| Basic Information | |
|---|---|
| Family ID | F082514 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MNDLFLLEPEFQYHASRARAELKPVRYRKWRRRLEWDGPDAATNEKNWIN |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.99 % |
| % of genes near scaffold ends (potentially truncated) | 26.55 % |
| % of genes from short scaffolds (< 2000 bps) | 85.84 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.637 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (7.965 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.168 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.867 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.59% β-sheet: 0.00% Coil/Unstructured: 56.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13191 | AAA_16 | 61.06 |
| PF01979 | Amidohydro_1 | 13.27 |
| PF13147 | Obsolete Pfam Family | 11.50 |
| PF07969 | Amidohydro_3 | 4.42 |
| PF13671 | AAA_33 | 0.88 |
| PF08007 | JmjC_2 | 0.88 |
| PF02781 | G6PD_C | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.88 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.64 % |
| Unclassified | root | N/A | 43.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_135704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 553 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1889568 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300000956|JGI10216J12902_115378082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 662 | Open in IMG/M |
| 3300001536|A1565W1_12108191 | Not Available | 1262 | Open in IMG/M |
| 3300001538|A10PFW1_10041139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. | 1510 | Open in IMG/M |
| 3300002568|C688J35102_120207800 | Not Available | 927 | Open in IMG/M |
| 3300002568|C688J35102_120319441 | Not Available | 988 | Open in IMG/M |
| 3300002568|C688J35102_120666155 | Not Available | 1319 | Open in IMG/M |
| 3300002568|C688J35102_120766235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1521 | Open in IMG/M |
| 3300003321|soilH1_10044917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1185 | Open in IMG/M |
| 3300004114|Ga0062593_100045362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2682 | Open in IMG/M |
| 3300004157|Ga0062590_100620581 | Not Available | 955 | Open in IMG/M |
| 3300004479|Ga0062595_102447276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300004479|Ga0062595_102648493 | Not Available | 504 | Open in IMG/M |
| 3300005093|Ga0062594_100078809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1856 | Open in IMG/M |
| 3300005327|Ga0070658_10778979 | Not Available | 831 | Open in IMG/M |
| 3300005329|Ga0070683_100014231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 6954 | Open in IMG/M |
| 3300005329|Ga0070683_100202155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1887 | Open in IMG/M |
| 3300005329|Ga0070683_101370623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 680 | Open in IMG/M |
| 3300005332|Ga0066388_100310631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2222 | Open in IMG/M |
| 3300005335|Ga0070666_11152649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 577 | Open in IMG/M |
