
| Ga0181524_104626653 | 3300014155 | Bog | VNLTVFEHDRQFVIEALRRGELDCLENVSEAAEASLFRHLLDRRVLERLAESYP |
| Ga0182021_101226503 | 3300014502 | Fen | MVNLTVFEHDRPFVIEALHRGEVDYLENVSEAAEANLFRHLTDRQV |
| Ga0182021_114418062 | 3300014502 | Fen | VNLTVFEHDRQFVIAALRRGEVDYLENVSEAAEANL |
| Ga0182027_104288291 | 3300014839 | Fen | VNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHLIDRRVLER |
| Ga0182027_108697461 | 3300014839 | Fen | VNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHLIDRRVLERLAES |
| Ga0180083_11131531 | 3300014875 | Soil | MDLVAFQYDRNFVVDALQRGEIDALENVSEAAEADLFRHLIGRGVL |
| Ga0182035_106252532 | 3300016341 | Soil | MDLVAFEHDRSFILEALRRGEIDYLEHVGEALEGDFFRQLIDRQVLQRLADSYPTLCGIFFLIS |
| Ga0182039_112541312 | 3300016422 | Soil | MDLVAFQYDCSFVLDALRNGEVDYLEHVSEAAEADLFRHLIRRQVIQRLADTY |
| Ga0187820_13142132 | 3300017924 | Freshwater Sediment | VNLTVFEHDRQFVIEALRRGELDYLENVSEAAEANLFRHLLDRQVLERLAESYPS |
| Ga0187819_103558711 | 3300017943 | Freshwater Sediment | MDLTAFQYDRSFVLDALRHGDLDYLEHVSEAAEADLFRHLIRRQ |
| Ga0187822_102330781 | 3300017994 | Freshwater Sediment | MDLTAFQYDRSFVLDALRHGDLDYLEHVSEAAEADLF |
| Ga0187804_103999662 | 3300018006 | Freshwater Sediment | VNLTVFAHDRPLVIEALRRGEVDYLENVAEAAEAN |
| Ga0187880_12103631 | 3300018016 | Peatland | VNLTVFEHDRQFVIEALRRGEVDYLENVSEAAEANLFRHL |
| Ga0187882_11030853 | 3300018021 | Peatland | MDLTAFSYDRSFVLDALRQGEINYLEHVSEAAEADLFRHLIRRQVVQRLA |
| Ga0187864_101682952 | 3300018022 | Peatland | VNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHLI |
| Ga0187864_102868162 | 3300018022 | Peatland | VNLTVFEHDRQFVIEALRRGELDYLENVSEAAEASLFRHLLDR |
| Ga0187889_101277073 | 3300018023 | Peatland | VNLTLFEHDRQFVIDALRRGELDYLENVSEAAEANLFRHL |
| Ga0184621_100961991 | 3300018054 | Groundwater Sediment | MELVAFENDRKFVLEGLRHGEVDYVEHVSEAAEADLFRHLISRDVLTRLAETY |
| Ga0187858_103969831 | 3300018057 | Peatland | VNLTVFEHDRPFVVDALRRGELDYLENVSEAAEANLFRHLI |
| Ga0184636_13190112 | 3300018068 | Groundwater Sediment | MDLVGLQFDRPFVLDALSRGEIDYLENVSEAAEADLFRKLIRRDVL |
| Ga0187772_105156811 | 3300018085 | Tropical Peatland | VNLIGFEYDRGFVLKALRQGEVDYLESVSEAVEADLFRHLIDRR |
| Ga0187770_105231673 | 3300018090 | Tropical Peatland | VNLTVFERDRQLVIEALRRGELDYLENVSEAAEAGLFRHLLDRRVLERLA |
| Ga0187770_109920681 | 3300018090 | Tropical Peatland | MNLIAFEHDRRFVVEALRQGEVDYLENVSEAVEADLFRHLIDRRVLARLA |
| Ga0182022_10101511 | 3300019785 | Fen | MDLAVFSYDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLRLV |
