NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F082567

Metagenome Family F082567

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082567
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 40 residues
Representative Sequence KANGLTVALGAGGTLSATYMSTPGNTTDLVFDVTGYYVP
Number of Associated Samples 75
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.80 %
% of genes near scaffold ends (potentially truncated) 95.58 %
% of genes from short scaffolds (< 2000 bps) 78.76 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.912 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen
(15.044 % of family members)
Environment Ontology (ENVO) Unclassified
(30.088 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.398 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF08486SpoIID 8.04
PF00535Glycos_transf_2 6.25
PF00534Glycos_transf_1 5.36
PF04989CmcI 2.68
PF13641Glyco_tranf_2_3 2.68
PF01370Epimerase 2.68
PF01863YgjP-like 1.79
PF01230HIT 1.79
PF13361UvrD_C 1.79
PF13517FG-GAP_3 1.79
PF00908dTDP_sugar_isom 1.79
PF13439Glyco_transf_4 1.79
PF01943Polysacc_synt 1.79
PF14667Polysacc_synt_C 0.89
PF00483NTP_transferase 0.89
PF13340DUF4096 0.89
PF02082Rrf2 0.89
PF00753Lactamase_B 0.89
PF08485Polysacc_syn_2C 0.89
PF01336tRNA_anti-codon 0.89
PF00160Pro_isomerase 0.89
PF00872Transposase_mut 0.89
PF13860FlgD_ig 0.89
PF13620CarboxypepD_reg 0.89
PF16363GDP_Man_Dehyd 0.89
PF13579Glyco_trans_4_4 0.89
PF07221GlcNAc_2-epim 0.89
PF13489Methyltransf_23 0.89
PF01979Amidohydro_1 0.89
PF00704Glyco_hydro_18 0.89
PF00106adh_short 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG2385Peptidoglycan hydrolase (amidase) enhancer domain SpoIIDCell wall/membrane/envelope biogenesis [M] 8.04
COG3510Cephalosporin hydroxylaseDefense mechanisms [V] 2.68
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 1.79
COG1451UTP pyrophosphatase, metal-dependent hydrolase familyGeneral function prediction only [R] 1.79
COG1898dTDP-4-dehydrorhamnose 3,5-epimerase or related enzymeCell wall/membrane/envelope biogenesis [M] 1.79
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.89
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.89
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.89
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.89
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.89
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.89
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.89
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.89
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.89
COG2942Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase familyCarbohydrate transport and metabolism [G] 0.89
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.91 %
UnclassifiedrootN/A30.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908044|A5_c1_ConsensusfromContig19242Not Available646Open in IMG/M
3300002069|JGIcombinedJ21912_10153466Not Available813Open in IMG/M
3300003369|JGI24140J50213_10115865Not Available876Open in IMG/M
3300003990|Ga0055455_10239444All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300005471|Ga0070698_100045863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4472Open in IMG/M
3300005879|Ga0075295_1043697Not Available592Open in IMG/M