| 3300005365|Ga0070688_101591994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 533 | Open in IMG/M |
| 3300005366|Ga0070659_101324577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 639 | Open in IMG/M |
| 3300005530|Ga0070679_101017748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 773 | Open in IMG/M |
| 3300005535|Ga0070684_100167220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1997 | Open in IMG/M |
| 3300005546|Ga0070696_101562160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 566 | Open in IMG/M |
| 3300005548|Ga0070665_100000566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 51646 | Open in IMG/M |
| 3300005548|Ga0070665_101244778 | Not Available | 755 | Open in IMG/M |
| 3300005614|Ga0068856_101350278 | Not Available | 728 | Open in IMG/M |
| 3300005615|Ga0070702_100374709 | Not Available | 1010 | Open in IMG/M |
| 3300005618|Ga0068864_101179739 | Not Available | 764 | Open in IMG/M |
| 3300005764|Ga0066903_100866998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1628 | Open in IMG/M |
| 3300005764|Ga0066903_101303658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1357 | Open in IMG/M |
| 3300005834|Ga0068851_10902175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 554 | Open in IMG/M |
| 3300005842|Ga0068858_101421465 | Not Available | 683 | Open in IMG/M |
| 3300005843|Ga0068860_100071362 | Not Available | 3300 | Open in IMG/M |
| 3300005843|Ga0068860_100933450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. | 884 | Open in IMG/M |
| 3300005900|Ga0075272_1099907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 557 | Open in IMG/M |
| 3300005937|Ga0081455_10225341 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300006755|Ga0079222_10417967 | Not Available | 942 | Open in IMG/M |
| 3300006806|Ga0079220_10911077 | Not Available | 684 | Open in IMG/M |
| 3300006953|Ga0074063_13621765 | Not Available | 666 | Open in IMG/M |
| 3300006954|Ga0079219_10841646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 730 | Open in IMG/M |
| 3300006954|Ga0079219_11402128 | Not Available | 624 | Open in IMG/M |
| 3300009093|Ga0105240_11064021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 862 | Open in IMG/M |
| 3300009094|Ga0111539_13094400 | Not Available | 537 | Open in IMG/M |
| 3300009098|Ga0105245_10007839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 9352 | Open in IMG/M |
| 3300009176|Ga0105242_10833139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 916 | Open in IMG/M |
| 3300009177|Ga0105248_11028687 | Not Available | 931 | Open in IMG/M |
| 3300009789|Ga0126307_11141876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. | 630 | Open in IMG/M |
| 3300009870|Ga0131092_10021359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 10183 | Open in IMG/M |
| 3300010042|Ga0126314_10789324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 699 | Open in IMG/M |
| 3300010044|Ga0126310_10011177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 4186 | Open in IMG/M |
