NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082510

Metagenome / Metatranscriptome Family F082510

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082510
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 42 residues
Representative Sequence FLLQLGPFGGAYVHGWGIRVWAAGYLCVALALALLAFSRRDL
Number of Associated Samples 98
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.77 %
% of genes near scaffold ends (potentially truncated) 99.12 %
% of genes from short scaffolds (< 2000 bps) 93.81 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.796 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(9.735 % of family members)
Environment Ontology (ENVO) Unclassified
(24.779 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.708 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 30.00%    β-sheet: 0.00%    Coil/Unstructured: 70.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF04227Indigoidine_A 60.18
PF00583Acetyltransf_1 3.54
PF13302Acetyltransf_3 2.65
PF02604PhdYeFM_antitox 1.77
PF00294PfkB 1.77
PF13581HATPase_c_2 1.77
PF13742tRNA_anti_2 1.77
PF10604Polyketide_cyc2 1.77
PF05816TelA 1.77
PF07690MFS_1 0.88
PF00590TP_methylase 0.88
PF00694Aconitase_C 0.88
PF03704BTAD 0.88
PF00265TK 0.88
PF00248Aldo_ket_red 0.88
PF12679ABC2_membrane_2 0.88
PF01026TatD_DNase 0.88
PF03640Lipoprotein_15 0.88
PF13011LZ_Tnp_IS481 0.88
PF01674Lipase_2 0.88
PF00072Response_reg 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2313Pseudouridine-5'-phosphate glycosidase (pseudoU degradation)Nucleotide transport and metabolism [F] 60.18
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 1.77
COG3853Uncharacterized conserved protein YaaN involved in tellurite resistanceDefense mechanisms [V] 1.77
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 1.77
COG1435Thymidine kinaseNucleotide transport and metabolism [F] 0.88
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.88
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.88
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.80 %
UnclassifiedrootN/A29.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig126633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
2170459003|FZN2CUW02HTNOPNot Available502Open in IMG/M
2170459005|F1BAP7Q02INZKLAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300001535|A3PFW1_10875037Not Available945Open in IMG/M
3300001536|A1565W1_10459619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii1012Open in IMG/M
3300002568|C688J35102_118419494Not Available558Open in IMG/M
3300004479|Ga0062595_100131971All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300004479|Ga0062595_100687305All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300004479|Ga0062595_100805344All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300005174|Ga0066680_10848031All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005176|Ga0066679_10299226All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300005176|Ga0066679_11000035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales521Open in IMG/M
3300005184|Ga0066671_10183108All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300005327|Ga0070658_10005067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia10725Open in IMG/M
3300005329|Ga0070683_100958679All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300005339|Ga0070660_101517016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300005344|Ga0070661_100217019All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300005440|Ga0070705_100699111All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005445|Ga0070708_100977434All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300005445|Ga0070708_101746845All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005458|Ga0070681_11803350All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005518|Ga0070699_102115770All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005529|Ga0070741_10269940All Organisms → cellular organisms → Bacteria1611Open in IMG/M