3300005886|Ga0075286_1063763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300005890|Ga0075285_1061349All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006642|Ga0075521_10058857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1694Open in IMG/M
3300006795|Ga0075520_1012396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales4298Open in IMG/M
3300006795|Ga0075520_1457132Not Available505Open in IMG/M
3300009029|Ga0066793_10037025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermatophilaceae → Dermatophilus → Dermatophilus congolensis2735Open in IMG/M
3300009176|Ga0105242_12601478Not Available555Open in IMG/M
3300009548|Ga0116107_1151555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium639Open in IMG/M
3300009615|Ga0116103_1004972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4878Open in IMG/M
3300009615|Ga0116103_1027130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1770Open in IMG/M
3300009616|Ga0116111_1097915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium745Open in IMG/M
3300009617|Ga0116123_1006539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4581Open in IMG/M
3300009617|Ga0116123_1011973All Organisms → cellular organisms → Bacteria3038Open in IMG/M
3300009760|Ga0116131_1062239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1177Open in IMG/M
3300009822|Ga0105066_1132336Not Available565Open in IMG/M
3300009836|Ga0105068_1029919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium950Open in IMG/M
3300012355|Ga0137369_10587735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium776Open in IMG/M
3300012931|Ga0153915_10106899Not Available2980Open in IMG/M
3300012955|Ga0164298_10090060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloterricola → Methyloterricola oryzae1598Open in IMG/M
3300012960|Ga0164301_10251736All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloterricola → Methyloterricola oryzae1160Open in IMG/M
3300014490|Ga0182010_10041882All Organisms → cellular organisms → Bacteria2156Open in IMG/M
3300014490|Ga0182010_10817075Not Available529Open in IMG/M
3300014494|Ga0182017_10022819All Organisms → cellular organisms → Bacteria4309Open in IMG/M
3300014494|Ga0182017_10131261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1628Open in IMG/M
3300014494|Ga0182017_10778322Not Available578Open in IMG/M
3300014498|Ga0182019_10571255Not Available791Open in IMG/M
3300014498|Ga0182019_10600598Not Available773Open in IMG/M
3300014498|Ga0182019_10692744Not Available722Open in IMG/M
3300014498|Ga0182019_10737235Not Available701Open in IMG/M
3300014502|Ga0182021_10020869All Organisms → cellular organisms → Bacteria7750Open in IMG/M
3300014502|Ga0182021_10356303Not Available1730Open in IMG/M
3300014502|Ga0182021_10361933Not Available1716Open in IMG/M
3300014502|Ga0182021_11053534Not Available979Open in IMG/M
3300014502|Ga0182021_13537003Not Available519Open in IMG/M
3300014839|Ga0182027_10005297All Organisms → cellular organisms → Bacteria19651Open in IMG/M
3300014839|Ga0182027_10188588All Organisms → cellular organisms → Bacteria → Terrabacteria group2399Open in IMG/M
3300014839|Ga0182027_10528285All Organisms → cellular organisms → Bacteria → Terrabacteria group1283Open in IMG/M
3300014969|Ga0157376_11920726Not Available629Open in IMG/M
3300017929|Ga0187849_1087001All Organisms → cellular organisms → Bacteria → Terrabacteria group1351Open in IMG/M
