| Basic Information | |
|---|---|
| Family ID | F082506 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GVLILLGRAFAATVRESGHPRMIVGGLVALLGVIVLLTYLGVELPRE |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.55 % |
| % of genes near scaffold ends (potentially truncated) | 92.04 % |
| % of genes from short scaffolds (< 2000 bps) | 91.15 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.611 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (7.965 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.858 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.018 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.00% β-sheet: 0.00% Coil/Unstructured: 52.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03734 | YkuD | 60.18 |
| PF12229 | PG_binding_4 | 16.81 |
| PF01368 | DHH | 4.42 |
| PF02272 | DHHA1 | 2.65 |
| PF08241 | Methyltransf_11 | 0.88 |
| PF05425 | CopD | 0.88 |
| PF04392 | ABC_sub_bind | 0.88 |
| PF01145 | Band_7 | 0.88 |
| PF13328 | HD_4 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 60.18 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 60.18 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 0.88 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.61 % |
| Unclassified | root | N/A | 12.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105677846 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300000956|JGI10216J12902_103096115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 824 | Open in IMG/M |
| 3300000956|JGI10216J12902_110582325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1299 | Open in IMG/M |
| 3300000956|JGI10216J12902_113851222 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300002568|C688J35102_117984788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300002568|C688J35102_120303103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 978 | Open in IMG/M |
| 3300003990|Ga0055455_10022026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1573 | Open in IMG/M |
| 3300004081|Ga0063454_100757886 | Not Available | 742 | Open in IMG/M |
| 3300004081|Ga0063454_101993940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300004081|Ga0063454_102047464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300004156|Ga0062589_100363574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1155 | Open in IMG/M |
| 3300005171|Ga0066677_10849338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300005179|Ga0066684_10687412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300005337|Ga0070682_101669506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300005338|Ga0068868_101311873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300005445|Ga0070708_100035205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4361 | Open in IMG/M |
| 3300005458|Ga0070681_10651950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300005533|Ga0070734_10656843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300005539|Ga0068853_100134541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2215 | Open in IMG/M |
| 3300005560|Ga0066670_10995616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300005563|Ga0068855_100112068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3131 | Open in IMG/M |