| Ga0179596_102578831 | 3300021086 | Vadose Zone Soil | MDLAAFQYDRSFVLDALRHGDLDYLEHVSEAAEADLFRHLLRRQVIQ |
| Ga0179596_105286371 | 3300021086 | Vadose Zone Soil | MDLVAFQYDRSFVLDALQHGDLDYLEHVSEAAEADLFRHLIQRQVIQRLADSYPSPRN |
| Ga0208321_10384612 | 3300025409 | Peatland | VNLTLFEHDRQFVIDALRRGELDYLENVSEAAEANLFRHLIDRRVL |
| Ga0208686_10689232 | 3300025500 | Peatland | VNLTVFEHDRQFVIEALRRGELDYLENVSEAAEASLFRH |
| Ga0209748_10498294 | 3300025836 | Arctic Peat Soil | MDLVAFHFDRSFVLDALRQGEIDYLEHVSEAAEADLF |
| Ga0209182_102027722 | 3300025843 | Lake Sediment | MDLAAFHYDRSFVLDALRHGEIDYLEHVSEAAEADLFRHLIGRQV |
| Ga0209176_100758482 | 3300025854 | Arctic Peat Soil | MDLVAFHFDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIGRQVVQRLA |
| Ga0210124_11420523 | 3300026007 | Natural And Restored Wetlands | MDLLAFEHDRLFVLQALRQGEIDYLEPVTEAVEADF |
| Ga0257164_10194981 | 3300026497 | Soil | MDWVAFENDRKFVLEGLRRGEVDYVEHVSEAAEADLFRHLISRDV |
| Ga0179587_107364672 | 3300026557 | Vadose Zone Soil | MDWVAFENDRKFVLEGLRHGEVDYVEHVSEAAEADLFRHLVSRD |
| Ga0207852_10240012 | 3300026959 | Tropical Forest Soil | MHLLAFEYDRPFILEALRRGQIDYLEHVGEALEGDFFRQ |
| Ga0209329_10137401 | 3300027605 | Forest Soil | MDLAAFEYDRQFVIEALRRGEIDFLENVSEAAEADLFRHLLGRDVLE |
| (restricted) Ga0233416_103017031 | 3300027799 | Sediment | MDLVLFEHDRDFVVSALREGNLDYLEHVSEAAETELFRH |
| Ga0209580_100225871 | 3300027842 | Surface Soil | MDLISFHYDRSFALEALRNGDIDYLEHVSEAAEADLFRHLIRRQVIQRLAETW |
| Ga0209590_109174211 | 3300027882 | Vadose Zone Soil | VDFAAFEHDPKFVIESLRRGEIDYLENLSEAAEADFFRHLIG |
| (restricted) Ga0233418_103035511 | 3300027995 | Sediment | MDLIAFKYDRSFVVEALSRGEIDYLEPVSEAAEADF |
| Ga0302323_1028354082 | 3300031232 | Fen | MDLVAFHYDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIGRQERPTPGRYLSH |
| Ga0318541_106099381 | 3300031545 | Soil | MDLVAFQYDCSFVLDALRNGEVDYLEHVSEAAEADLFRHLIRRQVIQRLAD |
| Ga0318496_107928452 | 3300031713 | Soil | MDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFRHLIRRQVIQRLAET |
| Ga0315293_111497632 | 3300031746 | Sediment | MNLVLFEHDRQFVIEALRRGQVDYLENVGQAVETD |
| Ga0315293_112404382 | 3300031746 | Sediment | MDLVAFHYDRSFVLDALRQSEIDYLEHVSEAAEADLFRHLIGRQVVQRL |
| Ga0318554_107680591 | 3300031765 | Soil | PKVMDLVAFEYDRSFILEALRRGEIDYLEHVGEALEGDFFR |
| Ga0315288_113226212 | 3300031772 | Sediment | MDLVGFQFDRPFVLDALSRGEIDFLENVSEAAEADF |