3300017940|Ga0187853_10241928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium831Open in IMG/M
3300017997|Ga0184610_1205761Not Available658Open in IMG/M
3300018013|Ga0187873_1041613All Organisms → cellular organisms → Bacteria → Terrabacteria group2059Open in IMG/M
3300018013|Ga0187873_1277934All Organisms → cellular organisms → Bacteria → Terrabacteria group616Open in IMG/M
3300018023|Ga0187889_10000175All Organisms → cellular organisms → Bacteria75300Open in IMG/M
3300018024|Ga0187881_10111174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1228Open in IMG/M
3300018026|Ga0187857_10024975All Organisms → cellular organisms → Bacteria3283Open in IMG/M
3300018028|Ga0184608_10119256All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300018060|Ga0187765_10295110All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300018060|Ga0187765_10666384All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300018063|Ga0184637_10604971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300018075|Ga0184632_10155541All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300018075|Ga0184632_10311570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium680Open in IMG/M
3300018075|Ga0184632_10316181Not Available674Open in IMG/M
3300018078|Ga0184612_10313810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium802Open in IMG/M
3300022650|Ga0236339_1265451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi526Open in IMG/M
3300022694|Ga0222623_10067454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1383Open in IMG/M
3300022694|Ga0222623_10361749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M
3300023311|Ga0256681_11735016All Organisms → cellular organisms → Bacteria → Terrabacteria group627Open in IMG/M
3300023311|Ga0256681_12545775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium501Open in IMG/M
3300025325|Ga0209341_10159930All Organisms → cellular organisms → Bacteria1893Open in IMG/M
3300025326|Ga0209342_10081254All Organisms → cellular organisms → Bacteria → Proteobacteria3013Open in IMG/M
3300025441|Ga0208456_1071348Not Available625Open in IMG/M
3300025448|Ga0208037_1036304All Organisms → cellular organisms → Bacteria → Terrabacteria group1021Open in IMG/M
3300025725|Ga0209638_1047594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1776Open in IMG/M
3300025764|Ga0209539_1300047Not Available550Open in IMG/M
3300025846|Ga0209538_1045385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1896Open in IMG/M
3300025888|Ga0209540_10358831Not Available809Open in IMG/M
3300025888|Ga0209540_10423522All Organisms → cellular organisms → Bacteria → Terrabacteria group720Open in IMG/M
3300025922|Ga0207646_10389732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1258Open in IMG/M
3300026036|Ga0208650_1056420Not Available512Open in IMG/M
3300026450|Ga0247847_1033016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium686Open in IMG/M
3300029980|Ga0302298_10258829Not Available576Open in IMG/M
3300029989|Ga0311365_10243980All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300030002|Ga0311350_11800957Not Available541Open in IMG/M
3300030019|Ga0311348_10703102All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300031232|Ga0302323_100345130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1557Open in IMG/M