| 3300005564|Ga0070664_100734720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300005564|Ga0070664_101300538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300005764|Ga0066903_101055677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1492 | Open in IMG/M |
| 3300005764|Ga0066903_101454720 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300005764|Ga0066903_102710384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
| 3300005764|Ga0066903_105626471 | Not Available | 659 | Open in IMG/M |
| 3300005834|Ga0068851_10407344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300006028|Ga0070717_11047728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300006034|Ga0066656_11076109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300006046|Ga0066652_100203193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1706 | Open in IMG/M |
| 3300006058|Ga0075432_10321137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300006755|Ga0079222_11452431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300006804|Ga0079221_11311280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300006806|Ga0079220_11541983 | Not Available | 572 | Open in IMG/M |
| 3300006904|Ga0075424_101250900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300009148|Ga0105243_11054439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300009162|Ga0075423_13011621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300009551|Ga0105238_12762292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300010037|Ga0126304_11109960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300010039|Ga0126309_10569762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300010044|Ga0126310_11504209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300010048|Ga0126373_12060817 | Not Available | 633 | Open in IMG/M |
| 3300010320|Ga0134109_10115671 | Not Available | 944 | Open in IMG/M |
| 3300010371|Ga0134125_12044694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300010375|Ga0105239_11241806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300010398|Ga0126383_11538800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300010398|Ga0126383_12558867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300010401|Ga0134121_10456742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1167 | Open in IMG/M |
| 3300010401|Ga0134121_12840338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300012003|Ga0120163_1035424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
| 3300012011|Ga0120152_1041119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1552 | Open in IMG/M |
| 3300012360|Ga0137375_10118707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2647 | Open in IMG/M |
| 3300012362|Ga0137361_11829823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300012511|Ga0157332_1035773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300012923|Ga0137359_11203345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300012958|Ga0164299_10578362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300012977|Ga0134087_10296969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
| 3300012986|Ga0164304_10960385 | Not Available | 673 | Open in IMG/M |
