Basic Information | |
---|---|
Family ID | F082579 |
Family Type | Metagenome |
Number of Sequences | 113 |
Average Sequence Length | 44 residues |
Representative Sequence | MEDEVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQEAGAFRV |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 60.18 % |
% of genes near scaffold ends (potentially truncated) | 43.36 % |
% of genes from short scaffolds (< 2000 bps) | 87.61 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (58.407 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.203 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.142 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.221 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 73.33% β-sheet: 0.00% Coil/Unstructured: 26.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF12705 | PDDEXK_1 | 22.12 |
PF01930 | Cas_Cas4 | 14.16 |
PF12728 | HTH_17 | 7.08 |
PF02467 | Whib | 3.54 |
PF03796 | DnaB_C | 2.65 |
PF13362 | Toprim_3 | 0.88 |
PF09723 | Zn-ribbon_8 | 0.88 |
PF01844 | HNH | 0.88 |
PF00227 | Proteasome | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 14.16 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 2.65 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 2.65 |
COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.30 % |
Unclassified | root | N/A | 17.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002930|Water_100008 | All Organisms → cellular organisms → Bacteria | 49744 | Open in IMG/M |
3300003277|JGI25908J49247_10034765 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
3300003393|JGI25909J50240_1025414 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
3300005527|Ga0068876_10432423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300005527|Ga0068876_10754966 | Not Available | 516 | Open in IMG/M |
3300005528|Ga0068872_10146497 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
3300005580|Ga0049083_10028262 | All Organisms → Viruses → Predicted Viral | 2007 | Open in IMG/M |
3300005581|Ga0049081_10010211 | All Organisms → Viruses → Predicted Viral | 3557 | Open in IMG/M |
3300005581|Ga0049081_10120152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300005581|Ga0049081_10158958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300005662|Ga0078894_11579891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300005805|Ga0079957_1201853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
3300006030|Ga0075470_10202648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300006641|Ga0075471_10102048 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
3300006920|Ga0070748_1315246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300007162|Ga0079300_10042918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1475 | Open in IMG/M |
3300007622|Ga0102863_1167432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300007639|Ga0102865_1047496 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
3300007861|Ga0105736_1124337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300007973|Ga0105746_1358391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300007974|Ga0105747_1149586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300008055|Ga0108970_11534375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300008106|Ga0114339_1146982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300008107|Ga0114340_1103182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1137 | Open in IMG/M |
3300008107|Ga0114340_1161460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300008110|Ga0114343_1195618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300008111|Ga0114344_1004966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5800 | Open in IMG/M |
3300009068|Ga0114973_10258814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
3300009068|Ga0114973_10383765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300009068|Ga0114973_10727814 | Not Available | 504 | Open in IMG/M |
3300009152|Ga0114980_10564350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300009155|Ga0114968_10037199 | All Organisms → Viruses → Predicted Viral | 3218 | Open in IMG/M |
3300009158|Ga0114977_10024555 | All Organisms → Viruses → Predicted Viral | 3777 | Open in IMG/M |
3300009159|Ga0114978_10508627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300009159|Ga0114978_10707118 | Not Available | 574 | Open in IMG/M |
3300009161|Ga0114966_10389544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300009181|Ga0114969_10224196 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
3300009181|Ga0114969_10778767 | Not Available | 509 | Open in IMG/M |
3300009183|Ga0114974_10208931 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
3300009185|Ga0114971_10421923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300009187|Ga0114972_10121873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1687 | Open in IMG/M |