3300005530|Ga0070679_100291380All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300005536|Ga0070697_101757089All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005537|Ga0070730_10516762All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005537|Ga0070730_10743594All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005539|Ga0068853_100777299All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300005556|Ga0066707_10743536Not Available611Open in IMG/M
3300005559|Ga0066700_10252622All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300005563|Ga0068855_101217619Not Available782Open in IMG/M
3300005575|Ga0066702_10299681All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300005614|Ga0068856_101453856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300005764|Ga0066903_100950566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1563Open in IMG/M
3300005764|Ga0066903_103447339All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300005764|Ga0066903_103990146Not Available791Open in IMG/M
3300005764|Ga0066903_106746859Not Available597Open in IMG/M
3300005892|Ga0075275_1096919All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005894|Ga0075270_1027039Not Available770Open in IMG/M
3300005903|Ga0075279_10084877All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300006032|Ga0066696_10950126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300006755|Ga0079222_10768126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300006806|Ga0079220_10270292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1030Open in IMG/M
3300006806|Ga0079220_10684647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300006914|Ga0075436_101433532All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300007788|Ga0099795_10491736Not Available571Open in IMG/M
3300009090|Ga0099827_11550419All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300009098|Ga0105245_10329683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1506Open in IMG/M
3300009519|Ga0116108_1072845All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300009548|Ga0116107_1213834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300009634|Ga0116124_1014693All Organisms → cellular organisms → Bacteria2705Open in IMG/M
3300010154|Ga0127503_10884601Not Available746Open in IMG/M
3300010323|Ga0134086_10432930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300010329|Ga0134111_10445665Not Available561Open in IMG/M
3300010373|Ga0134128_10734230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1096Open in IMG/M
3300010373|Ga0134128_11830099Not Available668Open in IMG/M
3300010373|Ga0134128_11853776All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300010376|Ga0126381_100728969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1419Open in IMG/M
3300010376|Ga0126381_101565296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia952Open in IMG/M
3300011271|Ga0137393_10639386Not Available912Open in IMG/M
3300012202|Ga0137363_11626765Not Available538Open in IMG/M
3300012209|Ga0137379_11105162All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012353|Ga0137367_10946042All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300012356|Ga0137371_10894779All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012944|Ga0137410_11837809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300012989|Ga0164305_11119497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300013105|Ga0157369_10939274Not Available886Open in IMG/M