| 3300012987|Ga0164307_10559101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 875 | Open in IMG/M |
| 3300013100|Ga0157373_10867696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300013104|Ga0157370_11130811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300013308|Ga0157375_10347110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1650 | Open in IMG/M |
| 3300013772|Ga0120158_10388166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
| 3300015373|Ga0132257_101804770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300017947|Ga0187785_10626998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300017974|Ga0187777_10564347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300018029|Ga0187787_10121649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300018064|Ga0187773_11013233 | Not Available | 545 | Open in IMG/M |
| 3300020078|Ga0206352_10527555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300021344|Ga0193719_10022859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2673 | Open in IMG/M |
| 3300021363|Ga0193699_10119777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
| 3300021377|Ga0213874_10438118 | Not Available | 514 | Open in IMG/M |
| 3300021415|Ga0193694_1042094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300022467|Ga0224712_10121763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
| 3300024245|Ga0247677_1038308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
| 3300024279|Ga0247692_1052556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300025906|Ga0207699_11277142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300025909|Ga0207705_10581890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300025912|Ga0207707_10015712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6597 | Open in IMG/M |
| 3300025915|Ga0207693_10900826 | All Organisms → cellular organisms → Bacteria → PVC group | 679 | Open in IMG/M |
| 3300025917|Ga0207660_10771337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300025924|Ga0207694_11679912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300025929|Ga0207664_10288949 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300025929|Ga0207664_10995342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300025935|Ga0207709_11511854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300026067|Ga0207678_11461495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300026121|Ga0207683_10077343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2947 | Open in IMG/M |
| 3300026326|Ga0209801_1065065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1627 | Open in IMG/M |
| 3300028590|Ga0247823_11342665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300028710|Ga0307322_10189226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300028800|Ga0265338_10447173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300028800|Ga0265338_10762291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300031250|Ga0265331_10510126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300031344|Ga0265316_10939586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300031548|Ga0307408_102031276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