3300031232|Ga0302323_100564782All Organisms → cellular organisms → Bacteria → Terrabacteria group1229Open in IMG/M
3300031232|Ga0302323_101826884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi688Open in IMG/M
3300031834|Ga0315290_10168695All Organisms → cellular organisms → Bacteria1891Open in IMG/M
3300031834|Ga0315290_11257579Not Available612Open in IMG/M
3300031873|Ga0315297_10047342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_183243Open in IMG/M
3300031873|Ga0315297_10158116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1846Open in IMG/M
3300031873|Ga0315297_10217286All Organisms → cellular organisms → Bacteria → Terrabacteria group1578Open in IMG/M
3300031873|Ga0315297_10231907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1527Open in IMG/M
3300031918|Ga0311367_10902788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium889Open in IMG/M
3300031918|Ga0311367_11858728Not Available584Open in IMG/M
3300031965|Ga0326597_10257641All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300031965|Ga0326597_10393312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1543Open in IMG/M
3300031965|Ga0326597_12152194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium511Open in IMG/M
3300031997|Ga0315278_10109778All Organisms → cellular organisms → Bacteria2788Open in IMG/M
3300032164|Ga0315283_10233950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1984Open in IMG/M
3300032164|Ga0315283_10745965Not Available1052Open in IMG/M
3300032177|Ga0315276_10336140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1610Open in IMG/M
3300032342|Ga0315286_10190261All Organisms → cellular organisms → Bacteria2196Open in IMG/M
3300032397|Ga0315287_10013120All Organisms → cellular organisms → Bacteria8541Open in IMG/M
3300032397|Ga0315287_10374289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1685Open in IMG/M
3300032397|Ga0315287_10374289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1685Open in IMG/M
3300032397|Ga0315287_10912973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1027Open in IMG/M
3300032397|Ga0315287_11078022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium931Open in IMG/M
3300032401|Ga0315275_10969011Not Available936Open in IMG/M
3300033433|Ga0326726_10614389All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1046Open in IMG/M
3300033486|Ga0316624_10054154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2584Open in IMG/M
3300034195|Ga0370501_0019305All Organisms → cellular organisms → Bacteria → Terrabacteria group1974Open in IMG/M
3300034195|Ga0370501_0081362Not Available1071Open in IMG/M
3300034195|Ga0370501_0277993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium601Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment15.04%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen15.04%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil9.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.96%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen7.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.19%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.42%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.65%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.77%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.77%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.77%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
