Basic Information | |
---|---|
Family ID | F082504 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 41 residues |
Representative Sequence | MSAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREEL |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 33.64 % |
% of genes near scaffold ends (potentially truncated) | 96.46 % |
% of genes from short scaffolds (< 2000 bps) | 83.19 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.345 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.203 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.018 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.327 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.63% β-sheet: 0.00% Coil/Unstructured: 94.37% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF01928 | CYTH | 21.24 |
PF13242 | Hydrolase_like | 21.24 |
PF12710 | HAD | 9.73 |
PF00877 | NLPC_P60 | 7.08 |
PF00072 | Response_reg | 2.65 |
PF08239 | SH3_3 | 2.65 |
PF13419 | HAD_2 | 1.77 |
PF03576 | Peptidase_S58 | 1.77 |
PF01648 | ACPS | 0.88 |
PF04972 | BON | 0.88 |
PF02321 | OEP | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 7.08 |
COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 3.54 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.35 % |
Unclassified | root | N/A | 2.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002562|JGI25382J37095_10238616 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
3300002908|JGI25382J43887_10019454 | All Organisms → cellular organisms → Bacteria | 3595 | Open in IMG/M |
3300002908|JGI25382J43887_10144165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1216 | Open in IMG/M |
3300004281|Ga0066397_10028613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 887 | Open in IMG/M |
3300005166|Ga0066674_10554865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
3300005174|Ga0066680_10383913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 893 | Open in IMG/M |
3300005176|Ga0066679_10105149 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
3300005178|Ga0066688_10244702 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300005179|Ga0066684_10366196 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300005554|Ga0066661_10690992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 599 | Open in IMG/M |
3300005556|Ga0066707_10878562 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
3300005569|Ga0066705_10179422 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
3300005574|Ga0066694_10094242 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300005574|Ga0066694_10401544 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 645 | Open in IMG/M |
3300005586|Ga0066691_10093250 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300005598|Ga0066706_10010400 | All Organisms → cellular organisms → Bacteria | 5097 | Open in IMG/M |
3300005598|Ga0066706_10263003 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300005598|Ga0066706_10289065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1287 | Open in IMG/M |
3300006032|Ga0066696_10220808 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300006755|Ga0079222_11529862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 627 | Open in IMG/M |
3300006791|Ga0066653_10342344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 756 | Open in IMG/M |
3300006797|Ga0066659_10977368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
3300006800|Ga0066660_10163638 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
3300006800|Ga0066660_10956119 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 693 | Open in IMG/M |
3300006871|Ga0075434_101079976 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300006903|Ga0075426_10254531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1279 | Open in IMG/M |
3300007258|Ga0099793_10379716 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 693 | Open in IMG/M |
3300007258|Ga0099793_10380237 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300009147|Ga0114129_10230718 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2493 | Open in IMG/M |
3300009808|Ga0105071_1056079 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 647 | Open in IMG/M |
3300009822|Ga0105066_1145641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 542 | Open in IMG/M |
3300010323|Ga0134086_10039558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1577 | Open in IMG/M |
3300010323|Ga0134086_10124208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 927 | Open in IMG/M |
3300010364|Ga0134066_10021019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1448 | Open in IMG/M |
3300010364|Ga0134066_10088166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 878 | Open in IMG/M |
3300011271|Ga0137393_10842256 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_66_5 | 783 | Open in IMG/M |
3300011435|Ga0137426_1097229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 827 | Open in IMG/M |
3300012096|Ga0137389_10594542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 951 | Open in IMG/M |
3300012198|Ga0137364_10209011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1432 | Open in IMG/M |
3300012198|Ga0137364_10713648 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 757 | Open in IMG/M |
3300012198|Ga0137364_11018860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 625 | Open in IMG/M |