| 3300031561|Ga0318528_10373629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300031681|Ga0318572_10440781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300031716|Ga0310813_11683854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300031720|Ga0307469_12231944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300031731|Ga0307405_10723565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 826 | Open in IMG/M |
| 3300031782|Ga0318552_10726046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300031859|Ga0318527_10424918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300031996|Ga0308176_11289010 | Not Available | 776 | Open in IMG/M |
| 3300031996|Ga0308176_11587725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300031996|Ga0308176_12975435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300032009|Ga0318563_10271769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
| 3300032770|Ga0335085_10673027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1155 | Open in IMG/M |
| 3300032805|Ga0335078_12266251 | Not Available | 570 | Open in IMG/M |
| 3300032954|Ga0335083_10827140 | Not Available | 741 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1056778462 | 3300000955 | Soil | GRAFAATVRESGHPRLILGGLAALVGVIVLLTYLGVELPRE* |
| JGI10216J12902_1030961152 | 3300000956 | Soil | MAPLIVIAVGVVGAVFILLARGFVETVRESGHPRLIVGGLAALVGLIVLLTYLGVELPREGG* |
| JGI10216J12902_1105823252 | 3300000956 | Soil | MAPLIVVAVGVVAAVFILLGRGLVETVRESGHPRLIVGGLAALVGLIVLLTYLGVELPREGG* |
| JGI10216J12902_1138512222 | 3300000956 | Soil | MAPLIVFAVGIAAGVFILLGRGFAQTVRESGHPRLIVGGLVALVGAIVLLTYLGVELPREGG* |
| C688J35102_1179847881 | 3300002568 | Soil | VLILLGRAFAVTVRESGHPRLIVAGLVGLGCAIAVLTYLGVELPRE* |
| C688J35102_1203031033 | 3300002568 | Soil | LIVIAVGVTAAIFILLGRGLAQSIRESPHPRLIVGSLVALAGLIVVLTYLGVELPREGG* |
| Ga0055455_100220263 | 3300003990 | Natural And Restored Wetlands | AGVLILLGRAFAATVRESGHPRWILGGLLAVVGAVVVLTWLGVQLPRE* |
| Ga0063454_1007578861 | 3300004081 | Soil | GLVGAVVILLGRAFAATVREAGHPKWIYGGLAALVAAVFVLTWLGVELPRE* |
| Ga0063454_1019939402 | 3300004081 | Soil | IAVGVTAAIFILLGRGLAQSIRESPHPRLIVGSLVALAGLIVVLTYLGVELPREGG* |
| Ga0063454_1020474642 | 3300004081 | Soil | LILLGRAFAVTVRESGHPRWILAGLAALFGAVVVLTYLGVELPRE* |
| Ga0062589_1003635742 | 3300004156 | Soil | GRAFATNVRESGHKRAIVAGLVALAGAVVVLTYLGVELPRE* |
| Ga0066677_108493381 | 3300005171 | Soil | AQNVRESGHRRLIYAGFVALLGIVALLTYLGVQLPREGG* |
| Ga0066684_106874121 | 3300005179 | Soil | VLGVLILLGRAFVNSVRESGHKRAIVAGLVVLAGAVVVLTYLGVQLPRE* |
| Ga0070682_1016695061 | 3300005337 | Corn Rhizosphere | ALVVGAGLVAGVLILLGRAFVVTVRESGHPRLIYAGLVGLAAVIVLLTYLGIELPREG* |
| Ga0068868_1013118732 | 3300005338 | Miscanthus Rhizosphere | GLIAAVFILLGRALAVTIRESGHPRWILGGLVALAGAIVLLTYLGVELPRE* |
| Ga0070708_1000352055 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGRAFAETVRDARHPRWIVGGLLALAGAIVLLTYLGVQLPRE* |
| Ga0070681_106519502 | 3300005458 | Corn Rhizosphere | GLVAGVLILLGRAFVVTVRESGHPRLIYLGLAGLAVAIVVLTYLGVELPREG* |
| Ga0070739_100204411 | 3300005532 | Surface Soil | GVLILLGRAFAESVRSWGHPRLLAAGLVALLGVVVLLTWLGISLPRE* |
| Ga0070734_106568432 | 3300005533 | Surface Soil | VLGTGLVLGVMILLGRAFAATVREAQHPRVIMGGLVLVVGAVVLMTWLGVTLPRE* |
| Ga0068853_1001345411 | 3300005539 | Corn Rhizosphere | FADSVRQSGHPRLIVGGLVALAGLIVLLTYLGVSLPKEG* |