3300010965|Ga0138308_119169 | All Organisms → Viruses → Predicted Viral | 3539 | Open in IMG/M |
3300011337|Ga0153702_1148 | All Organisms → cellular organisms → Bacteria | 26977 | Open in IMG/M |
3300012013|Ga0153805_1001318 | All Organisms → Viruses → Predicted Viral | 4944 | Open in IMG/M |
3300013372|Ga0177922_10339280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300017716|Ga0181350_1107231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300017761|Ga0181356_1031899 | All Organisms → Viruses → Predicted Viral | 1886 | Open in IMG/M |
3300017774|Ga0181358_1239696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300017777|Ga0181357_1205521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300017777|Ga0181357_1242824 | Not Available | 628 | Open in IMG/M |
3300017778|Ga0181349_1054491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1562 | Open in IMG/M |
3300017778|Ga0181349_1245249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300017780|Ga0181346_1127523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
3300017780|Ga0181346_1142253 | Not Available | 904 | Open in IMG/M |
3300017780|Ga0181346_1227792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300017780|Ga0181346_1236847 | Not Available | 643 | Open in IMG/M |
3300017784|Ga0181348_1231829 | Not Available | 647 | Open in IMG/M |
3300017784|Ga0181348_1275709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300017784|Ga0181348_1285654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300017785|Ga0181355_1325775 | Not Available | 570 | Open in IMG/M |
3300019784|Ga0181359_1051277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1591 | Open in IMG/M |
3300019784|Ga0181359_1077600 | All Organisms → Viruses → Predicted Viral | 1249 | Open in IMG/M |
3300019784|Ga0181359_1247767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300019784|Ga0181359_1249548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300020159|Ga0211734_10415016 | Not Available | 622 | Open in IMG/M |
3300020160|Ga0211733_11204226 | Not Available | 600 | Open in IMG/M |
3300020162|Ga0211735_10097624 | All Organisms → Viruses → Predicted Viral | 2087 | Open in IMG/M |
3300020172|Ga0211729_10075211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300022190|Ga0181354_1164428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300022190|Ga0181354_1190477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300022190|Ga0181354_1201648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300022748|Ga0228702_1057344 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
3300023174|Ga0214921_10043651 | All Organisms → Viruses → Predicted Viral | 4085 | Open in IMG/M |
3300023184|Ga0214919_10165399 | All Organisms → Viruses → Predicted Viral | 1726 | Open in IMG/M |
3300023184|Ga0214919_10523821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300024346|Ga0244775_10626061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300025896|Ga0208916_10496252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300027129|Ga0255067_1046595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300027129|Ga0255067_1057389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300027131|Ga0255066_1032531 | Not Available | 735 | Open in IMG/M |
3300027135|Ga0255073_1070121 | Not Available | 560 | Open in IMG/M |
3300027140|Ga0255080_1077326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300027659|Ga0208975_1000348 | Not Available | 23091 | Open in IMG/M |
3300027659|Ga0208975_1078033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300027689|Ga0209551_1266425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300027707|Ga0209443_1087397 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
3300027733|Ga0209297_1010849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4455 | Open in IMG/M |
3300027736|Ga0209190_1000939 | Not Available | 20762 | Open in IMG/M |
3300027754|Ga0209596_1328005 | Not Available | 599 | Open in IMG/M |
3300027754|Ga0209596_1357632 | Not Available | 561 | Open in IMG/M |
3300027782|Ga0209500_10373888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300027782|Ga0209500_10388171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300027785|Ga0209246_10065606 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
3300027793|Ga0209972_10322901 | Not Available | 675 | Open in IMG/M |
3300027797|Ga0209107_10342906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300027816|Ga0209990_10189947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
3300027899|Ga0209668_10184225 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
3300027899|Ga0209668_10432184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300027963|Ga0209400_1159526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
3300027969|Ga0209191_1048799 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