| 3300010358|Ga0126370_11960543 | Not Available | 571 | Open in IMG/M |
| 3300010373|Ga0134128_12864565 | Not Available | 531 | Open in IMG/M |
| 3300010870|Ga0102750_10906366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 532 | Open in IMG/M |
| 3300011119|Ga0105246_11217607 | Not Available | 694 | Open in IMG/M |
| 3300012011|Ga0120152_1121110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 719 | Open in IMG/M |
| 3300012469|Ga0150984_107490113 | Not Available | 715 | Open in IMG/M |
| 3300012943|Ga0164241_10001318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 31629 | Open in IMG/M |
| 3300012943|Ga0164241_11157436 | Not Available | 571 | Open in IMG/M |
| 3300012960|Ga0164301_11890052 | Not Available | 504 | Open in IMG/M |
| 3300012971|Ga0126369_12841624 | Not Available | 567 | Open in IMG/M |
| 3300012985|Ga0164308_10770972 | Not Available | 836 | Open in IMG/M |
| 3300013105|Ga0157369_11194014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 777 | Open in IMG/M |
| 3300013296|Ga0157374_11763859 | Not Available | 644 | Open in IMG/M |
| 3300013297|Ga0157378_11198477 | Not Available | 799 | Open in IMG/M |
| 3300013306|Ga0163162_10277077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1809 | Open in IMG/M |
| 3300014497|Ga0182008_10364410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 769 | Open in IMG/M |
| 3300014497|Ga0182008_10402477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 736 | Open in IMG/M |
| 3300014969|Ga0157376_12461060 | Not Available | 560 | Open in IMG/M |
| 3300015371|Ga0132258_11623928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1631 | Open in IMG/M |
| 3300015372|Ga0132256_101836868 | Not Available | 714 | Open in IMG/M |
| 3300015373|Ga0132257_102472809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 674 | Open in IMG/M |
| 3300015373|Ga0132257_102731163 | Not Available | 643 | Open in IMG/M |
| 3300015374|Ga0132255_101588062 | Not Available | 991 | Open in IMG/M |
| 3300020070|Ga0206356_11763461 | Not Available | 977 | Open in IMG/M |
| 3300020081|Ga0206354_11039041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 755 | Open in IMG/M |
| 3300021384|Ga0213876_10505981 | Not Available | 643 | Open in IMG/M |
| 3300021445|Ga0182009_10325214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 780 | Open in IMG/M |
| 3300025899|Ga0207642_10523740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 729 | Open in IMG/M |
| 3300025904|Ga0207647_10050009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2590 | Open in IMG/M |
| 3300025904|Ga0207647_10364821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 817 | Open in IMG/M |
| 3300025908|Ga0207643_10237158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA0032 | 1120 | Open in IMG/M |
| 3300025919|Ga0207657_11386299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 528 | Open in IMG/M |
| 3300025920|Ga0207649_11350712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 564 | Open in IMG/M |
| 3300025921|Ga0207652_11382006 | Not Available | 607 | Open in IMG/M |