| Ga0066670_109956161 | 3300005560 | Soil | VVGAGLVGGVLILLGRAFAVTVRESGHPRLIYLGLLGLAAAIVVLTYLGVELPREG* |
| Ga0068855_1001120684 | 3300005563 | Corn Rhizosphere | LLGRAFVVTVRESGHPRLIYAGLVGLAAVIVLLTYLGIELPREG* |
| Ga0070664_1007347202 | 3300005564 | Corn Rhizosphere | ALVVGAGLVGGVLILLGRAFAVTVRESGHPRLIYLGLLGLAAAIVVLTYLGVELPREG* |
| Ga0070664_1013005381 | 3300005564 | Corn Rhizosphere | LLGRGFVVTVRESGHPRLIYIGLIAMAGAIVVLTYLGVELPRE* |
| Ga0066903_1010556773 | 3300005764 | Tropical Forest Soil | LLGRAFMATVRESGHPRWIWGGVAVVVALVCLLTWLGVQLPRE* |
| Ga0066903_1014547203 | 3300005764 | Tropical Forest Soil | VLLPALVLGIGLILGVLILLGRAFADTVRESAHPRWIVAGLVALAGAVILLT |
| Ga0066903_1027103842 | 3300005764 | Tropical Forest Soil | AIVGAGLVAGIFILLGRAFMETVRESGHPRWILGGLVALLGAIVLLTYLGVELPRE* |
| Ga0066903_1056264712 | 3300005764 | Tropical Forest Soil | VGLVAGVAILLGRAFMATVRESGHPRWVWGGVAVVVVLVCVLTWLGVDLPKE* |
| Ga0068851_104073441 | 3300005834 | Corn Rhizosphere | IVGAGLVGAVFILLGRAFADSVRQSGHPRLIVGGLVALAGLIVLLTYLGVSLPKEG* |
| Ga0070717_110477282 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRAFAETVRESSHPRLILGGLVALVGVIVLLTYLGVSLPRE* |
| Ga0066656_110761091 | 3300006034 | Soil | SVRESGHKRAIVAGLVVLAGAVVVLTYLGVQLPRE* |
| Ga0066652_1002031931 | 3300006046 | Soil | LARGLVETIRESGHPRWIVAALVAVVGLVVLLTYLGVELPREGG* |
| Ga0075432_103211371 | 3300006058 | Populus Rhizosphere | LGRAFVYSARESGHKRLIYAGLAALAVLIVFMTYLGVELPREGG* |
| Ga0079222_114524312 | 3300006755 | Agricultural Soil | VRESGHKRVIVAGLAALAAAVVVLTYLGVQLPRE* |
| Ga0079221_113112801 | 3300006804 | Agricultural Soil | AGVLIVLGRAFASSVRDSGHKRLIVAGLVALAGAVVLLTYLGVQLPRE* |
| Ga0079220_115419831 | 3300006806 | Agricultural Soil | TVRESGHPRLVYLGLLGLAGAIVLLTYLGVELPRE* |
| Ga0075424_1012509001 | 3300006904 | Populus Rhizosphere | FVHSVRESGHKRAIIAGLFVLAGAVVVLTYLGVELPRE* |
| Ga0105243_110544392 | 3300009148 | Miscanthus Rhizosphere | VLGVLILLGRAFADSVRSAEHPRWIVGGLVALAGAIVLLTYLGVELPRE* |
| Ga0075423_130116211 | 3300009162 | Populus Rhizosphere | VFILLGRAFAQSVRESGHKRAILAGLALVVAAVVVLTYLGVELPKE* |
| Ga0105238_127622922 | 3300009551 | Corn Rhizosphere | AFAVTVRESGHPRLIYLGLAGLAVAIVVLTYLGVELPREG* |
| Ga0126304_111099603 | 3300010037 | Serpentine Soil | IFILLGRGLVQSIRESPHPRLIVGSLVALAGLIVVLTYLGVELPREGG* |
| Ga0126309_105697621 | 3300010039 | Serpentine Soil | TIRESPHPRLIVGSLVALAGLIVVLTYLGVELPREGG* |
| Ga0126310_115042091 | 3300010044 | Serpentine Soil | LVQSIRESPHPRLIVGSLVALAGLIVVLTYLGVELPREGG* |
| Ga0126373_120608171 | 3300010048 | Tropical Forest Soil | GVAILLGRAFMATVRESGHPRWVWGGVAVVVVLVCVLTWLGVDLPRE* |
| Ga0134109_101156713 | 3300010320 | Grasslands Soil | VLGVLILLGRAFAHSVRESGHKRAIIAGLVAVVAAVVVLTYLG |
| Ga0134125_120446941 | 3300010371 | Terrestrial Soil | AGLVAGVLILLGRAFVVTVRESGHPRLIYLGLVGLAAAIVILTYLGVELPREG* |
| Ga0105239_112418062 | 3300010375 | Corn Rhizosphere | GAGLVGAVFILLGRAFADSVRQSGHPRLIVGGLVALAGLIVLLTYLGVSLPKEG* |
| Ga0126383_115388002 | 3300010398 | Tropical Forest Soil | VVGAGLVAGVAILLGRAFMATVRESGHPRWIWGGVAVVVALVCLLTWLGVELPRE* |
| Ga0126383_125588672 | 3300010398 | Tropical Forest Soil | GGGLILGVLILLGRAFASNVRESGHKRVIVAGLVVLAGAVVVLTYLGVELPRE* |
| Ga0134121_104567422 | 3300010401 | Terrestrial Soil | VGGGLVLGVLILLGRAFADSVRSAEHPRWIVGGLVALAGAIVLLTYLGVELPRE* |