3300027971|Ga0209401_1265080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300031707|Ga0315291_11194055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300031707|Ga0315291_11395373 | Not Available | 558 | Open in IMG/M |
3300031772|Ga0315288_11255263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300031951|Ga0315904_10290911 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
3300032177|Ga0315276_10830654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
3300032401|Ga0315275_12261418 | Not Available | 567 | Open in IMG/M |
3300033979|Ga0334978_0294403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300033995|Ga0335003_0224756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
3300033996|Ga0334979_0261529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
3300034012|Ga0334986_0450263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300034066|Ga0335019_0150378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1534 | Open in IMG/M |
3300034121|Ga0335058_0106689 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 29.20% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.96% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.31% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.42% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.42% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.42% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.54% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.65% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.77% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.77% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.89% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.89% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.89% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.89% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.89% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.89% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.89% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Water_10000837 | 3300002930 | Estuary Water | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV* |
JGI25908J49247_100347653 | 3300003277 | Freshwater Lake | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV* |
JGI25909J50240_10254143 | 3300003393 | Freshwater Lake | EDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYXDAQESGAVXV* |
Ga0068876_104324231 | 3300005527 | Freshwater Lake | DEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV* |
Ga0068876_107549663 | 3300005527 | Freshwater Lake | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAG |
Ga0068872_101464973 | 3300005528 | Freshwater Lake | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV* |
Ga0049083_100282622 | 3300005580 | Freshwater Lentic | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV* |
Ga0049081_100102117 | 3300005581 | Freshwater Lentic | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYIDAQESEAVKV* |
Ga0049081_101201523 | 3300005581 | Freshwater Lentic | MEDQVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV* |
Ga0049081_101589583 | 3300005581 | Freshwater Lentic | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAVRV* |
Ga0078894_115798912 | 3300005662 | Freshwater Lake | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAFRV* |
Ga0079957_12018531 | 3300005805 | Lake | HMTEEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV* |
Ga0075470_102026481 | 3300006030 | Aqueous | MEDEVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAFRV* |
Ga0075471_101020482 | 3300006641 | Aqueous | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV* |
Ga0070748_13152462 | 3300006920 | Aqueous | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYDDAEKAGAFRV* |
Ga0079300_100429183 | 3300007162 | Deep Subsurface | MTDEYAAHYFYEMGWKACRLAYKLHEEAEEAGAFRV* |
Ga0102863_11674323 | 3300007622 | Estuarine | MEDEVKYIHMTEEYAAQYWHQQGWMACRLAYKLYNDAQETG |
Ga0102865_10474961 | 3300007639 | Estuarine | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV* |
Ga0105736_11243371 | 3300007861 | Estuary Water | EDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFKV* |
Ga0105746_13583912 | 3300007973 | Estuary Water | MEDKVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV* |
Ga0105747_11495862 | 3300007974 | Estuary Water | VLVFWVGVLMEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV* |
Ga0108970_115343752 | 3300008055 | Estuary | MTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV* |
Ga0114339_11469821 | 3300008106 | Freshwater, Plankton | VRGTLMEDKVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV* |
Ga0114340_11031822 | 3300008107 | Freshwater, Plankton | MEDKVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQEAGALKV* |
Ga0114340_11614603 | 3300008107 | Freshwater, Plankton | VKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV* |
