| Basic Information | |
|---|---|
| Family ID | F082509 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 45 residues |
| Representative Sequence | YHPWADVVTIIGFLDDLRDDWGSERLLVEDMLARAVAELGGTSR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.77 % |
| % of genes near scaffold ends (potentially truncated) | 85.84 % |
| % of genes from short scaffolds (< 2000 bps) | 94.69 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.407 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.664 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.858 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.938 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.17% β-sheet: 0.00% Coil/Unstructured: 45.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 18.58 |
| PF01740 | STAS | 16.81 |
| PF06689 | zf-C4_ClpX | 9.73 |
| PF13561 | adh_short_C2 | 7.08 |
| PF13411 | MerR_1 | 7.08 |
| PF02861 | Clp_N | 6.19 |
| PF03243 | MerB | 5.31 |
| PF01636 | APH | 1.77 |
| PF00690 | Cation_ATPase_N | 1.77 |
| PF00710 | Asparaginase | 0.88 |
| PF00089 | Trypsin | 0.88 |
| PF01513 | NAD_kinase | 0.88 |
| PF00376 | MerR | 0.88 |
| PF08044 | DUF1707 | 0.88 |
| PF00667 | FAD_binding_1 | 0.88 |
| PF13384 | HTH_23 | 0.88 |
| PF13692 | Glyco_trans_1_4 | 0.88 |
| PF00005 | ABC_tran | 0.88 |
| PF13565 | HTH_32 | 0.88 |
| PF00293 | NUDIX | 0.88 |
| PF00072 | Response_reg | 0.88 |
| PF04149 | DUF397 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 6.19 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.77 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.77 |
| COG0369 | Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductases | Nucleotide transport and metabolism [F] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.41 % |
| Unclassified | root | N/A | 41.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig27033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albicerus | 569 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10204072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 802 | Open in IMG/M |
| 3300004643|Ga0062591_101678229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella qitaiheensis | 643 | Open in IMG/M |
| 3300005336|Ga0070680_100466007 | Not Available | 1080 | Open in IMG/M |
| 3300005364|Ga0070673_100547723 | Not Available | 1051 | Open in IMG/M |
| 3300005435|Ga0070714_100301950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1493 | Open in IMG/M |
| 3300005467|Ga0070706_101229939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300005467|Ga0070706_101810440 | Not Available | 555 | Open in IMG/M |
| 3300005545|Ga0070695_100714252 | Not Available | 797 | Open in IMG/M |
| 3300005578|Ga0068854_100560354 | Not Available | 970 | Open in IMG/M |
| 3300005598|Ga0066706_11477736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella qitaiheensis | 512 | Open in IMG/M |
| 3300005614|Ga0068856_100597171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1125 | Open in IMG/M |
| 3300005713|Ga0066905_101658545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300005898|Ga0075276_10161416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300006755|Ga0079222_10776065 | Not Available | 777 | Open in IMG/M |
| 3300006804|Ga0079221_10512316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300006804|Ga0079221_11623803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella qitaiheensis | 524 | Open in IMG/M |