3300013307|Ga0157372_12530447Not Available589Open in IMG/M
3300015245|Ga0137409_10243323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1601Open in IMG/M
3300015371|Ga0132258_13747071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1036Open in IMG/M
3300015372|Ga0132256_101747006All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300015372|Ga0132256_102876071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300016387|Ga0182040_10470393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia999Open in IMG/M
3300017936|Ga0187821_10263920All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300017937|Ga0187809_10187634Not Available729Open in IMG/M
3300017959|Ga0187779_11109394Not Available553Open in IMG/M
3300018432|Ga0190275_10908182Not Available949Open in IMG/M
3300018433|Ga0066667_11920388Not Available541Open in IMG/M
3300020081|Ga0206354_11480532Not Available664Open in IMG/M
3300020082|Ga0206353_10706646Not Available626Open in IMG/M
3300021377|Ga0213874_10264519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300025321|Ga0207656_10526290Not Available601Open in IMG/M
3300025459|Ga0208689_1009303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3348Open in IMG/M
3300025477|Ga0208192_1071158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300025929|Ga0207664_10581670Not Available1005Open in IMG/M
3300025929|Ga0207664_11285829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300025952|Ga0210077_1058817All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae796Open in IMG/M
3300026036|Ga0208650_1029667Not Available673Open in IMG/M
3300026318|Ga0209471_1217466Not Available708Open in IMG/M
3300026542|Ga0209805_1183129Not Available924Open in IMG/M
3300026552|Ga0209577_10408444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium973Open in IMG/M
3300027869|Ga0209579_10781768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300028577|Ga0265318_10342916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300028653|Ga0265323_10052368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300028666|Ga0265336_10198106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300028666|Ga0265336_10239744Not Available539Open in IMG/M
3300028802|Ga0307503_10024426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2039Open in IMG/M
3300028889|Ga0247827_11257032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium516Open in IMG/M
3300031239|Ga0265328_10172261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300031241|Ga0265325_10365363Not Available636Open in IMG/M
3300031249|Ga0265339_10577005Not Available516Open in IMG/M
3300031251|Ga0265327_10077223All Organisms → cellular organisms → Bacteria → Terrabacteria group1653Open in IMG/M
3300031712|Ga0265342_10699023Not Available507Open in IMG/M
3300031724|Ga0318500_10705126Not Available515Open in IMG/M
3300031778|Ga0318498_10388872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300031945|Ga0310913_11320049Not Available500Open in IMG/M
3300031954|Ga0306926_10500888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1493Open in IMG/M
3300032770|Ga0335085_10193047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2502Open in IMG/M
3300032783|Ga0335079_10470902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1344Open in IMG/M
3300032805|Ga0335078_11341629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300032892|Ga0335081_10036120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7889Open in IMG/M