| Ga0318568_105108302 | 3300031819 | Soil | MDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFRHLIRRQVIQRL |
| Ga0310917_100432964 | 3300031833 | Soil | TPKVMDLVAFEYDRSFILEALRRGEIDYLEHVGEALEGDFFR |
| Ga0315290_108757892 | 3300031834 | Sediment | MNLVLFEHDRQFVIEALRRGQVDYLENVGQAVETDLFR |
| Ga0318495_102328602 | 3300031860 | Soil | MDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFR |
| Ga0306919_101596583 | 3300031879 | Soil | MDLVAFEYDRSFILEALRRGEIDYLEHVGEALEGDFFR |
| Ga0315289_106542312 | 3300032046 | Sediment | MDLIGLQFDRPFVLDALSRGENDYLEHVSEAAEAS |
| Ga0318506_104186612 | 3300032052 | Soil | MDLVAFQYDCSFVLDALRNGEVDYLEHVSEAAEADLFRHLIRRQVIQ |
| Ga0318506_104187642 | 3300032052 | Soil | MDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFRHLIRR |
| Ga0315284_122578572 | 3300032053 | Sediment | MDLVAFQYDRSFVLDALRNGEIDYLEHVSEAAEADLFRHLIRRQ |
| Ga0315282_105930842 | 3300032069 | Sediment | MDLLTFQYDRSFVLDALRQGDIDYLEHVSEAAEADWFRHLIRRQV |
| Ga0318525_103218702 | 3300032089 | Soil | MDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFRHLIRRQVIQRLAE |
| Ga0315277_109862662 | 3300032118 | Sediment | MDLITFQYDRSFVLGALRQGDIDYLEHVSEAAEADLFRHLIRRQVVQRLAET |
| Ga0315292_112238961 | 3300032143 | Sediment | MDFVAFEYDRKFVLEGLRHGEVDYVEAVTEAAETDLFRHLI |
| Ga0315292_115931331 | 3300032143 | Sediment | MDLIGLQFDRPFVLDALSRGEIDFLENVSEAAEADF |
| Ga0315270_105266572 | 3300032275 | Sediment | MDFVAFEHDRKFVLDALRNGEVDYLESVNEAAEADLFRHLISRDVLN |
| Ga0315287_109607802 | 3300032397 | Sediment | MDLLALEYDRDFVIEAMRQGQLDYLEHVSEAAETDFFRHLIGRGVLA |
| Ga0335076_101079293 | 3300032955 | Soil | MDLISFQYDRSFVLDALRNGDVDYLENVSEAAEADLF |
| Ga0316619_117840461 | 3300033414 | Soil | MDLVAFQYDRNFVVDALQRGEIDALENVSEAAEADLFRHLIGRGVLN |
| Ga0316625_1017863011 | 3300033418 | Soil | MDLVAFQFDRPFVLDALSRGEIDYLEHVSEAAEAGFFRQL |
| Ga0316617_1006048203 | 3300033557 | Soil | MDLVAFQFDRPLVLDALSRGEIDYLEHVSEAAEAGFFRHLIRR |
| Ga0364928_0088670_1_147 | 3300033813 | Sediment | MDLVAFHYDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIRRQVVQRL |
| Ga0334817_060979_623_733 | 3300033820 | Soil | MDLVAFQYDRSFVLEALRRGEIDCLEHVSEAAEADFF |
| Ga0370484_0022553_1_108 | 3300034125 | Untreated Peat Soil | MDLVAFHFDRSFVLDALRQGEIDYLEHVSEAAEADL |
| Ga0373909_0279512_3_137 | 3300034191 | Sediment Slurry | MDLLAFQYDRSFVLDALRHGDIDYLEHVGEAAEADLFRHLIRRQV |
| Ga0373914_0167022_423_566 | 3300034419 | Sediment Slurry | MNLMVFEHDQQFVIDALRRGEVDYLENVSEAAETELFRHLIGRGVLKR |
| ⦗Top⦘ |