| 3300006904|Ga0075424_102320808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300006914|Ga0075436_100542869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 853 | Open in IMG/M |
| 3300009089|Ga0099828_10861391 | Not Available | 810 | Open in IMG/M |
| 3300009090|Ga0099827_11382812 | Not Available | 613 | Open in IMG/M |
| 3300009137|Ga0066709_100748290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1411 | Open in IMG/M |
| 3300009156|Ga0111538_13947149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albicerus | 513 | Open in IMG/M |
| 3300009545|Ga0105237_10921853 | Not Available | 881 | Open in IMG/M |
| 3300009792|Ga0126374_11005209 | Not Available | 654 | Open in IMG/M |
| 3300010337|Ga0134062_10782008 | Not Available | 509 | Open in IMG/M |
| 3300010360|Ga0126372_10222865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 1592 | Open in IMG/M |
| 3300010397|Ga0134124_12353074 | Not Available | 574 | Open in IMG/M |
| 3300010876|Ga0126361_11052459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2251 | Open in IMG/M |
| 3300011269|Ga0137392_10603670 | Not Available | 911 | Open in IMG/M |
| 3300011269|Ga0137392_10880904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 738 | Open in IMG/M |
| 3300011271|Ga0137393_10358658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1246 | Open in IMG/M |
| 3300012189|Ga0137388_11810800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 542 | Open in IMG/M |
| 3300012198|Ga0137364_11103831 | Not Available | 597 | Open in IMG/M |
| 3300012200|Ga0137382_10952440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albicerus | 617 | Open in IMG/M |
| 3300012285|Ga0137370_10769138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella qitaiheensis | 598 | Open in IMG/M |
| 3300012350|Ga0137372_10635148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300012351|Ga0137386_10123606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1842 | Open in IMG/M |
| 3300012351|Ga0137386_10858547 | Not Available | 652 | Open in IMG/M |
| 3300012351|Ga0137386_11245157 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012356|Ga0137371_10040697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3588 | Open in IMG/M |
| 3300012356|Ga0137371_10114703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2103 | Open in IMG/M |
| 3300012357|Ga0137384_10755756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 788 | Open in IMG/M |
| 3300012515|Ga0157338_1035845 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012683|Ga0137398_10645698 | Not Available | 734 | Open in IMG/M |
| 3300012683|Ga0137398_10768419 | Not Available | 672 | Open in IMG/M |
| 3300012929|Ga0137404_11327113 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300016371|Ga0182034_11856467 | Not Available | 531 | Open in IMG/M |
| 3300016387|Ga0182040_11051629 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300016404|Ga0182037_10529839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 991 | Open in IMG/M |
| 3300016404|Ga0182037_11685683 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300016404|Ga0182037_12029684 | Not Available | 516 | Open in IMG/M |
| 3300017932|Ga0187814_10037703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 1790 | Open in IMG/M |