3300032955|Ga0335076_10269828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1594Open in IMG/M
3300033475|Ga0310811_10009106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12803Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere7.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.54%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.54%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.54%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.77%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.77%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.77%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005892Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305EnvironmentalOpen in IMG/M
3300005894Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203EnvironmentalOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025952Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026036Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_021039902140918007SoilFLLQLGPFGGAYVHGWPIRLWAAVYLVAALAAAVALFARKDL
E4A_082650802170459003Grass SoilGPFGGAYVHGWGIRLWAVAYALVVGALALVSFARKDL
E41_048164502170459005Grass SoilFLLQLGPFGGAYVHGWGIRAWSVGYLCVALALAVFAFRRRDL
A3PFW1_1087503723300001535PermafrostMITERASGLTGFLLQLGPFGGAYVHGWPIRAWAAVYLVAVLAAAVGLFARKNL*
A1565W1_1045961933300001536PermafrostFLLQLGPFGGAYVHGWGIRVWSVGYLIVVGAIALYAFSRRNL*
C688J35102_11841949413300002568SoilASGLTGFLLQLGPFGGAYVHGWGIRLWAVAYLVLVLGVAVAAFSRRNL*
Ga0062595_10013197133300004479SoilSSNASGLTGFLLQLGPFGGAYVHGWGIRLWSVGYLCVALVVALLAFSRRDL*
Ga0062595_10068730513300004479SoilLQLGPFGGAYVHGWPIRVWAIVYLVGIGVLALALFARKDL*
Ga0062595_10080534413300004479SoilSGLTGFLLQLGPFGGAYVHGWGIRVWAAAYLCAALALAVLVFRRRDL*
Ga0066680_1084803113300005174SoilGLTGFLLQLGPFGGAYVHGWGIRVWAAAFLCLALALAVLAFQRRDL*
Ga0066679_1029922623300005176SoilQLGPFGGAYVHGWGIRVWAVGYLAAVLALAVLAFSRRNL*
Ga0066679_1100003523300005176SoilFTTFLLQLGPFGGSYNSGWGVRGWAAAYLVLVGAAALTAFARRDL*
Ga0066671_1018310833300005184SoilTGFLLQLGPFGGAYVHGWGIRLWSAGYLCVALILGLLAFSRRDL*
Ga0070658_1000506713300005327Corn RhizosphereFLLQLGPFGGAYIHGWPIRLWAVAYLVLVLVAAVAAFSRRNL*
Ga0070683_10095867913300005329Corn RhizosphereLLQLGPFGGAYVHGWGVRVWAVGYLFAALALALVLFRRRDL*
Ga0070660_10151701623300005339Corn RhizosphereLQLGPFGGAYVHGWGIRVWAAFYLVAVLVLAVLAFGRRNL*
Ga0070661_10021701913300005344Corn RhizosphereFLLQLGPFGGAYVHGWGIRVWSAGYLVVVLAVAAAIFNRKSL*
Ga0070705_10069911113300005440Corn, Switchgrass And Miscanthus RhizosphereASGLTGFLLQLGPFGGAYVHGWGIRVWAAGYLVAVLGIAVAAFQRRNL*
Ga0070708_10097743423300005445Corn, Switchgrass And Miscanthus RhizosphereFLLQLGPFGGAYVHGWGIRLWSVGYLLAALALAVFAFQRRDL*
Ga0070708_10174684523300005445Corn, Switchgrass And Miscanthus RhizosphereALRLISRDASGLTGFLLQLGPFGGAYVHGWGIRVWSAGYLCVALLLAVLAFSRRDL*
Ga0070681_1180335013300005458Corn RhizosphereLQLGPFGGAYVHGWPIRVWAAVYLLFVLAAAIAAFRRKNL*
Ga0070699_10211577023300005518Corn, Switchgrass And Miscanthus RhizosphereQLGPFGGAYVHGWGIRLWAVAYLAIVGALALVSFSRRNL*
Ga0070741_1026994013300005529Surface SoilLQLGPFGGGYVHGWTIRVWSVAYLVLVCAAALGAFARRNL*
Ga0070679_10029138013300005530Corn RhizosphereLLQLGPFGGAYIHGWGIRIWSVGYLFVVLTLAVFAFSRRNL*
Ga0070697_10175708923300005536Corn, Switchgrass And Miscanthus RhizosphereTGFLLQLGPFGGAYVHGWGIRLWAVAYLVIVGAVALVSFSRRNL*
Ga0070730_1051676213300005537Surface SoilLQLGPFGGAYVHGWGIRLWAVAYTLIVGAVALVSFARKNL*
Ga0070730_1074359423300005537Surface SoilLLQLGPFGGAFVHGWGVRVWAAGYLCVALALAVFLFQRRDL*
Ga0068853_10077729913300005539Corn RhizosphereLTGFLLQLGPFGGAYIHGWPIRVWAVAYLVLVLAAAIAAFSRRNL*
Ga0066707_1074353613300005556SoilQLGPFGGAYIHGWGIRLWAAAYLALVAFGAALVFARRDL*