Ga0114343_11956181 | 3300008110 | Freshwater, Plankton | TEEYAAQYWHQQGWLACRLAYKLYNDAQETGALKV* |
Ga0114344_10049667 | 3300008111 | Freshwater, Plankton | MEDEVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQEAGALKV* |
Ga0114973_102588142 | 3300009068 | Freshwater Lake | MEDEVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV* |
Ga0114973_103837652 | 3300009068 | Freshwater Lake | MENQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV* |
Ga0114973_107278142 | 3300009068 | Freshwater Lake | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNEAQESGAVRV* |
Ga0114980_105643502 | 3300009152 | Freshwater Lake | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV* |
Ga0114968_100371996 | 3300009155 | Freshwater Lake | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGTVRV* |
Ga0114977_100245554 | 3300009158 | Freshwater Lake | MTEEYAAQYWHQQGWLACRLAYKLYNDAQESGTVRV* |
Ga0114978_105086272 | 3300009159 | Freshwater Lake | MEDQVKYIHMTEEYTAQYWHQQGWLACRLAYKLYNDAQDAGAVKV* |
Ga0114978_107071183 | 3300009159 | Freshwater Lake | MEDQVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGALRV* |
Ga0114966_103895441 | 3300009161 | Freshwater Lake | QVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAVRI* |
Ga0114969_102241963 | 3300009181 | Freshwater Lake | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQESGAVRI* |
Ga0114969_107787672 | 3300009181 | Freshwater Lake | MEDEVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQEAGAFRV* |
Ga0114974_102089312 | 3300009183 | Freshwater Lake | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQDAGALRV* |
Ga0114971_104219232 | 3300009185 | Freshwater Lake | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV* |
Ga0114972_101218734 | 3300009187 | Freshwater Lake | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDA |
Ga0138308_1191693 | 3300010965 | Lake Chemocline | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKIYNDAQDAGAFRV* |
Ga0153702_11483 | 3300011337 | Freshwater | MENQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYDDAEKAGAFRV* |
Ga0153805_10013184 | 3300012013 | Surface Ice | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQESGALKV* |
Ga0177922_103392801 | 3300013372 | Freshwater | TRTVLGGAMEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGTVRV* |
Ga0181350_11072312 | 3300017716 | Freshwater Lake | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYIDAQESGAVKV |
Ga0181356_10318992 | 3300017761 | Freshwater Lake | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0181358_12396961 | 3300017774 | Freshwater Lake | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQESGAVRV |
Ga0181357_12055211 | 3300017777 | Freshwater Lake | EDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVRV |
Ga0181357_12428241 | 3300017777 | Freshwater Lake | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYN |
Ga0181349_10544911 | 3300017778 | Freshwater Lake | VKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0181349_12452491 | 3300017778 | Freshwater Lake | CRVGVLMEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0181346_11275233 | 3300017780 | Freshwater Lake | VGVLMEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQESGAVRV |
Ga0181346_11422532 | 3300017780 | Freshwater Lake | CRVGVLMEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0181346_12277922 | 3300017780 | Freshwater Lake | CRVGVLMEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV |
Ga0181346_12368471 | 3300017780 | Freshwater Lake | MEDEVKYIALAYEYAAQYWHHQGFLACRLAYILYNDAHDS |
Ga0181348_12318294 | 3300017784 | Freshwater Lake | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQESG |
Ga0181348_12757091 | 3300017784 | Freshwater Lake | PVLVCRVGVLMEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAEEAGAFRV |
Ga0181348_12856543 | 3300017784 | Freshwater Lake | AMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAFRV |
Ga0181355_13257752 | 3300017785 | Freshwater Lake | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYIDAQEAGALKV |
Ga0181359_10512771 | 3300019784 | Freshwater Lake | KYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0181359_10776002 | 3300019784 | Freshwater Lake | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV |
Ga0181359_12477672 | 3300019784 | Freshwater Lake | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0181359_12495481 | 3300019784 | Freshwater Lake | EDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGALRV |
Ga0211734_104150162 | 3300020159 | Freshwater | MENEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYDDAEKAGAFRV |
Ga0211733_112042261 | 3300020160 | Freshwater | MEDQVKYIHMTDEYAAQYWHQQGWLACRLAYKLYDDAEKAGAFRV |
Ga0211735_100976245 | 3300020162 | Freshwater | MENEVKYIHMTEEYAAQYWHQQGWLACRLAYKLYDDAEKAGAFRV |
Ga0211729_100752113 | 3300020172 | Freshwater | LVCWVGVLMEDQVKYIHMTDEYAAQYWHQQGWLACRLAYKLYDDAEKAGAFRV |