| 3300017993|Ga0187823_10346968 | Not Available | 528 | Open in IMG/M |
| 3300019887|Ga0193729_1178727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300019887|Ga0193729_1190244 | Not Available | 709 | Open in IMG/M |
| 3300020002|Ga0193730_1041241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1337 | Open in IMG/M |
| 3300020004|Ga0193755_1141106 | Not Available | 738 | Open in IMG/M |
| 3300020199|Ga0179592_10185204 | Not Available | 947 | Open in IMG/M |
| 3300021363|Ga0193699_10118792 | Not Available | 1077 | Open in IMG/M |
| 3300021420|Ga0210394_11381641 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300021474|Ga0210390_10948306 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300021479|Ga0210410_10103570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2514 | Open in IMG/M |
| 3300021559|Ga0210409_10440961 | Not Available | 1162 | Open in IMG/M |
| 3300022467|Ga0224712_10069117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1429 | Open in IMG/M |
| 3300022467|Ga0224712_10589063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella qitaiheensis | 542 | Open in IMG/M |
| 3300024181|Ga0247693_1055223 | Not Available | 579 | Open in IMG/M |
| 3300024187|Ga0247672_1069788 | Not Available | 597 | Open in IMG/M |
| 3300025320|Ga0209171_10154789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1337 | Open in IMG/M |
| 3300025903|Ga0207680_10231840 | Not Available | 1269 | Open in IMG/M |
| 3300025910|Ga0207684_10273917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1456 | Open in IMG/M |
| 3300025910|Ga0207684_10839653 | Not Available | 775 | Open in IMG/M |
| 3300025910|Ga0207684_11111635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300025914|Ga0207671_10473985 | Not Available | 998 | Open in IMG/M |
| 3300025915|Ga0207693_10690267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
| 3300025916|Ga0207663_10605440 | Not Available | 861 | Open in IMG/M |
| 3300025929|Ga0207664_11629909 | Not Available | 567 | Open in IMG/M |
| 3300026374|Ga0257146_1032846 | Not Available | 842 | Open in IMG/M |
| 3300026498|Ga0257156_1063027 | Not Available | 767 | Open in IMG/M |
| 3300027787|Ga0209074_10194275 | Not Available | 758 | Open in IMG/M |
| 3300027903|Ga0209488_10859117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300027915|Ga0209069_10788163 | Not Available | 566 | Open in IMG/M |
| 3300028755|Ga0307316_10199255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
| 3300028875|Ga0307289_10433668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albicerus | 540 | Open in IMG/M |
| 3300028885|Ga0307304_10138016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1007 | Open in IMG/M |
| 3300031543|Ga0318516_10398535 | Not Available | 793 | Open in IMG/M |
| 3300031544|Ga0318534_10807731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300031670|Ga0307374_10029665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6409 | Open in IMG/M |
| 3300031718|Ga0307474_11574064 | Not Available | 516 | Open in IMG/M |
| 3300031724|Ga0318500_10674663 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031744|Ga0306918_11321280 | Not Available | 554 | Open in IMG/M |
| 3300031747|Ga0318502_10271006 | Not Available | 994 | Open in IMG/M |