Ga0066700_1025262213300005559SoilGGAYVHGWGIRVWSAGYLCVALALAVLAFSRRDL*
Ga0068855_10121761913300005563Corn RhizosphereFGGAYIHGWGIRIWSVGYLFVVLALAVFAFSRRNL*
Ga0066702_1029968123300005575SoilFLLQLGPFGGAYVHGWGIRVWSVAYVLIVGALALVSFARKNL*
Ga0068856_10145385623300005614Corn RhizosphereLGPFGGAYVHGWPIRVWAAGYLVVALALAVLAFSRRDL*
Ga0066903_10095056633300005764Tropical Forest SoilLQLGPFGGAYVHGWPIRVWAVVYLVAVGAAALSLFARKDL*
Ga0066903_10344733923300005764Tropical Forest SoilLQLGPFGGAYVHGWGIRIWAVVYLAGILALGLWAFSRRNL*
Ga0066903_10399014623300005764Tropical Forest SoilFGGGYVHGWGIRVWSLGYLVVALAVAVLAFSRKDL*
Ga0066903_10674685923300005764Tropical Forest SoilPFGGAYVHGWGIRVWSVGYLIVALALAVFAFQHRDL*
Ga0075275_109691923300005892Rice Paddy SoilFLLQLGPFGGAYVHGWGIRVWAAGYLCVALALALLAFSRRDL*
Ga0075270_102703913300005894Rice Paddy SoilGGAYVHGWGIRVWAAGYLLVALALALFAFRQRDL*
Ga0075279_1008487723300005903Rice Paddy SoilFLLQLGPFGGAYVHGWGIRVWAAAYLGIALALALTVFARRDL*
Ga0066696_1095012613300006032SoilFLLQLGPFGGAYVHGWPIRIWAAGYLVAILAIAVAAFSRRNL*
Ga0079222_1076812613300006755Agricultural SoilILQLGPFGGGYVHGWTIRTWSIGYLVLALAAAVAAFSRRNL*
Ga0079220_1027029213300006806Agricultural SoilTENASGLTGFLLQLGPFGGAYVHGWPIRFWAAGYLVLVLGAGLLAFSRRNL*
Ga0079220_1068464713300006806Agricultural SoilTGFLLQLGPFGGAYVHGWGIRVWSVGYLCVALGLALLAFSRRDL*
Ga0075436_10143353213300006914Populus RhizospherePFGGAYVHGWGIRVWSVGYLCVALVLAVLAFSRRDL*
Ga0099795_1049173623300007788Vadose Zone SoilFFLQLGPFGGAYVHGWGIRLWAVGFLCIALALAVFLFQRRDL*
Ga0099827_1155041913300009090Vadose Zone SoilLLQLGPFGGAYVHGWGIRVWSLGYLLVIDAVALYAFSRRNL*
Ga0105245_1032968313300009098Miscanthus RhizosphereGATSFLLQLGPFGGGYVHGWEIRLWSVAYLVLIGAAALAAFARRDL*
Ga0116108_107284513300009519PeatlandSFLLQLGPFGGAYVHGWTIRVGAVGFLVAVGAVALAAFSRKNL*
Ga0116107_121383423300009548PeatlandGGAYVHGWTIRVWAVGYLVAVGAVALAAFSRKNL*
Ga0116124_101469313300009634PeatlandLTSFLLQLGPFGGAYVHGWTIRVWAVGYLVAVGAVALAAFSRKNL*
Ga0127503_1088460113300010154SoilFGGAYVHGWGIRLWSVGYLCVALALAVFAFSRRDL*
Ga0134086_1043293013300010323Grasslands SoilLGPFGGAYVHGWGIRVWAAGYLVALLGIALAAFQRRNL*
Ga0134111_1044566513300010329Grasslands SoilLTGFLLQLGPFGGAYVHGWGIRLWAAAYLCVVLALAVAAFARRNL*
Ga0134128_1073423013300010373Terrestrial SoilMITENASGLTGFLLQLGPFGGAYVHGWGICAWAVVYLAAVLALGAAVFN
Ga0134128_1183009913300010373Terrestrial SoilTGFLLQLGPFGGAYVHVWGIRVWSAGYLCVALVLGLLAFSRRDL*
Ga0134128_1185377633300010373Terrestrial SoilASGLTGFLLQLGPFGGAYVHGWGIRVWSAGYLCVALALAVLAFQRRDL*
Ga0126381_10072896913300010376Tropical Forest SoilLLQLGPFGGGYVHGWGIRLWSVGYLCLALVLAVLAFSRKDL*
Ga0126381_10156529633300010376Tropical Forest SoilGFLLQLGPFGGAYVHGWPIRVWAVVYLLAIGVAAIALFARKDL*
Ga0137393_1063938623300011271Vadose Zone SoilRMITEKVSVLTGFLLQPGPFGGEYVHGWPIRIWAAFYLVAVLAAAIALFSRRNL*
Ga0137363_1162676523300012202Vadose Zone SoilLLQLGPFGGAYVHGWPIRIWAVAYLVAALAAAVALFLRKDL*
Ga0137379_1110516213300012209Vadose Zone SoilSGLTGFLLQLGPFGGAYVHGWGIRVWSVGYLVAVGAFALWAFSRRNL*
Ga0137367_1094604223300012353Vadose Zone SoilGGGYVHGWSIRLWAAAYLVVFGMVALALFARRDL*
Ga0137371_1089477923300012356Vadose Zone SoilGFLLQLGPFGGAYVHGWGIRVWSAAYLVAVLAVALYGFSRRNL*
Ga0137410_1183780923300012944Vadose Zone SoilQLGPFGGAYVHGWPIRIWAGVYLVLALAAAVALFSRKDL*
Ga0164305_1111949723300012989SoilLGPFGGAYVHGWGIRVWAVFYLVAVLAVAVAAFGRRNL*
Ga0157369_1093927423300013105Corn RhizosphereLQLGPFGGAYVHGWGIRVWSAGYLVVVLAVAAAIFNRKSL*
Ga0157372_1253044723300013307Corn RhizosphereQLGPFGGAYIHGWPIRIWAVCYLLLVLAAAVAAFSRRNL*
Ga0137409_1024332333300015245Vadose Zone SoilPFGGAYVHGWPIRVWAVVYLGAALAAAVALFQRKDL*
Ga0132258_1374707123300015371Arabidopsis RhizosphereEALYQDGLRMITENTSGLTGFLLQLGPFRGAYVHGWGIRVWALVYTLLVGAVALAAFARKDL*