3300012201|Ga0137365_11073071 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300012201|Ga0137365_11323232 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
3300012202|Ga0137363_10246079 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1452 | Open in IMG/M |
3300012202|Ga0137363_10375377 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1181 | Open in IMG/M |
3300012203|Ga0137399_11065037 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 681 | Open in IMG/M |
3300012206|Ga0137380_10257541 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300012208|Ga0137376_11035475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 703 | Open in IMG/M |
3300012209|Ga0137379_11173395 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 674 | Open in IMG/M |
3300012226|Ga0137447_1074888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 651 | Open in IMG/M |
3300012285|Ga0137370_10933658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 536 | Open in IMG/M |
3300012351|Ga0137386_10089601 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
3300012355|Ga0137369_10608888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 759 | Open in IMG/M |
3300012360|Ga0137375_10262820 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300012395|Ga0134044_1205783 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 886 | Open in IMG/M |
3300012532|Ga0137373_10092637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2662 | Open in IMG/M |
3300012683|Ga0137398_10773336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 670 | Open in IMG/M |
3300012918|Ga0137396_10067382 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2495 | Open in IMG/M |
3300012925|Ga0137419_10118121 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1867 | Open in IMG/M |
3300012929|Ga0137404_11347965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 658 | Open in IMG/M |
3300012930|Ga0137407_10549243 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1081 | Open in IMG/M |
3300012972|Ga0134077_10242545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 744 | Open in IMG/M |
3300012972|Ga0134077_10283602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 692 | Open in IMG/M |
3300012977|Ga0134087_10125465 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300012977|Ga0134087_10523757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 601 | Open in IMG/M |
3300014150|Ga0134081_10043605 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300014150|Ga0134081_10230074 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 640 | Open in IMG/M |
3300014872|Ga0180087_1020024 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300015053|Ga0137405_1385775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 663 | Open in IMG/M |
3300015264|Ga0137403_10045241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4565 | Open in IMG/M |
3300015264|Ga0137403_10207485 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1888 | Open in IMG/M |
3300015371|Ga0132258_11907441 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1496 | Open in IMG/M |
3300017654|Ga0134069_1162238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 751 | Open in IMG/M |
3300017657|Ga0134074_1402620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 508 | Open in IMG/M |
3300018060|Ga0187765_10863938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
3300018071|Ga0184618_10013888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2501 | Open in IMG/M |
3300018433|Ga0066667_10270544 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1301 | Open in IMG/M |
3300019789|Ga0137408_1193823 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1705 | Open in IMG/M |
3300019882|Ga0193713_1045521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1266 | Open in IMG/M |
3300020199|Ga0179592_10384128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 615 | Open in IMG/M |
3300021086|Ga0179596_10011582 | All Organisms → cellular organisms → Bacteria | 2915 | Open in IMG/M |
3300021086|Ga0179596_10340138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 752 | Open in IMG/M |
3300024330|Ga0137417_1094441 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 738 | Open in IMG/M |
3300025910|Ga0207684_10041143 | All Organisms → cellular organisms → Bacteria | 3920 | Open in IMG/M |
3300025922|Ga0207646_11026168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 728 | Open in IMG/M |
3300025928|Ga0207700_10131667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2043 | Open in IMG/M |
3300026014|Ga0208776_1021118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 553 | Open in IMG/M |
3300026297|Ga0209237_1226698 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 579 | Open in IMG/M |
3300026298|Ga0209236_1239383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 608 | Open in IMG/M |
3300026301|Ga0209238_1076147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1174 | Open in IMG/M |
3300026306|Ga0209468_1027325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2006 | Open in IMG/M |
3300026313|Ga0209761_1049132 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
3300026314|Ga0209268_1027190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2006 | Open in IMG/M |
3300026315|Ga0209686_1142314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 751 | Open in IMG/M |
3300026322|Ga0209687_1115486 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 866 | Open in IMG/M |