| 3300025934|Ga0207686_11046527 | Not Available | 664 | Open in IMG/M |
| 3300025934|Ga0207686_11096621 | Not Available | 649 | Open in IMG/M |
| 3300025940|Ga0207691_10651653 | Not Available | 890 | Open in IMG/M |
| 3300025941|Ga0207711_11711138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 572 | Open in IMG/M |
| 3300025944|Ga0207661_10145481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2044 | Open in IMG/M |
| 3300025944|Ga0207661_10264594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1533 | Open in IMG/M |
| 3300025945|Ga0207679_10064201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2743 | Open in IMG/M |
| 3300025960|Ga0207651_10508168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1043 | Open in IMG/M |
| 3300025986|Ga0207658_11094794 | Not Available | 728 | Open in IMG/M |
| 3300026023|Ga0207677_11891065 | Not Available | 554 | Open in IMG/M |
| 3300026035|Ga0207703_11004898 | Not Available | 800 | Open in IMG/M |
| 3300028379|Ga0268266_10000596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 49462 | Open in IMG/M |
| 3300028379|Ga0268266_11527229 | Not Available | 643 | Open in IMG/M |
| 3300028768|Ga0307280_10185023 | Not Available | 731 | Open in IMG/M |
| 3300031938|Ga0308175_100084177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2877 | Open in IMG/M |
| 3300031938|Ga0308175_100087805 | Not Available | 2826 | Open in IMG/M |
| 3300031938|Ga0308175_100171661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 2104 | Open in IMG/M |
| 3300031938|Ga0308175_100935405 | Not Available | 955 | Open in IMG/M |
| 3300031938|Ga0308175_101526660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides lijunqiniae | 746 | Open in IMG/M |
| 3300031939|Ga0308174_10245764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1388 | Open in IMG/M |
| 3300031939|Ga0308174_10325561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1218 | Open in IMG/M |
| 3300031996|Ga0308176_10755572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1013 | Open in IMG/M |
| 3300031996|Ga0308176_10964168 | Not Available | 898 | Open in IMG/M |
| 3300032080|Ga0326721_10301288 | Not Available | 894 | Open in IMG/M |
| 3300034268|Ga0372943_0308927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1005 | Open in IMG/M |
| 3300034268|Ga0372943_0910770 | Not Available | 585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 7.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010870 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_02200380 | 2199352025 | Soil | MMNDMFLLEPEFQYHAKRTRAELRPVRYRKWRRRIQWEGPEAATNEKNWIN |
| ICChiseqgaiiDRAFT_18895682 | 3300000033 | Soil | MNDLFLLEPELQYHVKRTRDELKPVRYRKWRRRLEWDGPDGATNEKNWIN* |
| JGI10216J12902_1153780821 | 3300000956 | Soil | MNDLFSLEPEYRYKAARARQELRGARYRRWRRRIEWDGPEASTDAKNWIN* |
| A1565W1_121081913 | 3300001536 | Permafrost | MRTMNDLFMLEPEFHYRATRTRNQLRPVRYRRWRKRLEKGGPAAATNEKNWIN* |
| A10PFW1_100411393 | 3300001538 | Permafrost | MNDLFMLEPEFHYRATRTRNQLRPVRYRRWRKRLEKGGPAAA |
| C688J35102_1202078001 | 3300002568 | Soil | MNDFFLLVPEYQYHANRAREELKPVRYRKWRRRLQGDGPGGATNEKNWIN* |