| 3300031779|Ga0318566_10596399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
| 3300031781|Ga0318547_10377788 | Not Available | 868 | Open in IMG/M |
| 3300031782|Ga0318552_10118572 | Not Available | 1317 | Open in IMG/M |
| 3300031793|Ga0318548_10333208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300031819|Ga0318568_10734627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 613 | Open in IMG/M |
| 3300031831|Ga0318564_10266538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300031835|Ga0318517_10464459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300031846|Ga0318512_10727026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300031859|Ga0318527_10239597 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031896|Ga0318551_10037407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2389 | Open in IMG/M |
| 3300031912|Ga0306921_10449709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ncost-T10-10d | 1501 | Open in IMG/M |
| 3300031947|Ga0310909_10951606 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031981|Ga0318531_10302318 | Not Available | 723 | Open in IMG/M |
| 3300032008|Ga0318562_10648605 | Not Available | 609 | Open in IMG/M |
| 3300032009|Ga0318563_10551534 | Not Available | 622 | Open in IMG/M |
| 3300032052|Ga0318506_10519039 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032065|Ga0318513_10529774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300032091|Ga0318577_10504319 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300032160|Ga0311301_10785458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1313 | Open in IMG/M |
| 3300032898|Ga0335072_10812149 | Not Available | 892 | Open in IMG/M |
| 3300033475|Ga0310811_10287939 | Not Available | 1905 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00121260 | 2166559006 | Grass Soil | ERFTVSWERVAGTAYHPWGDVVTVVGFLDDLHDDWGPERLLVEDMLARAMAELGG |
| JGIcombinedJ51221_102040722 | 3300003505 | Forest Soil | VVTIIGSLDDLRDDWGSERHLVEDMLARAVAELGGMQHVPG* |
| Ga0062591_1016782291 | 3300004643 | Soil | ERVAGTTYHPWGDVVTVVGFLDDLHDDWGSERFAVEDMLARAVAELAG* |
| Ga0070680_1004660071 | 3300005336 | Corn Rhizosphere | TYHPWGDVVTVVGFLDDLHGDWGSERFGVEDMLARAVAELAR* |
| Ga0070673_1005477231 | 3300005364 | Switchgrass Rhizosphere | ERVAGTTYHPWGDVVTVVGFLDDLHGDWGSERFGVEDMLARAVAELAR* |
| Ga0070714_1003019503 | 3300005435 | Agricultural Soil | AGAAYHPWADVVTIIGFLDDLRDDWGPEEVLVEDMLARAVAELGATSR* |
| Ga0070706_1012299392 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RFTVRWEQAAGTTYHPWGDVVTVVGFLDDLHDDWGSERLLVEDMLARAIAELAG* |
| Ga0070706_1018104401 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGAAYHPRADVVTITGFLDHLRDDWGSERLPVEDMLARAVAELGGDSR* |
| Ga0070695_1007142521 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | HPWGDVVTVVGFLDDLHGDWGSERFGVEDMLARAVAELAR* |
| Ga0068854_1005603541 | 3300005578 | Corn Rhizosphere | WEQIAGTTYHPWGDVVTIVGFLDDLHDDWGSERFGVEDMLARAIAELAG* |
| Ga0066706_114777362 | 3300005598 | Soil | VTVVGFLDDLHDDWGSERLLVEDMLARAIAELAG* |
| Ga0068856_1005971712 | 3300005614 | Corn Rhizosphere | VVTIIGFLDDLRDDWGPERLVVEDMLARAVTELDS* |
| Ga0066905_1016585451 | 3300005713 | Tropical Forest Soil | AEHNPCGDVVTIVGFLDDLRDDWGWERLRVQDMLARATAELGR* |
| Ga0075276_101614162 | 3300005898 | Rice Paddy Soil | HPWADVVTIIGFLDDLRDDWGSERLLIEDMLARAVAELSGTAR* |