3300002069Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300022650Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025441Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025764Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025846Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026036Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026450Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25EnvironmentalOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033820Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-DEnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A5_c1_003023602124908044SoilNFPVRDTRANGVTVALSGSGTLNALYTGPAGATIHILFDVTGYFK
JGIcombinedJ21912_1015346623300002069Arctic Peat SoilTRANGVTVRLSAKGTLSAVFKGTAGATTALVFDVTGYFLP*
JGI24140J50213_1011586523300003369Arctic Peat SoilGDIKGNGLTVALGAAGTLSVTYISTPGNTTDLVFDVTGYYVP*
Ga0055455_1023944413300003990Natural And Restored WetlandsDTRANGITVPLGADGTLSATLKGASGATTALVFDVTGYFLP*
Ga0070698_10004586373300005471Corn, Switchgrass And Miscanthus RhizosphereDNRANGVTVALGAGGTLSITYLAASGTTDFVFDVTGYFVP*
Ga0075295_104369723300005879Rice Paddy SoilRANGVTVALGSGGKLSATYISSAGGTTQLIFDVTGYFVP*
Ga0075286_106376313300005886Rice Paddy SoilGVTVGLGSGGTLSATFVATAGARTNLVFDVTGYFTP*
Ga0075285_106134913300005890Rice Paddy SoilGDIRANGMTVKLGAGGTLSAVYKAGGGTTDLVYDVFGYYK*
Ga0075521_1005885713300006642Arctic Peat SoilNRGDIKANGLTVALGAGGTLSATYMSTPGNTTDLVFDVTGYYVP*
Ga0075520_101239613300006795Arctic Peat SoilKGNGLTVALSATGSLSATYMSNPGNTTNLVFDVTGYFVP*
Ga0075520_145713213300006795Arctic Peat SoilLTVALSSGGTLSSTYMSTAGNTTDLVFDVTGYFVPAAG*
Ga0066793_1003702513300009029Prmafrost SoilTGVTVALGTGGTLSAVFKGSGGTTALVFDVTGYFVR*
Ga0105242_1260147823300009176Miscanthus RhizosphereSTINVPVGDNRANGVDVGLAANGSLSAVWVGNTPTSTTHVIFDVTGYFR*
Ga0116107_115155523300009548PeatlandTVALGSGGTLSATYMSNPGNRTDLVFDVSGYYAP*
Ga0116103_100497243300009615PeatlandQIVGNGLTVALGSGGTLSATYMSTAGNKTDLVFDVAGYFAP*
Ga0116103_102713033300009615PeatlandTVALGSAGTLSATYMSTAGATTDLVFDVTGYFTP*
Ga0116111_109791523300009616PeatlandLTVALGSAGTLSATYMSTAGATTDLVFDVTGYFTP*
Ga0116123_100653913300009617PeatlandIVGNGLTVALGSGGTLSATYLSTAGAKTDLVFDVSGYFAP*
Ga0116123_101197313300009617PeatlandEILANGLTVALGSAGTLSATYMSTAGATTDLVFDVTGYFTP*
Ga0116131_106223913300009760PeatlandVGNGLTVALGSGGTLSATYMSTAGNKTDLVFDVSGYFAP*
Ga0105066_113233623300009822Groundwater SandGVTVALGAGGALSATYISGTGGYTHLVFDVTGYFMP*
Ga0105068_102991913300009836Groundwater SandNGVTVALGAGGALSATYISGTGGYTHLVFDVTGYFMP*
Ga0137369_1058773533300012355Vadose Zone SoilVTVGLGGAGTLSITYLASSGASTDFVFDVTGYFVH*
Ga0153915_1010689913300012931Freshwater WetlandsDNRANGVTVTLSGSGTLSATYMASAGASTQLVFDVTGYFVP*
Ga0164298_1009006013300012955SoilLTVALSPAGTLSATFVGSSSATAQIVFDVTGYYQ*
Ga0164301_1025173613300012960SoilNGLTVALSPAGTLSATFVGSSSATAQVVFDVTGYYQ*
Ga0182010_1004188213300014490FenTVALSSSGTLSATYMAGAGATTDLVFDVTGYFTK*
Ga0182010_1081707513300014490FenIKGNGLAVGLGSGGSLSATYISTAGNKTDLVFDVTGYFTP*
Ga0182017_1002281963300014494FenGDIVANGVTVALSSSGTLSATYMAGAGATTDLVFDVTGYFTK*
Ga0182017_1013126133300014494FenMTVALSGIESLSVTYMPNPGNRTDLVFDVSGYYAP*
Ga0182017_1077832213300014494FenFVKGDIKGNGLAVALGSGGSLSATYVSLAGNTTDLVFDVTGYFAP*