| C688J35102_1203194411 | 3300002568 | Soil | MNDLYLLEPELKYHTARTRAELKPVRYRKWRRRLEWDGPQGATNEKNWIN* |
| C688J35102_1206661551 | 3300002568 | Soil | MNDLFLLEPEYRYHAERARHELKPVRYRKWRRRLHGAATNEKNWIN* |
| C688J35102_1207662351 | 3300002568 | Soil | MMNDMFLLEPEYQYHASRTRAELRPVRYRKWRRRLKWDGAAAATDEKNWIN* |
| soilH1_100449172 | 3300003321 | Sugarcane Root And Bulk Soil | MNDLFLLEPEYQYRAKRARQALKPVRYRKWRRRLEWDGPAAATDEKNWIN* |
| Ga0062593_1000453623 | 3300004114 | Soil | MNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGATDEKNWIN* |
| Ga0062590_1006205812 | 3300004157 | Soil | MNDLFLLEPELQYHVKRTRAELKPVRYRKWRRRLEWDGPSAATNEKNWIN* |
| Ga0062595_1024472761 | 3300004479 | Soil | MNDLFTLEPEYRYHAARARLELKNARYRKWRRRLEWDGPDAASDAKNWIN* |
| Ga0062595_1026484931 | 3300004479 | Soil | GNTEMNDLFLLEPEYRYRAERARQELRPVRYRKWRRRLLGGPGAATNEKNWIN* |
| Ga0062594_1000788092 | 3300005093 | Soil | MNDLFLLEPEFHYHAKRAREELKPVRYRKWRRRVEWDGPAGATNEKNWIN* |
| Ga0070658_107789792 | 3300005327 | Corn Rhizosphere | MNDLSMLEPELQYRAARAHEELRPVRYRKWRRRLEHGGPRAATNEKNWIS* |
| Ga0070683_1000142315 | 3300005329 | Corn Rhizosphere | MSDMFLLKPEFEYHARRTRAALRPTRYRKWRRRLEWDGPDAATDEKNWIN* |
| Ga0070683_1002021552 | 3300005329 | Corn Rhizosphere | MNDLFLLEPELQYHVKRTRDELKPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0070683_1013706231 | 3300005329 | Corn Rhizosphere | MNDLFTLEPEYRYHAARARLELKNSRYRRWRRRLEWDGPDAATDAKNWIN* |
| Ga0066388_1003106312 | 3300005332 | Tropical Forest Soil | MNDLFLLEPEFQYHAKRVRSELKPVRYRKWRRRVEWDGPSAATDEKNWIN* |
| Ga0070666_111526492 | 3300005335 | Switchgrass Rhizosphere | MNDLFLLEPEFQYHASRARAELKPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0070688_1015919942 | 3300005365 | Switchgrass Rhizosphere | MNDLFLLEPEFQYHAKRARAELKPVRYRKWRRRLEWDGPSAATNEKNWIN* |
| Ga0070659_1013245772 | 3300005366 | Corn Rhizosphere | MQDLFILEPEFQYHAKRARAELKPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0070679_1010177482 | 3300005530 | Corn Rhizosphere | MNDWYLLIPEYDYHAKRARHELKPVRYRKWRRRLEGEGPHAATNEKNWIN* |
| Ga0070684_1001672202 | 3300005535 | Corn Rhizosphere | MNDLYLLESELKYHTARTRAELKPVRYRKWRRRLEWDGPQGATNEKNWIN* |
| Ga0070696_1015621601 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VMNDLFLLEPEFQYHASRARAELKPVRYRKWRRRLEWDGPEGATDEKNWIN* |
| Ga0070665_10000056620 | 3300005548 | Switchgrass Rhizosphere | MQDLFLLEPEFQYHAKRARAELKPVRYRKWRRRLEWDGPSAATNEKNWIN* |
| Ga0070665_1012447782 | 3300005548 | Switchgrass Rhizosphere | VSAEHEHEGITAMNDLFLLEPELKYHTSRTRDELKPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0068856_1013502782 | 3300005614 | Corn Rhizosphere | FTLEPEYRYHAARARLELKNSRYRRWRRRLEWDGPDAATDAKNWIN* |
| Ga0070702_1003747092 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | QPDKNLKGMRTMNDLFLLEPEFHYHAKRAREELKPVRYRKWRRRVEWDGPAGATNEKNWIN* |
| Ga0068864_1011797392 | 3300005618 | Switchgrass Rhizosphere | MNDLFLLEPEFQYHASRARAELRPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0066903_1008669982 | 3300005764 | Tropical Forest Soil | MNDLFLLEPEFQYHAKRVRGELKPVRYRKWRRRVEWDGPSAATDEKNWIN* |