Ga0181354_11644282 | 3300022190 | Freshwater Lake | TDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV |
Ga0181354_11904772 | 3300022190 | Freshwater Lake | SMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0181354_12016482 | 3300022190 | Freshwater Lake | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGALKV |
Ga0228702_10573442 | 3300022748 | Freshwater | ELKVIPMTDEYAAQYWHQQGWMACRLAYKLYEDAEKAGAHRV |
Ga0214921_100436519 | 3300023174 | Freshwater | MTDEYAAQYWHQQGWLACRLAYKLYIDAQEAGALKV |
Ga0214919_101653994 | 3300023184 | Freshwater | TRTVLGGAMEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGTVRV |
Ga0214919_105238212 | 3300023184 | Freshwater | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQESGAVNV |
Ga0244775_106260612 | 3300024346 | Estuarine | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0208916_104962523 | 3300025896 | Aqueous | CRVGVLMEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0255067_10465952 | 3300027129 | Freshwater | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAEEAGAFRV |
Ga0255067_10573892 | 3300027129 | Freshwater | VKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV |
Ga0255066_10325312 | 3300027131 | Freshwater | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV |
Ga0255073_10701211 | 3300027135 | Freshwater | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYN |
Ga0255080_10773262 | 3300027140 | Freshwater | KYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV |
Ga0208975_100034823 | 3300027659 | Freshwater Lentic | MTDEYAAQYWHQQGWLACRLAYKLYIDAQESEAVKV |
Ga0208975_10780332 | 3300027659 | Freshwater Lentic | MEDQVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0209551_12664252 | 3300027689 | Freshwater Lake | VLMEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0209443_10873971 | 3300027707 | Freshwater Lake | RRVGVLMEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV |
Ga0209297_10108496 | 3300027733 | Freshwater Lake | MTEEYAAQYWHQQGWLACRLAYKLYNDAQESGTVRV |
Ga0209190_100093916 | 3300027736 | Freshwater Lake | MEDEVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV |
Ga0209596_13280051 | 3300027754 | Freshwater Lake | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQDAGALRV |
Ga0209596_13576322 | 3300027754 | Freshwater Lake | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAVRV |
Ga0209500_103738882 | 3300027782 | Freshwater Lake | MEDQVKYIHMTEEYTAQYWHQQGWLACRLAYKLYNDAQDAGAVKV |
Ga0209500_103881711 | 3300027782 | Freshwater Lake | GTRTVLGGAMEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0209246_100656061 | 3300027785 | Freshwater Lake | LMEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0209972_103229012 | 3300027793 | Freshwater Lake | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV |
Ga0209107_103429063 | 3300027797 | Freshwater And Sediment | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDAQESGAVSV |
Ga0209990_101899473 | 3300027816 | Freshwater Lake | MEDKVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQEAGALKV |
Ga0209668_101842253 | 3300027899 | Freshwater Lake Sediment | MTEEYAAQYWHQQGWLACRLAYKLYIDAQEAGALKV |
Ga0209668_104321842 | 3300027899 | Freshwater Lake Sediment | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAEEAGAFRV |
Ga0209400_11595262 | 3300027963 | Freshwater Lake | MENQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQESGAVNV |
Ga0209191_10487995 | 3300027969 | Freshwater Lake | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQEAGAVKV |
Ga0209401_12650802 | 3300027971 | Freshwater Lake | LILVCRVGVLMEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0315291_111940552 | 3300031707 | Sediment | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDSQEAGAVNV |
Ga0315291_113953733 | 3300031707 | Sediment | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDAQEAGAVNV |
Ga0315288_112552633 | 3300031772 | Sediment | MEDEVKYIAMTDEYAAQYWHQQGWLACRLAYKLYNDS |
Ga0315904_102909111 | 3300031951 | Freshwater | VKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQEAGALKV |
Ga0315276_108306543 | 3300032177 | Sediment | MEDEVKYIHMTDEYAAKYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0315275_122614181 | 3300032401 | Sediment | MEDEVKYIHMTDEYAAQYWHQQGWLACRLAYKLYNDA |
Ga0334978_0294403_74_211 | 3300033979 | Freshwater | MEDQVKYIHMTEEYAAQYWHQQGWLACRLAYKLYNDAQDAGAFRV |
Ga0335003_0224756_780_884 | 3300033995 | Freshwater | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYN |
Ga0334979_0261529_402_551 | 3300033996 | Freshwater | MWEGILMEVKSVHMTDEYAAHYFYQMGWMACRLAYKLHEEAEQAGAFRV |
Ga0334986_0450263_112_249 | 3300034012 | Freshwater | MENEVKYIPMTDEYAAQYWHQQGWLACRLAYKLYIDAQEAGALKV |
Ga0335019_0150378_120_257 | 3300034066 | Freshwater | MEDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAQESGAVDV |
Ga0335058_0106689_1503_1637 | 3300034121 | Freshwater | EDEVKYIHMTEEYAAHYWHQQGWLACRLAYKLYNDAEEAGAFRV |
⦗Top⦘ |