| Ga0134121_128403382 | 3300010401 | Terrestrial Soil | GVLILLGRAFAATVRESGHPRMIVGGLVALLGVIVLLTYLGVELPRE* |
| Ga0120163_10354243 | 3300012003 | Permafrost | AGLVGAVFILLGRAFAASVRESGHPRLIIGGLVALCGLIVLLTYLGVSLPKEG* |
| Ga0120152_10411191 | 3300012011 | Permafrost | IGAGLVFGVLILLGRAFAVTVRESGHPRLIVAGLLGLAGVIVLLTYLGVQLPRE* |
| Ga0137375_101187075 | 3300012360 | Vadose Zone Soil | VIAVGVTAAIFILLGRGLVQSVRESGHPRIIVGALVALAGVIVLLTYLGVELPREGG* |
| Ga0137361_118298231 | 3300012362 | Vadose Zone Soil | VVVLLGRAFADSVRESGHPRLIVGGLVALAGVIVLLTYLGVSLPKEG* |
| Ga0157332_10357731 | 3300012511 | Soil | IVFAVGIAIGVFILLGRGFVQTVRESGHPRLIVGGLVALAGVIVLLTYLGVELPREGG* |
| Ga0137359_112033452 | 3300012923 | Vadose Zone Soil | AVFILLGCAFAASVRESGHPRLIVGGLVALAGLIVLLTFLGVTLPKEG* |
| Ga0164299_105783623 | 3300012958 | Soil | FATLIVLGRALAHSVRESGHRRVIYVGFVALAGVVALLTYLGVELPRE* |
| Ga0134087_102969692 | 3300012977 | Grasslands Soil | GRAFVNSVRESGHKRAIVAGLVVLAGAVVVLTYLGVQLPRE* |
| Ga0164304_109603852 | 3300012986 | Soil | FASTVRESGHPRWVWGGVAVLVGLVVLLTWLGVQLPRE* |
| Ga0164307_105591013 | 3300012987 | Soil | VLGVMILLGRAFAATVRESGHPRLILGGLVAVFGAVVLLTWLGIELPRE* |
| Ga0157373_108676961 | 3300013100 | Corn Rhizosphere | GTGLVAGVLILLGRAFAVTVRESGHPRLIYIGLLGLAAAIVILTYLGIELPREG* |
| Ga0157370_111308111 | 3300013104 | Corn Rhizosphere | LILLGRAFADTVRESGHPRWIVGAMAALVGAILVLTWLGVSLPRE* |
| Ga0157375_103471101 | 3300013308 | Miscanthus Rhizosphere | AGLIGAVLILLGRALAVTIRESGHPRWILGGLVALAGAIVLLTYLGVELPRE* |
| Ga0120158_103881661 | 3300013772 | Permafrost | FILLGRAFATSVRESGHPRLVIGGLVALGVVIGILTWLGVTLPREG* |
| Ga0134078_102765552 | 3300014157 | Grasslands Soil | ATVRESNHPRLILGAVAAVFGAVLLLTWLGIELPRE* |
| Ga0132257_1018047701 | 3300015373 | Arabidopsis Rhizosphere | VLILLGRAFVESVRESGHQRLIYAGLAVLAVFIGVLTYLGVELPREGG* |
| Ga0187785_106269982 | 3300017947 | Tropical Peatland | VLGAGLVLGVLILLWRAFLVTVRESGHPRLIWGGVAVVVGLVVLLTWLGVDLPRE |
| Ga0187777_105643472 | 3300017974 | Tropical Peatland | FMATVRESTHPRWILGAVAALAGVIALLTWLGVQLPRE |
| Ga0187787_101216491 | 3300018029 | Tropical Peatland | IGGGIALGILILLGRAFADNVRESGHKRVVIAALVGLVAAVVVLTYLGVQLPKE |
| Ga0187773_110132332 | 3300018064 | Tropical Peatland | AAVLILLGRALAQSVRESGHPRVIFAGFVALAGAVALLTYLGVELPRE |
| Ga0206352_105275552 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | LVVGVGLVGGVLILLGRAFADTVRESGHPRWIVGAMAALVGAILVLTWLGVSLPRE |
| Ga0193719_100228593 | 3300021344 | Soil | LGRAFAHSLRESGHKRLILASLGVLVGAVVVLTYLGVELPKE |
| Ga0193699_101197771 | 3300021363 | Soil | VRESGHPRLIVGGLIALAGVIVLLTFLGVTLPKEG |
| Ga0213874_104381181 | 3300021377 | Plant Roots | VAGVLILLGRGFVYSIRESGHPRWIYVGLVGLAAAIGFLTYLGVSLPRE |
| Ga0193694_10420941 | 3300021415 | Soil | GAVLILLGRALGVTIRESGHPRWIVGGLIALAGAIVVLTYLGVELPRE |
| Ga0224712_101217632 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGLVAGVLIILGRAFANSVRESGHKRLIVAGLVVLAGAVVVLTYLGVQLPRE |
| Ga0247677_10383082 | 3300024245 | Soil | AVLILLGRAFADSVRESGHPRLIAGGAVALVGVVVLLTWLGVQLPRE |
| Ga0247692_10525561 | 3300024279 | Soil | GRAFAASVRESGHPRVIIGGLVALAALIVLLTYLGVSLPKEG |
| Ga0207699_112771422 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | NSVRESGHKRLIVAGLVVLAGAIVVLTYLGVQLPRE |
| Ga0207705_105818902 | 3300025909 | Corn Rhizosphere | QTVRESGHPRWILAGLAAMVGAIVVLTYLGVELPRE |