| Ga0066903_1013036582 | 3300005764 | Tropical Forest Soil | MNNDFLVSQAEYQYRAERNRRQLQPVRHRKWRKRLEWDGPRAATDVKNWIN* |
| Ga0068851_109021751 | 3300005834 | Corn Rhizosphere | LLEPEFQYHASRARAELKPVRYRKWRRRLEWDGPSAATNEKNWIN* |
| Ga0068858_1014214652 | 3300005842 | Switchgrass Rhizosphere | HEGITEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0068860_1000713621 | 3300005843 | Switchgrass Rhizosphere | DLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGATDEKNWIN* |
| Ga0068860_1009334502 | 3300005843 | Switchgrass Rhizosphere | MNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0075272_10999072 | 3300005900 | Rice Paddy Soil | MNDLFLLEPEYHYHAERARQELKPVRYRRWRRRMQDGAAGATSEKNWIS* |
| Ga0081455_102253412 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNDLFLLEPEFQYHAERARHELKPVRYRKWRRRLHGAATDEKNWIN* |
| Ga0079222_104179672 | 3300006755 | Agricultural Soil | MNDLFLLEPEFQYHAKRARAELKPVRYRKWRRRLEWHGPDAATDEKNWIN* |
| Ga0079220_109110771 | 3300006806 | Agricultural Soil | RAMNDLFLLEPEFQYHAKRARAELKPVRYRKWRRRLEWHGPDAATDEKNWIN* |
| Ga0074063_136217651 | 3300006953 | Soil | MNDLFLLEPEYHYHTERARRQLKAVRYRKWRRRLDFDGPQAVTDEKNWIALDKKN |
| Ga0079219_108416462 | 3300006954 | Agricultural Soil | MNDLFLLEPEYQYRASRAHEELKPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0079219_114021282 | 3300006954 | Agricultural Soil | MRTMNDLFLLEPEYQYHAERARHELKPVRYRKWRRRLHGAATNEKNWIN* |
| Ga0105240_110640212 | 3300009093 | Corn Rhizosphere | PALPHGASLYVSARHRHEGITEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGATDEKNWIN* |
| Ga0111539_130944001 | 3300009094 | Populus Rhizosphere | MSARHRHEGITEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGATDEKNWIN* |
| Ga0105245_100078398 | 3300009098 | Miscanthus Rhizosphere | VSARHRHEGITEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGATDEKNWIN* |
| Ga0105242_108331391 | 3300009176 | Miscanthus Rhizosphere | MNDLFLLEPEFQYHASRSRAELRPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0105248_110286871 | 3300009177 | Switchgrass Rhizosphere | RHEGITEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0126307_111418762 | 3300009789 | Serpentine Soil | MSARHRPEGKIVMNNMFLLEPEFQYHAKRARAELRPVRYRKWRRRLKWDGPAAATDEKNWIN* |
| Ga0131092_100213598 | 3300009870 | Activated Sludge | MRTMNNDLFLLESEYHYHQERTRHALKANRYRRWRRRVEWDGPKAATDAKNWIN* |
| Ga0126314_107893242 | 3300010042 | Serpentine Soil | MMNNMFLLEPEFQYHAKRTKAELRPVRYRKWRRRLKWDGPSAATDEKNWIN* |
| Ga0126310_100111772 | 3300010044 | Serpentine Soil | MIAMNNLFLLEPELQYRAERARAQLKPVRHHRKWRRRLKWDGPSAATDEKNWIN* |
| Ga0126370_119605432 | 3300010358 | Tropical Forest Soil | MNDLFLLEPEYQYRASRAHEELKPVRYRKWRRRLLWDGPDAATNEKNWIN* |
| Ga0134128_128645652 | 3300010373 | Terrestrial Soil | SARHRHEGITEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGATDEKNWIN* |
| Ga0102750_109063661 | 3300010870 | Soil | MNDLFLLEPELKYHTSRTRDELKPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0105246_112176071 | 3300011119 | Miscanthus Rhizosphere | PEGTRVMNDLYLLEPELKYHTARTRAELKPVRYRKWRRRLEWDGPQGATNEKNWIN* |
| Ga0120152_11211102 | 3300012011 | Permafrost | MNDLFMLEPEFHYRATRTRNQLRPVRYRRWRKRLEKGGPAAATNEKNWIN* |