Ga0132256_10174700613300015372Arabidopsis RhizosphereTGFLLQLGPFGGAYVHGWPIRVWAIVYLVGIGVLALALFARKDL*
Ga0132256_10287607113300015372Arabidopsis RhizosphereLLQLGPFGGGYVHGWSIRLWAVAYLAVIGAAALAAFTRRNL*
Ga0182040_1047039333300016387SoilLQLGPFGGAYVHGWPIRVWAVAYLVASGAGALALFARKDL
Ga0187821_1026392013300017936Freshwater SedimentGPFGGAYVHGWPIRVWAVAYTLGVGVLALAAFARKNL
Ga0187809_1018763423300017937Freshwater SedimentFGGAYVHGWGIRAWAVVYVLLIGAVALFSFSRKNL
Ga0187779_1110939423300017959Tropical PeatlandTEHQTGLNAFLLQLGPFGGAYVHGWSIRIWAIVYLVLVGATALALFARKDL
Ga0190275_1090818223300018432SoilGPFGGADPAGPGLVLFAAAYTGVVIALAVAAFARRDL
Ga0066667_1192038813300018433Grasslands SoilLTGFLLQLGPFGGAYVHGWGIRVWAVAYVLIVGAVALVSFTRKNL
Ga0206354_1148053213300020081Corn, Switchgrass And Miscanthus RhizosphereFGGAYVHGWGIRVWAVAYLALVLALGAVVFNRKNL
Ga0206353_1070664623300020082Corn, Switchgrass And Miscanthus RhizosphereFLLQLGPFGGAYIHGWPIRIWAAAYLLLVLVAAVAAFSRRNL
Ga0213874_1026451923300021377Plant RootsVQLGPFGGGYVHGWPIRIWAVLYLLAVLAAAVAAFNRRNL
Ga0207656_1052629013300025321Corn RhizosphereGLTGAALKLGPFGGSFVYGWDVRVWAVGYLGAALALAVFLFKRRDL
Ga0208689_100930353300025459PeatlandENTSGLTSFLLQLGPFGGAYVHGWTIRVWAVGYLVAVGAVALAAFSRKNL
Ga0208192_107115823300025477PeatlandLTSFLLQLGPFGGAYVHGWTIRVWAVGYLVAVGAVALAAFSRKNL
Ga0207664_1058167013300025929Agricultural SoilTGFLLQLGPFGGAYVHGWGIRVWAVAYVLIVGALALVSFARKNL
Ga0207664_1128582913300025929Agricultural SoilQLGPFGGAYVHGWGIRVWSLGYLLVVGAVALYAFSRRNL
Ga0210077_105881723300025952Natural And Restored WetlandsLQLGPFGGAYVHGWGIRVWAACYLVAALVLALLAFSRRDL
Ga0208650_102966713300026036Rice Paddy SoilITGFLLQLGPFGGAYVHGWGIRVWAAAYLGIALALALTVFARRDL
Ga0209471_121746623300026318SoilGFLLQLGPFGGAYVHGWGIRVWAVGYLAAVLALAVLAFSRRNL
Ga0209805_118312913300026542SoilGPFGGAYVHGWPIRLWSVAYALLVGGLALVSFARKDL
Ga0209577_1040844433300026552SoilLLQLGPFGGSYNSGWGVRGWAAAYLVLVGAAALTAFSRRDL
Ga0209579_1078176823300027869Surface SoilTSFLLQLGPFGGAYVHGWPIRIWSLAYLVLIGAAAIFAFSRRDL
Ga0265318_1034291613300028577RhizosphereGPFGGAYVHGWTIRIWALGYLVAVGAIAVWAFARRNL
Ga0265323_1005236813300028653RhizospherePFGGAYVHGWTIRIWALAYLVAVGAVALFAFRRKNL
Ga0265336_1019810623300028666RhizospherePFGGAYVHGWTIRIWALGYLVAVGAVALFAFRRKNL
Ga0265336_1023974423300028666RhizosphereSGLTGFLLQLGPFGGAYVHGWPIRVWAAFYLVAALAAAVALFARKDL
Ga0307503_1002442613300028802SoilTENTFGLTGFLLQLGPFGGAYVHGWPIRIWAAVYLVLALAAAVALFLRKDL
Ga0247827_1125703213300028889SoilATSFLLQLGPFGGGYVHGWTIRVWALAYLALVVAAALAAFARRNL
Ga0265328_1017226123300031239RhizosphereFGGAYVHGWPIRVWAAFYLVAALAAAVALFARKDL
Ga0265325_1036536323300031241RhizosphereSNASGLTGFLLQLGPFGGAYVHGWPIRIWAAAYLVMVGGAALAAFSRRNL
Ga0265339_1057700523300031249RhizosphereSGLTGFLLQLGPFGGAYVHGWPIRIWAAAYLVMVGGAALAAFSRRNL
Ga0265327_1007722313300031251RhizosphereLGPFGGAYVHGWGIRVWAVGYVVAVGAVALAAFARKNL
Ga0265342_1069902323300031712RhizosphereGLTGFLLQLGPFGGAYVHGWPIRIWAAAYLAFVGGAALAAFSRRNL
Ga0318500_1070512613300031724SoilIISSNASGVTGFLLQLGPFGGAFVHGWGVRIWSLGYLCAALALAVFLFKRRDL
Ga0318498_1038887213300031778SoilLQLGPFGGAYVHGWPIRLWSIVYLAAIGAAALALFARKDL
Ga0310913_1132004913300031945SoilLQLGPFGGAYVHGWSIRIWAVVYLLLVGAAALALFARKDL
Ga0306926_1050088813300031954SoilGVTGFLLQLGPFGGAFVHGWGVRIWSLGYLCAALALAVFLFKRRDL
Ga0335085_1019304753300032770SoilFGGAYVHGWGIRVWAAAYLALALGLGLVGFSRRDL
Ga0335079_1047090213300032783SoilTGFLLQLGPFGGAYVHGWEIRVWSAAYLVAIGALALWAFSRRNL
Ga0335078_1134162913300032805SoilGLTGFLLQLGPFGGAYVHGWEIRVWSAAYLVAIGALALWAFSRRNL
Ga0335081_10036120123300032892SoilQLGPFGGAYIHGWQIRVWAAAYLAIALAVALLAFRRRDL
Ga0335076_1026982833300032955SoilTGFLLQLGPFGGAYVHGWEIRVWSVAYLVAIGALALWAFSRRNL
Ga0310811_1000910613300033475SoilLQLGPFGGAYVHGWGIRVWAAFYLVAVLVLAVLAFGRRNL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.