| Ga0207707_100157125 | 3300025912 | Corn Rhizosphere | VRESGHPRLIYAGLVGLAAVIVLLTYLGIELPREG |
| Ga0207693_109008261 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGRAFAATVRESGHPRLILGGLVAVFGAVVLLTWLGIELPRE |
| Ga0207660_107713371 | 3300025917 | Corn Rhizosphere | VLILLGRAFAVTVRESGHPRLIVAAVVGLAGAIVLLTFLGVELPRE |
| Ga0207694_116799122 | 3300025924 | Corn Rhizosphere | AFAVTVRESGHPRLIYLGLAGLAVAIVVLTYLGVELPREG |
| Ga0207664_102889493 | 3300025929 | Agricultural Soil | VLILLGRAFAATVRESGHPRLILGGVVAVLGAVVLLTWLGINLPRE |
| Ga0207664_109953422 | 3300025929 | Agricultural Soil | ILLGRAFAVTVRESGHPRLIYLGLLGLVGAIALLTYLGVELPRE |
| Ga0207709_115118542 | 3300025935 | Miscanthus Rhizosphere | GIGVIAAVLILLGRAFVESVRESGHQRLIYAGLAVLAVFIGVLTYLGVELPREGG |
| Ga0207678_114614951 | 3300026067 | Corn Rhizosphere | LILLGRAFAVTVRESGHPRLIYVGLLGLAAAIVILTYLGIELPREG |
| Ga0207683_100773431 | 3300026121 | Miscanthus Rhizosphere | VVGIGLVGGVLILLGRALAVTIRESGHPRWIVSGLVALAGAIVLLTYLGVELPRE |
| Ga0209801_10650651 | 3300026326 | Soil | GLGLVGGMLILLGRAFVETMREARHPRWIVGGLIALAGAIVLLTYLGVELPRE |
| Ga0247823_113426652 | 3300028590 | Soil | IGLIAAVLILLGRAFVESVRESGHQRLIYAGLAVVAVFIAVLTYLGVELPREGG |
| Ga0307322_101892262 | 3300028710 | Soil | LAVTIRESGHPRWILGGLVALAGAIVLLTYLGVELPRE |
| Ga0265338_104471732 | 3300028800 | Rhizosphere | FVVGGGLVLAVLILLGRAFADSIRGLKHKRLWLLGSVALLGVIVLLTYLGVSLPKEE |
| Ga0265338_107622912 | 3300028800 | Rhizosphere | SAFAASVRESGHPRWVWAGLAGLVGAVIVLTYLGVSLPRE |
| Ga0265331_105101261 | 3300031250 | Rhizosphere | VLAVLILLGRAFADSIRGLKHKRLWLLGSVALLGVIVLLTYLGVSLPKEE |
| Ga0265316_109395862 | 3300031344 | Rhizosphere | GLILGVLILLGRAFAESVRESGHKRLLMAGLVALTGVVVILTYLGVSLPRE |
| Ga0307408_1020312761 | 3300031548 | Rhizosphere | VRESGHPRLIVGGLVALAGLIVVLTYLGVELPREGG |
| Ga0318528_103736292 | 3300031561 | Soil | ILLGRAFMATVRESGHPRILWGGVAVVVGLVVLLTWLGVELPRE |
| Ga0318572_104407812 | 3300031681 | Soil | AFADTVRESTHPRWIVAGLVALAGAVILLTWLGVSLPRE |
| Ga0310813_116838542 | 3300031716 | Soil | GVVILLGRAFAQTLRESGHKRAILAGLAAVVAAVVVLTYLGVELPRE |
| Ga0307469_122319441 | 3300031720 | Hardwood Forest Soil | VRESGHKRLIVSGLVVITIAVIVLTYLGVQLPREGG |
| Ga0307405_107235653 | 3300031731 | Rhizosphere | VMAPLIVIAVGVSAAVLILLGRGLVQSVRESGHPRLIVGGLVALAGLIVVLTYLGVELPREGG |
| Ga0318552_107260462 | 3300031782 | Soil | VGIVLATGIVLVRAMAQTVRESGHPRWFYAGFVALAGAIALLTYLGVQLPREGG |
| Ga0318527_104249182 | 3300031859 | Soil | GAGLVLGVMILLGRAFMATVRESGHPRILWGGVAVVVGLVVLLTWLGVELPRE |
| Ga0308176_112890101 | 3300031996 | Soil | LGRAFAVTVRESGHPRLIYAGLLGLAVAIVILTYLGIELPREG |
| Ga0308176_115877252 | 3300031996 | Soil | AHSVRESGHKRAIVAGLVVVAGAVVVLTYLGVELPRE |
| Ga0308176_129754351 | 3300031996 | Soil | LLGRALAVTIRESGHPRWIVSGLVALAGAIVLLTYLGVELPRE |
| Ga0306922_104238841 | 3300032001 | Soil | GAVLILLGRAFADSVRDWGHPRLLAAGAVTLVAVVVVLTWLGVSLPRE |
| Ga0318563_102717691 | 3300032009 | Soil | VLGTGLILGVLILLGRAFADTVRESTHPRWIVAGLVALAGAVILLTWLGVSLPRE |
| Ga0335085_106730272 | 3300032770 | Soil | GVMILLGRAFMATVRESGHPRALWGGVAVIVGLVVLLTWLGVQLPRE |
| Ga0335078_122662512 | 3300032805 | Soil | DSVRDSAHPRWILGGVVALVGAVVLLTWLGIQLPRE |
| Ga0335083_108271402 | 3300032954 | Soil | QTVRESGHPRWFYAGFVVLAGAIALLTYLGVELPREGG |
| ⦗Top⦘ |