| Ga0150984_1074901131 | 3300012469 | Avena Fatua Rhizosphere | MKGMRTMNDLFLLEPEYRYHADRARQELRPVRYRKWRRRLQGSGPSGATDEKNWIN* |
| Ga0164241_1000131810 | 3300012943 | Soil | MNDLFLLEPELQYHVKRTREELKPVRYRKWRRRLEWDGPDAATNEKNWIN* |
| Ga0164241_111574362 | 3300012943 | Soil | MNDWYLLVPEYDYHAKRARHELKPVRYRRWRRRLEGDGPRAATNEKNWIN* |
| Ga0164301_118900521 | 3300012960 | Soil | SELKYHTARTRAELKPARYRKWRRRLEWDGPQGATNEKNWIN* |
| Ga0126369_128416242 | 3300012971 | Tropical Forest Soil | MKVMNDLFLLEPEYQYHAKRARDELKPVRYRKWRRRLHGGGATDEKNWIN* |
| Ga0164308_107709721 | 3300012985 | Soil | PKGHIMNDLFSLEPEYRYHADRARLELKGSRYRRWRRRLEWDGPDAATDAKNWIN* |
| Ga0157369_111940142 | 3300013105 | Corn Rhizosphere | MNDLFLLEPEYHYHAERARQELKPVRYRRWRRRMQNGAAGATSEKNWIS* |
| Ga0157374_117638591 | 3300013296 | Miscanthus Rhizosphere | RVMNDLYLLEPELKYHTARTRAELKPVRYRKWRRRLEWDGPQGATNEKNWIN* |
| Ga0157378_111984771 | 3300013297 | Miscanthus Rhizosphere | TEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGATDEKNWIN* |
| Ga0163162_102770772 | 3300013306 | Switchgrass Rhizosphere | MRTMNDLFLLEPEFHYHAKRAREELKPVRYRKWRRRVEWDGPAGATNEKNWIN* |
| Ga0182008_103644102 | 3300014497 | Rhizosphere | MSNMYLLEPEYRYHAERAQAELKPVRYRRWRRRLEGHGPEAATSEKNWIN* |
| Ga0182008_104024771 | 3300014497 | Rhizosphere | MNDLFLLEPEYRYRANRTRNQLRPVRYRRWRKRLAAGGPGAATDEKNWIS* |
| Ga0157376_124610602 | 3300014969 | Miscanthus Rhizosphere | MNDLYLLESELKYHTARTRAELKPARYRKWRRRLEWDGPQGATNEKNWIN* |
| Ga0132258_116239282 | 3300015371 | Arabidopsis Rhizosphere | MRAMNDLFLLEPEYQYHAERARHELKPVRYRKWRRRLHGAATNEKNWIN* |
| Ga0132256_1018368682 | 3300015372 | Arabidopsis Rhizosphere | MNDLFLLEPEYQYHAERARHELKPVRYRKWRRRLHGAATNEKNWIN* |
| Ga0132257_1024728092 | 3300015373 | Arabidopsis Rhizosphere | MNDLFTLEPEYRYHAARARLELKTSRYRRWRRRLEWDGADAATDAKNWIN* |
| Ga0132257_1027311632 | 3300015373 | Arabidopsis Rhizosphere | MNDLFLLKPEYQYHAERARHELKPVRYRKWRRRLHGAATNEKNWIN* |
| Ga0132255_1015880622 | 3300015374 | Arabidopsis Rhizosphere | HVSQTRTEGMRAMNDLFLLKPEYQYHAERARHELKPVRYRKWRRRLHGAATNEKNWIN* |
| Ga0206356_117634612 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDLFILEPEFQYHAKRARAELKPVRYRKWRRRLEWDGPSAATNEKNWIN |
| Ga0206354_110390412 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDMFLLKPEFEYHAKRTRAALRPTRYRKWRRRLEWDGPDAATDEKNWIN |
| Ga0213876_105059812 | 3300021384 | Plant Roots | MNDLFLLEPEFQYRASRARSELKPVRYRKWRRRLEWDGPDAATNEKNWIN |
| Ga0182009_103252142 | 3300021445 | Soil | MNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGATDEKNWIN |
| Ga0207642_105237402 | 3300025899 | Miscanthus Rhizosphere | MNDLFLLEPEFQYHASRARAELRPVRYRKWRRRLEWDGPDAATNEKNWIN |
| Ga0207647_100500092 | 3300025904 | Corn Rhizosphere | MNDLSMLEPELQYRAARAHEELRPVRYRKWRRRLEHGGPRAATNEKNWIS |
| Ga0207647_103648212 | 3300025904 | Corn Rhizosphere | MNDLFLLEPEYHYHAERARQELKPVRYRRWRRRMQNGAAGATSEKNWIS |
| Ga0207643_102371582 | 3300025908 | Miscanthus Rhizosphere | MNDLYLLESELKYHTARTRAELKPVRYRKWRRRLEWDGPQGATNEKNWIN |
| Ga0207657_113862992 | 3300025919 | Corn Rhizosphere | EPEFQYHASRARAELRPVRYRKWRRRLEWDGPDAATNEKNWIN |