| Ga0079222_107760651 | 3300006755 | Agricultural Soil | VERFTACWERTAGTAYHPWGDVVTVVGFLDDLHDGWGSERLLVEDVLARAVAELGG* |
| Ga0079221_105123162 | 3300006804 | Agricultural Soil | TAYHPWADVVTIIGFLDDLRDGWGSERLLVEDMLARAVAELGGQAA* |
| Ga0079221_116238032 | 3300006804 | Agricultural Soil | YHPWGDVVTIVGFLDDLRGDWGPERLLVEDMLARAVAELGGG* |
| Ga0075424_1023208081 | 3300006904 | Populus Rhizosphere | VASRFTVRWERVAGTTYHPWGDVVTVVGFLDDLHDDWGSERFAVEDMLARAVAELAG* |
| Ga0075436_1005428692 | 3300006914 | Populus Rhizosphere | TIIGFLDDLRADWGSERLLVEEMLARAVAELGGTSR* |
| Ga0099828_108613912 | 3300009089 | Vadose Zone Soil | FTALWQHAAGDTYHPWADVLTIIGFLDDLRDDWGSERLLIEDMLARAVADLGANSR* |
| Ga0099827_113828122 | 3300009090 | Vadose Zone Soil | EVVSRFTAGWEREASAVYHPWGDVVTVVGFLDDLHDGWGSERLLVEDMLTRAVAELGG* |
| Ga0066709_1007482902 | 3300009137 | Grasslands Soil | MVTIIGFLDDLRDDWGSERLLVEDMLARAVADLGGTSR* |
| Ga0111538_139471492 | 3300009156 | Populus Rhizosphere | TYHPWGDVVTVVGFLDDLHDDWGSERFAVEDMLARAVAELAG* |
| Ga0105237_109218532 | 3300009545 | Corn Rhizosphere | TTYHPWGDVVTVVGFLDDLHDGWGSERLLVEDMLARAVAELGG* |
| Ga0126374_110052091 | 3300009792 | Tropical Forest Soil | PWGDVVTIVGFLDDLHDDWGSERLLVEDMLARAVAELATY* |
| Ga0134062_107820082 | 3300010337 | Grasslands Soil | SRFTAGWEREASAVYHPWGDVVTVVGFLDDLHDDWGSERLLVEDMLARAVAELGG* |
| Ga0126372_102228651 | 3300010360 | Tropical Forest Soil | HPWGDLVTIVGFLDDLRDDWGAERLLVEDMLARAVAALDG* |
| Ga0134124_123530741 | 3300010397 | Terrestrial Soil | TYHPWGDVVTVVGFLDALHDDWGSERFGVEDMLARAVAELAG* |
| Ga0126361_110524591 | 3300010876 | Boreal Forest Soil | RFTAVWQQAADAAYHPWGDIVTIIGFLDDLREDWGPERDLVEDMLARAVAELGRSR* |
| Ga0137392_106036701 | 3300011269 | Vadose Zone Soil | DVVTIIGFLDDLRDDWGSERLRVEDMLARAVAELGGTSR* |
| Ga0137392_108809041 | 3300011269 | Vadose Zone Soil | YHPWADVVTIIGFLDDLRDDWGSERLLVEDMLARAVAELGGTSR* |
| Ga0137393_103586583 | 3300011271 | Vadose Zone Soil | YHPWADVVTIIGFLDDLRDESEWLLIEDTLARAVAELGGNSR* |
| Ga0137388_118108001 | 3300012189 | Vadose Zone Soil | PWADVVTIIGFLDDLRDDWGSERLRVEDMLARAVAELGGTSR* |
| Ga0137364_111038312 | 3300012198 | Vadose Zone Soil | EANAVYHPWGDVVTVVGFLDDLHDGWGSERLLVEDMLARAVAELGG* |
| Ga0137382_109524402 | 3300012200 | Vadose Zone Soil | ERAAGAAYHPWGDVVTVVGFLDDLHDDWGSERFGVEDMLARAVAELAG* |
| Ga0137370_107691381 | 3300012285 | Vadose Zone Soil | WEQLAGTTYHPWGDVVTVVGFLDDLHDDWGSERLLVEDMLARAIAELAG* |
| Ga0137372_106351481 | 3300012350 | Vadose Zone Soil | QAASVTYHPWADVITIIGFLDDLRDDWGSERLLVEDMLARAVAELGGNTR* |
| Ga0137386_101236063 | 3300012351 | Vadose Zone Soil | WQQAAGAAYHPWADVITIIGFLDDLCEDWGSERLLVEDMLARAVAELGGDSR* |
| Ga0137386_108585471 | 3300012351 | Vadose Zone Soil | VVERFTVSWERTAGTAYHPWGDVVTVVGFLDDLHDDWGSERLLVEDMLARAVAELGG* |
| Ga0137386_112451571 | 3300012351 | Vadose Zone Soil | VVTIIGFLDDLRGDWGPEGVLVEDMLARAVAELGGTSR* |
| Ga0137371_100406971 | 3300012356 | Vadose Zone Soil | PWADVVTIIGFLDDLREDWGSERLLVEDMLARAVAELGGNSR* |
| Ga0137371_101147031 | 3300012356 | Vadose Zone Soil | PWADVVTIIGFLDDLREDWGSERLLVEDMLARAVAELGGTSR* |
| Ga0137384_107557562 | 3300012357 | Vadose Zone Soil | AAYHPWADVVTIIGFLDDLRDDWGPERLLVEDMLAQAVAGLGGVSR* |
| Ga0157338_10358452 | 3300012515 | Arabidopsis Rhizosphere | ERVAGTAYHPWGDVVTIVGFLDDLHDDWGSERFGVEDVLARAVAELAR* |
| Ga0137398_106456982 | 3300012683 | Vadose Zone Soil | CWEREASAVYHPWGDVVTIVGFLDDLHDGWGSERLLVEDVLAQAVAELGG* |