Ga0182019_1057125523300014498FenTVALSATGTLSATYSGGVGQTTQLIFDVTGYFVP*
Ga0182019_1060059813300014498FenNRANGVTVALSGSGSLWALYDTGGPGQTSDLVFDVTGYFVP*
Ga0182019_1069274413300014498FenNRANGVTAALSATGTLSATYIAGAGQTTQLIFDVTGYFVPLR*
Ga0182019_1073723513300014498FenSNGVTVALSGGGALSVTYMGGPGATTNVAFVVTGYFAP*
Ga0182021_1002086913300014502FenNRANGVTVALSGTGGLSATFVGSSGGATTDLLFDVTGYFVP*
Ga0182021_1035630333300014502FenVKGDIKGNGLAVALGSGGGLSATYMSTTGNTTDLVFDVTGYFAP*
Ga0182021_1036193333300014502FenKGNGLAVALGSGGSLSATYVSVAGNTTDLVFDVTGYFAP*
Ga0182021_1105353433300014502FenDNRANGVTVALSATGTLSATYSGGVGQTTQLIFDVTGYFVP*
Ga0182021_1353700313300014502FenANGVTVALSGTGSLSATFVGSSGSATTQLIFDVTGYFVP*
Ga0182027_1000529713300014839FenNGLTVALSSSGTLSATYISSAGATTDLVFDVTGYFTP*
Ga0182027_1018858823300014839FenGVTVALGSGGTLSATYISYSGNTTDLIFDATGYYEP*
Ga0182027_1052828513300014839FenKGNGLAVALGSGGGLSATYMSTTGNTTDLVFDVTGFFAP*
Ga0157376_1192072623300014969Miscanthus RhizospherePLGDTRANGLTVALSPAGTLSATYVASSSSATAQVLFDVTGYYQ*
Ga0187849_108700113300017929PeatlandIVGNGLTVALGSGGTLSATYLSTAGAKTDLVFDVSGYFAP
Ga0187853_1024192813300017940PeatlandNGVTVALGSGGTLSATYMSNPGNRTDLVFDVSGYYAP
Ga0184610_120576123300017997Groundwater SedimentDNRANGVTVALGAGGSLSATYRALGGAGSTDLVFDVTGYFVP
Ga0187873_104161333300018013PeatlandLANGVTVGLSGTGTLSATYISTTGQTTNLVFDVTGYFVH
Ga0187873_127793423300018013PeatlandTTVGLASGGILYPTYMSNAGNTTDLVLDVTGYFLP
Ga0187889_1000017513300018023PeatlandEILANGLTVALGSAGTLSATYMSTAGATTDLVFDVTGYFTP
Ga0187881_1011117423300018024PeatlandFKKGQIVGNGLTVALGSGGTLSATYLSTAGAKTDLVFDVSGYFAP
Ga0187857_1002497553300018026PeatlandIAGNGVTVALGSGGTLSATYMSNPGNRTDLVFDVSGYYAP
Ga0184608_1011925643300018028Groundwater SedimentLGDTRANGVTVALSLSGTLSATFGYAGSTQLIFDVTGYFVE
Ga0187765_1029511023300018060Tropical PeatlandNGLAVAVGSSGTLSGVYMSISGNTTDVVVDVTGYFAP
Ga0187765_1066638423300018060Tropical PeatlandLGTGGTLSATYMSNLGNTTHLVFDVTGYFEMPIPS
Ga0184637_1060497113300018063Groundwater SedimentLNFPAGDSRANGVTAALSPTGSLSATYGPSSGAATDLVFDVTGYFVP
Ga0184632_1015554113300018075Groundwater SedimentPLGDTRANGVTVALGLDGTLSATFAYSGSTDLIFDVTGYFVD
Ga0184632_1031157013300018075Groundwater SedimentLGDTRANGVTVALSSTGSLSATFGYAGTTDLVFDVTGYFVP
Ga0184632_1031618113300018075Groundwater SedimentDNRANGVTVALGPGGTLSATYVTGSWSGTTDVVFDVTGYFVP
Ga0184612_1031381013300018078Groundwater SedimentRANGVTVALGPGGALSATYISGTGGSTHLVFDVTGYFVP
Ga0236339_126545113300022650FreshwaterKGQVTGNGLTVALSATGSLSATYISSPGNTTDLVFEVTGYFGP
Ga0222623_1006745443300022694Groundwater SedimentTGVTVALGPGGTLSATSGYAGTTDLVFDVTGYFFLN
Ga0222623_1036174913300022694Groundwater SedimentVGDTRSNGVTVALSSTGTLSATFGYAGSTDLVFDVTGYFVP
Ga0256681_1173501613300023311FreshwaterVKGNGLTVALGSGGKLSATYISTAGNVTDLVFDVTGYFVPAGG
Ga0256681_1254577513300023311FreshwaterNFLAGDIRGNGLTIPLGSGGTLSATYLSTSGNTTDLVVDVTGYFAP
Ga0209341_1015993033300025325SoilANGVTLALSGSGTLSATYLAAAGKTTDFIFDVTGYFDAP
Ga0209342_1008125453300025326SoilADNRANGVTLALGAGGTLSATLAPSGTTDLVFDVTGYFVD
Ga0208456_107134813300025441PeatlandDIRANNLAVALSGTGTLSATYMSSAGNKTDLVFDVTGYFVP
Ga0208037_103630413300025448PeatlandQIVGNGLTVALGSGGTLSATYLSTAGAKTDLVFDVSGYFAP
Ga0209638_104759423300025725Arctic Peat SoilGLTVALGSGGTLSATYMSFAGNTTDLVFDVTGYYVP
Ga0209539_130004713300025764Arctic Peat SoilPKGDTRATGVTVALGTGGTLSAVFKGSGGTTALVFDVTGYFR
Ga0209538_104538523300025846Arctic Peat SoilTGVTVTLGAGGTLSAVFKGGGGATTALVFDVTGYFR