| Ga0207649_113507122 | 3300025920 | Corn Rhizosphere | NDLSMLEPELQYRAARAHEELRPVRYRKWRRRLEHGGPRAATNEKNWIS |
| Ga0207652_113820061 | 3300025921 | Corn Rhizosphere | MNDLFLLEPELQYHVKRTRDELKPVRYRKWRRRLEWDGPDAATNEKNWIN |
| Ga0207686_110465271 | 3300025934 | Miscanthus Rhizosphere | MNDLFLLEPEFQYHASRSRAELRPVRYRKWRRRLEWDGPDAA |
| Ga0207686_110966212 | 3300025934 | Miscanthus Rhizosphere | MNDLFLLEPEFHYHAKRAREELKPVRYRKWRRRVEWDGPAGATNEKNWIN |
| Ga0207691_106516532 | 3300025940 | Miscanthus Rhizosphere | RHRHEGITEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPQGATNEKNWIN |
| Ga0207711_117111381 | 3300025941 | Switchgrass Rhizosphere | TEMNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPDAATNEKNWIN |
| Ga0207661_101454812 | 3300025944 | Corn Rhizosphere | MSDMFLLKPEFEYHARRTRAALRPTRYRKWRRRLEWDGPDAATDEKNWIN |
| Ga0207661_102645942 | 3300025944 | Corn Rhizosphere | MNDLFTLEPEYRYHAARARLELKNSRYRRWRRRLEWDGPDAATDAKNWIN |
| Ga0207679_100642013 | 3300025945 | Corn Rhizosphere | MNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPDAATNEKNWIN |
| Ga0207651_105081682 | 3300025960 | Switchgrass Rhizosphere | MNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPQGATNEKNWIN |
| Ga0207658_110947941 | 3300025986 | Switchgrass Rhizosphere | MNDLFLLEPEFQYRSKRTRSELRPVRYRKWRRRLEWDGPEGA |
| Ga0207677_118910652 | 3300026023 | Miscanthus Rhizosphere | NRREEAMNDLFTLEPEYKYHAARARLELRTARYRRWRRRLEWDGPAASSDAKNWIN |
| Ga0207703_110048982 | 3300026035 | Switchgrass Rhizosphere | MNDLFLLEPEFQYHASRARAELKPVRYRKWRRRLEWDGPDAATNEKNWIN |
| Ga0268266_1000059619 | 3300028379 | Switchgrass Rhizosphere | MQDLFLLEPEFQYHAKRARAELKPVRYRKWRRRLEWDGPSAATNEKNWIN |
| Ga0268266_115272291 | 3300028379 | Switchgrass Rhizosphere | VSQTRHEGITVMNDLFLLEPEFQYHASRARAELKPVRYRKWRRRLEWDGPDAATNEKNWI |
| Ga0307280_101850232 | 3300028768 | Soil | MNDLYLLEPELKYHTARTRAELKPVRYRKWRRRLEWDGPQGATNEKNWIN |
| Ga0308175_1000841773 | 3300031938 | Soil | MYNDLFLLEPEFRYRADRTRGELRPVRYRKWRRRLEWDGPDAATDEKNWIN |
| Ga0308175_1000878051 | 3300031938 | Soil | MNDLFSLEPEYRYHAARTRLELRNARYRRWRRRLEWDGPDASDVKNWIN |
| Ga0308175_1001716612 | 3300031938 | Soil | MNDLFLLEPEFHYRANRTRNELRPVRYRRWRKRVADGGPGAATNEKNWIS |
| Ga0308175_1009354051 | 3300031938 | Soil | MNDLFLLEPELKYHTSRTRDELKPVRYRKWRRRLEWEGPDAATNEKNWIN |
| Ga0308175_1015266602 | 3300031938 | Soil | MNDLFLLESELKYRTSRTRDELRPARYRRWRRRLEWDGPDAATNEKNWIN |
| Ga0308174_102457642 | 3300031939 | Soil | MNDLFLLEPEFHYRANRTRNELRPVRYRRWRKRVAEGGPGAATNEKNWIS |
| Ga0308174_103255612 | 3300031939 | Soil | MNDLFSLEPEYRYHAARARLELRNARYRRWRRRLEWDGPDASDVKNWIN |
| Ga0308176_107555722 | 3300031996 | Soil | MNDLFLLEPEFHYRANRTRNVLRPVRYRRWRKRLAAGGPAAATDEKNWIN |
| Ga0308176_109641682 | 3300031996 | Soil | MNDLFLLEPELQYHVKRTRDELKPVRYRKWRRRLEWDGPSAATNEKNWIN |
| Ga0326721_103012882 | 3300032080 | Soil | MNDLYLLEPELKYHTARTRAELKPVRYRKWRRRLRGAATNEKNWIN |
| Ga0372943_0308927_366_518 | 3300034268 | Soil | MNDLFLLEPEYHYRATRTRNELRPVRYRRWRKRLAEGGPGAATDEKNWIS |
| Ga0372943_0910770_229_381 | 3300034268 | Soil | MNDLFMLEPEFHYRANRTRNELRPVRYRRWRKRVADGGPAAATNEKNWIS |
| ⦗Top⦘ |