| Ga0137398_107684191 | 3300012683 | Vadose Zone Soil | AYHPWADVVTIIGFLDDLRDDWGSEQFLVEDMLARAVAELGGTSR* |
| Ga0137404_113271132 | 3300012929 | Vadose Zone Soil | DATYHPWADVVTIIGFLDDLRGDWGSERLLVEDRLARAIAELGGTSL* |
| Ga0182034_118564672 | 3300016371 | Soil | AIIGFLDDLRDGWGSERHLVEDMLARAVAELGRNSR |
| Ga0182040_110516293 | 3300016387 | Soil | FHPWADVVTIVGFLDDLCSGWGSDRYLLEDLLADAVAELDARS |
| Ga0182037_105298391 | 3300016404 | Soil | IIGFLDDLRGDGGSVRLLVEDMLARAVAELGVNNR |
| Ga0182037_116856832 | 3300016404 | Soil | VTGATFHPWADLVTIVGFLDDLRSGWGSDRYVVEDVLADAVAELDARS |
| Ga0182037_120296842 | 3300016404 | Soil | WGDVVTVVGFLDDLRDDWGSERLLVEDMLARAVADLGG |
| Ga0187814_100377034 | 3300017932 | Freshwater Sediment | AAYHPWADVVTIIGFLDDLRDDWGSERVLVEDMLTRAVAELGANSQVRNRRGR |
| Ga0187823_103469682 | 3300017993 | Freshwater Sediment | VVTIVGFLDDLRDGWGSERLLVEDVLARAVAELGG |
| Ga0193729_11787271 | 3300019887 | Soil | AAYHPWADVVTIIGFLDDLRDDWGSEQLLVEDMLARAVAELGTNGR |
| Ga0193729_11902442 | 3300019887 | Soil | VVIVVGFLDDLHDDWGSERLLVEDMLARAVAELGG |
| Ga0193730_10412411 | 3300020002 | Soil | VVTITGFLDDLREDWGSERLLVEGMLARAVAELGGSSR |
| Ga0193755_11411061 | 3300020004 | Soil | WEQVAGATYHPWGDVVTVVGFLDDLHDDWGSERLLVEDMLARAIAELAR |
| Ga0179592_101852042 | 3300020199 | Vadose Zone Soil | AYHPWADVVTILGFLDDLRGDWGSERLLVEDMLARAVAELGGTSR |
| Ga0193699_101187923 | 3300021363 | Soil | VVTVVGFLDDLHDDWGSERLLVEDMLARAVAELGG |
| Ga0210394_113816412 | 3300021420 | Soil | VVTIVGFLDDLRGDWGPERLLVEDMLARAVAELGG |
| Ga0210390_109483062 | 3300021474 | Soil | FTVSWERAAGAAYHPWGDVVTVVGFLDDLHDDWGSERLLVEDMLARAMAELAG |
| Ga0210410_101035701 | 3300021479 | Soil | AGTVYHPWGDVVTIVGFLDDLRGDWGRERLLVEDMLARAVAELGGNSR |
| Ga0210409_104409613 | 3300021559 | Soil | VVTIVGFLDDLRGDWGPERLLVEDMLARAVAELGGG |
| Ga0224712_100691171 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTIIGFLDDLRDDWGPERLVVEDMLARAVTELDS |
| Ga0224712_105890631 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | DVVTVVGFLDDLHGDWGSERFGVEDMLARAVAELAR |
| Ga0247693_10552232 | 3300024181 | Soil | GDVVTVVGFLDDLHDDWGSERFGVEDMLARAVAELAR |
| Ga0247672_10697882 | 3300024187 | Soil | AGTTYHPWGDVVTVVGFLDDLHDDWGSERFGVEDMLARAVAELAR |
| Ga0209171_101547894 | 3300025320 | Iron-Sulfur Acid Spring | RAAGATYHPWADVVTIIGFLDDLRDGWGSERLRAEDMLARAVAELGGTSR |
| Ga0207680_102318401 | 3300025903 | Switchgrass Rhizosphere | TVRWERVAGTTYHPWGDVVTVVGFLDDLHDDWGSERFGVEDMLARAVAELAR |
| Ga0207684_102739173 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | WQQAAGAAYHPWADVVTIIGFLDDLREDWGSERLLVEDMLARAVAELGENSR |
| Ga0207684_108396532 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EVASRFTVRWEQAAGTTYHPWGDVVTVVGFLDDLHDDWGSERLLVEDMLARAIAELAG |
| Ga0207684_111116352 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TIIGFLDHLRDDWGSERLPVEDMLARAVAELGGDSR |
| Ga0207671_104739851 | 3300025914 | Corn Rhizosphere | ERVAGTTYHPWGDVVTVVGFLDDLHGDWGSERFGVEDMLARAVAELAR |
| Ga0207693_106902671 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TIIGFLDDLREDWGSERLLVEDMLGRAVAELGGNSR |
| Ga0207663_106054402 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RWEQVADTTYHPWGDVVTVVGFLDDLHDDWGSERFAVEDMLARAVAELAG |
| Ga0207664_116299092 | 3300025929 | Agricultural Soil | PWGDVVTIVGFLDDLRGDWGRERLLVEDMLARAVAGC |
| Ga0257146_10328461 | 3300026374 | Soil | RFTRMWERVAGAEYHPWGDVVTIVGFLDDLRDDWGSERLLVEDMLTRAVTDLAG |