Ga0209014_1012098013300025857Arctic Peat SoilGVTVALSGTGTLSATYMGSVGGATTDLLFDVTGYFVP
Ga0209540_1035883123300025888Arctic Peat SoilPVGDTRATGVTVTLGAGGTLSAVFRGGGGTTTALVFDVTGYFR
Ga0209540_1042352213300025888Arctic Peat SoilKGDTRATGVTVALGTGGTLSAFFKGATGATTALIFDVTGYFVR
Ga0207646_1038973233300025922Corn, Switchgrass And Miscanthus RhizosphereVGDNRANGVTVALGAGGTLSITYLAASGTTDFVFDVTGYFVP
Ga0208650_105642023300026036Rice Paddy SoilLGDNRANGVTVGLGSGGTLSATFVATAGARTNLVFDVTGYFTP
Ga0247847_103301623300026450SoilVKDNGVTVSLSATGMLSATYMSTPKNTTDLVLDVTGYFVP
Ga0302298_1025882913300029980FenFKAGDIRANGLTVALGLGGILSATYISTPGNTTDLVFDMTGYFVPAG
Ga0311365_1024398013300029989FenGLTVALGAGGTLSATYMSTPGNTTDLVFDVTGYYVP
Ga0311350_1180095713300030002FenANGLTVALGLGGILSATYISTAGNTTDLVFDMTGYFVPAG
Ga0311348_1070310223300030019FenNFNKGDIKANGLTVELSPTGTLAVTYISTAGNTTDLVFDVTGYYLP
Ga0302323_10034513023300031232FenKANGLTVALGAGGTLSATYMSTPGNTTDLVFDVTGYYVP
Ga0302323_10056478213300031232FenLTVALGLGGILSATYISTAGNTTDLVFDMTGYFVPAG
Ga0302323_10182688423300031232FenGLTVALGVGGILSATYISTAGNTTDLVFDMTGYFVPAG
Ga0315290_1016869513300031834SedimentNRANGVTVALSATGTLSATYMGEVGSATTHLVFDVTGYFVP
Ga0315290_1125757913300031834SedimentANGVTVALSGTGTLSATYMGEVGSATTHLIFDVTGYFVP
Ga0315297_1004734223300031873SedimentVTVALSATGTLSATYMGEVGSATTHLVFDVTGYFVP
Ga0315297_1015811633300031873SedimentNGVTVALSGTGTLSATYMGEAGPSATTHLIFDVTGYFVP
Ga0315297_1021728613300031873SedimentFPLGDNRANGVTVALSGTGTLSATYMGEVGTATTHLIFDVTGYFVP
Ga0315297_1023190723300031873SedimentNGVTVALSATGTLSATYMGEVGSATTHLVFDVTGYFVP
Ga0311367_1090278813300031918FenKANGLTVALSPSGTLSATYMSTPGNATDLVFDVTGYYVP
Ga0311367_1185872813300031918FenRGDIKGNGLAVGLGSGGSLSATYISNAGNKTDLVFDVTGYFTP
Ga0326597_1025764113300031965SoilGQTIANGVTVALGAGGTLSATYLSSPGKTVALIFDVTGYFVP
Ga0326597_1039331213300031965SoilGDNVANGVTVALGAGGTLSATYLSTPGNTTALVFDVTGYFVP
Ga0326597_1215219423300031965SoilRANGVTVALSPTGSLSATNGYAGTTDLVFDVTGYFVP
Ga0315278_1010977813300031997SedimentDWANGVTVPLGGTGTLSATYVTGGPGHTTHLVFDVTGYFVPE
Ga0315283_1023395013300032164SedimentNRANGVTVALSGTGTLSATYMGEAGPSATTHLIFDVTGYFVP
Ga0315283_1074596513300032164SedimentDNRANGVTVPLSGTGTLSATYLENGPGSPTTHLIFDVTGYFAP
Ga0315276_1033614013300032177SedimentDNRANGVTVALSATGTLSATYVGAAGPSATTHLIFDVTGYFAP
Ga0315286_1019026113300032342SedimentRANGVTVALSATGTLSATYMGEVGSATTHLVFDVTGYFVP
Ga0315287_1001312093300032397SedimentGVTVALSGTGTLSATYMGEAGPSATTHLIFDVTGYFVP
Ga0315287_1037428913300032397SedimentGVTVALSATGTLSATYVGAAGPSATTHLIFDVTGYFAP
Ga0315287_1037428933300032397SedimentNFPVGDNRANGVTVALSATGTLSATYVGAAGPSATTHLIFDVTGYFVP
Ga0315287_1091297323300032397SedimentVNRANGVTVALSRTGTLSATYMGAAGPSATTDLIFDVTGYFVP
Ga0315287_1107802223300032397SedimentFPVGDNRANGVTVALSATGTLSATYVGAAGPSATTHLIFDVTGYFVP
Ga0315275_1096901123300032401SedimentNGVTVALSGTGTLSATYMGEVGTATTHLIFDVTGYFVP
Ga0326726_1061438913300033433Peat SoilTVALGAGGTLSATYLAPAGATTDLIFDVTGYFVPE
Ga0316624_1005415443300033486SoilGLTVELGLSGSLSATYISFGGETTDLILDMTGYFVK
Ga0334817_023806_11_1183300033820SoilVTVTLGAGGILYVTYVGSAGATTQVSFDVTGYFVK
Ga0370501_0019305_13_1233300034195Untreated Peat SoilVTVALSGTGTLSATYMGETGSATTHLIFDVTGYFLP
Ga0370501_0081362_960_10703300034195Untreated Peat SoilTVALGSGGTLSATYAGEAGPSATTQLIFDVTGFFVH
Ga0370501_0277993_2_1303300034195Untreated Peat SoilGDIKGNGLTVALGAGGTLSVTYISTPGNTTDLVLDVTGYYVP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.