| Ga0257156_10630272 | 3300026498 | Soil | MWEQVAGAEYHPWGDVVTIVGFLDDLRDDWGSERLLVEDMLTRAVTDLAG |
| Ga0209074_101942752 | 3300027787 | Agricultural Soil | RTAGTAYHPWGDVVTVVGFLDDLHDGWGSERLLVEDVLVRAVAELGG |
| Ga0209488_108591172 | 3300027903 | Vadose Zone Soil | VGHRVFLDDLCEDWGSERLLVEDMLARAVAELGGDSR |
| Ga0209069_107881631 | 3300027915 | Watersheds | CWEREANALYHPWGDVVTVIGFLDDLHDGLGSERLLVEDVLARAVAELGG |
| Ga0307316_101992551 | 3300028755 | Soil | VVTITGFLDDLREDWGSERLLVEGMLARAVAELGESSR |
| Ga0307289_104336682 | 3300028875 | Soil | RFTVRWEQVAGATYHPWGDVVTVVGFLDDLHDDWGSERLLVEDMLARAIAELAR |
| Ga0307304_101380162 | 3300028885 | Soil | VVTITGFLDDLREDWGSERLLVEGILARAVAELGGSSR |
| Ga0318516_103985351 | 3300031543 | Soil | SWERVAGTAYHPWGDVVTIVGFLDDLRDDWGSERLLVEDMLARAVTELRG |
| Ga0318534_108077312 | 3300031544 | Soil | TYHPWADVVAIIGFLDDLRDGWGSERHLVEDMLARAVAELGRNSR |
| Ga0307374_100296652 | 3300031670 | Soil | VVTVIGFLDDLREEQGSDHDLVEDLLAQAVAELRRGP |
| Ga0307474_115740641 | 3300031718 | Hardwood Forest Soil | FTACWEREACAVYHPWGDVVTIVGFLDDLHDDWGPERLLVEDVLARAVAELGG |
| Ga0318500_106746631 | 3300031724 | Soil | PWADVVTIVGFLDDLRSGWGSDRYLLEDLLADAVAELDARS |
| Ga0306918_113212801 | 3300031744 | Soil | TERFTGSWERAAGAEYHPWGDVVTIVGFLDDLRDDWGSEQFLVEDMLARAVTELTR |
| Ga0318502_102710062 | 3300031747 | Soil | VVTVVGFLDDLHEDWGPERLLVEDMLARAVAGLGGG |
| Ga0318566_105963991 | 3300031779 | Soil | YHPWADVVTITGFLDDLRDDQGSERDLVEDMLALAVAEIGGSSQ |
| Ga0318547_103777882 | 3300031781 | Soil | AYHPWGDVVTIVGFLDDLRDDWGSERLLVEDMLARAVTELRG |
| Ga0318552_101185722 | 3300031782 | Soil | VAERFTVSWELVAGAAYHPWGDVVTIVGFLDDLRDDWGSERLLVEDMLARAVTELRG |
| Ga0318548_103332081 | 3300031793 | Soil | TYHPWADVVTIIGFLDDLRGDQGSERHLVEDMLARAVAEIGGSSQ |
| Ga0318568_107346271 | 3300031819 | Soil | VVTIIGFLDDLRDGWGSERLLVEDMLARAVAELVGNNR |
| Ga0318564_102665382 | 3300031831 | Soil | VVTIIGFLDDLRDGWGPERNLVEDLLARAIAELGGNSR |
| Ga0318517_104644591 | 3300031835 | Soil | ADVVTIIGFLDDLRGDQGSERHLVEDMLARAVAEIGGSSQ |
| Ga0318512_107270261 | 3300031846 | Soil | FTAFRQQAAGAAYHPWGDVVTIIGFLDDLRDGWGSERHLVEDMLARAVAELGGNSR |
| Ga0318527_102395971 | 3300031859 | Soil | GDSFHPWADVVTIVGFLDDLRSGWGSDRYLLEDLLADAVAELDARS |
| Ga0318551_100374071 | 3300031896 | Soil | VVTVVGFLDDLHADWGPERLLVEDMLARAVADLGGG |
| Ga0306921_104497092 | 3300031912 | Soil | LWEEVTGATFHPWADLVTIVGFLDDLRSGWGSDRYLVEDVLADAVAELDARS |
| Ga0310909_109516061 | 3300031947 | Soil | VTIVGFFDDLRSGWGSERYLVEDLLVDAVAELDARP |
| Ga0318531_103023181 | 3300031981 | Soil | VLWQRTAGATYHPWADVVTIIGFLDDLRDDQGSERHLVEDMLARAVAEIGGSSQ |
| Ga0318562_106486051 | 3300032008 | Soil | WADVVTIIGFLDDLRDDQGSERHLVEDMLARAVAEIGGSSQ |
| Ga0318563_105515342 | 3300032009 | Soil | VSWERVAGIAYHPWGDVVTVVGFLDDLRDDWGSERLLVEDMLARAVADLGG |
| Ga0318506_105190392 | 3300032052 | Soil | HPWADVVTIVGFLDDLRSGWGSDRYLLEDLLADAVAELDARS |
| Ga0318513_105297741 | 3300032065 | Soil | YHPWGDVVTVVGFLDDLRGDWGRERHLVEDLLARAVAELGG |
| Ga0318577_105043192 | 3300032091 | Soil | WADVVTIVGFLDDLRSGWGSDRYLLEDLLADAVAELDARS |
| Ga0311301_107854582 | 3300032160 | Peatlands Soil | ALWQRAAGDTYHPWADVVTIIGFLDDLRDDPGSGPDPVEDMFARAVAELGGTRR |
| Ga0335072_108121491 | 3300032898 | Soil | PWGDVVTVVGFLDDLHDDWGSERFAVEDMLARAVAELAG |
| Ga0310811_102879391 | 3300033475 | Soil | VASRFTVHWERVAGTTYHPWGDVVTVVGFLDDLHDDWGSERFAVEDMLARAVAELAG |
| ⦗Top⦘ |