3300026324|Ga0209470_1055676 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1889 | Open in IMG/M |
3300026329|Ga0209375_1014393 | All Organisms → cellular organisms → Bacteria | 4761 | Open in IMG/M |
3300026334|Ga0209377_1197200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 677 | Open in IMG/M |
3300026523|Ga0209808_1104163 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300026528|Ga0209378_1247392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 566 | Open in IMG/M |
3300026536|Ga0209058_1187126 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 890 | Open in IMG/M |
3300026540|Ga0209376_1304412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 625 | Open in IMG/M |
3300026552|Ga0209577_10174721 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1670 | Open in IMG/M |
3300027748|Ga0209689_1341926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 573 | Open in IMG/M |
3300028784|Ga0307282_10618678 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_66_5 | 525 | Open in IMG/M |
3300031226|Ga0307497_10591616 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 560 | Open in IMG/M |
3300033158|Ga0335077_10079471 | All Organisms → cellular organisms → Bacteria | 3896 | Open in IMG/M |
3300034176|Ga0364931_0017251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1996 | Open in IMG/M |
3300034176|Ga0364931_0271682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 559 | Open in IMG/M |
3300034773|Ga0364936_007980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1643 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.08% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.65% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J37095_102386162 | 3300002562 | Grasslands Soil | MPLRVPELAPSLGRVLVPRRLAXPWVPLDDIREELATRVLELG |
JGI25382J43887_100194541 | 3300002908 | Grasslands Soil | MSAPVKIPMPLRVPELAPSLGRLLVPRRLEEPWVPLDDIREE |
JGI25382J43887_101441653 | 3300002908 | Grasslands Soil | MSTPVKIPMPLRVPELAPSLGRLLVPRRLEEPWVPLDDIREEL |
Ga0066397_100286131 | 3300004281 | Tropical Forest Soil | MKLLMPLRVPELAPSLGRIIVPRRQEVPWVPLDDIREELATRVLEL |
Ga0066674_105548652 | 3300005166 | Soil | VSTVKIPMPLRVPELAPSLGRVVVPRRVTEPWVPIDDLREALATRVLE |
Ga0066680_103839133 | 3300005174 | Soil | MSAPVKIPMPLRVPELAPSLGRLLVPRRLEEPWVPLDDIREELAT |
Ga0066679_101051494 | 3300005176 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDVREDLATR |
Ga0066688_102447023 | 3300005178 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDVREDLA |
Ga0066684_103661961 | 3300005179 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDVRED |
Ga0066661_106909922 | 3300005554 | Soil | VSTVKIPMPLRVPELAPSLGRVVVPRRVAEPWVPIDD |
Ga0066707_108785622 | 3300005556 | Soil | MSASPPPLKIPMPLRVPELAPSLGRLLVPRRLEPPW |
Ga0066705_101794221 | 3300005569 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVP |
Ga0066694_100942421 | 3300005574 | Soil | MSAQVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDI |
Ga0066694_104015441 | 3300005574 | Soil | MSASVKIPMPLRVPELAPPLGRVLVPRRLEEPWVPLDDIREELAT |
Ga0066691_100932504 | 3300005586 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDIREELAT |
Ga0066706_100104001 | 3300005598 | Soil | VSTVKIPMPLRVPELAPSLGRVVVPRRVAEPWVPIDDIREALA |
Ga0066706_102630033 | 3300005598 | Soil | MNPPLKLLMPLRVPELAPSLGRVIVPRRLFDPWVPLD |
Ga0066706_102890653 | 3300005598 | Soil | VSSVKIPMPLRVPELAPSLGRVLVPRRVAEPWLPIDDIREA |
Ga0066696_102208083 | 3300006032 | Soil | MSTPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREELATR |
Ga0079222_115298621 | 3300006755 | Agricultural Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPL |
Ga0066653_103423441 | 3300006791 | Soil | MSASVKIPMPLRVPELAPPLGRVLVPRRLEEPWVPL |
Ga0066659_109773682 | 3300006797 | Soil | MKLLMPLRVPELAPSLARIIVPRRLFDPWVPLDDSPEE |
Ga0066660_101636384 | 3300006800 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLD |
Ga0066660_109561192 | 3300006800 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDLREDLA |
Ga0075434_1010799763 | 3300006871 | Populus Rhizosphere | MSPQVKIPMPLRVPELAPSLGRVLVPRRLTEPWVPLDDIRE |
Ga0075426_102545313 | 3300006903 | Populus Rhizosphere | MKLFMPLRVPELAPSLGRIIVPRRLFDPWVPLDDIREELAT |
Ga0099793_103797161 | 3300007258 | Vadose Zone Soil | MNQPLKLLMPLRVPELAPSLGRIIVPRRLLDPWVPVDDIR |
Ga0099793_103802372 | 3300007258 | Vadose Zone Soil | MSASVKIPMPLRVPELAPSLGQVLVPRRLEEPWVPLDDIREELATRVI |
Ga0114129_102307181 | 3300009147 | Populus Rhizosphere | MNIPMPLRVPELAPSLGRVIVARRREPPWVPLDDIREELATA |
Ga0105071_10560791 | 3300009808 | Groundwater Sand | MPLRVPELASPLGRLIVPRRLSPPSIPVDDAREDLATRILELG |
Ga0105066_11456411 | 3300009822 | Groundwater Sand | MSASLKIPMPLRVPELAPSLGRLLVPRRLAEPWIPLEDIREELAT |
Ga0134086_100395583 | 3300010323 | Grasslands Soil | VSTVKIPMPLRVPELAPSLGRVVVPRRVTEPWVPIDDLREAL |
Ga0134086_101242081 | 3300010323 | Grasslands Soil | MSTPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREELATRVME |
Ga0126377_112647051 | 3300010362 | Tropical Forest Soil | VTLHVPELGPCLGRLIVPRRVTELWVPLDDVREAL |
Ga0134066_100210191 | 3300010364 | Grasslands Soil | MSAMKLLMPLRVPELAPSLGRIIVPRRLLDPWVPLEDIREELATR |
Ga0134066_100881661 | 3300010364 | Grasslands Soil | MSTPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIR |
Ga0137393_108422562 | 3300011271 | Vadose Zone Soil | MNPPLKLLMPLRVPELAPSLGRVIVPRRLFDPWVPLDDIREELATRVL |
Ga0137426_10972293 | 3300011435 | Soil | MKLLMPLRVPELAPSLGRIIVPRRQQAPWVPLDDIREELA |
Ga0137389_105945421 | 3300012096 | Vadose Zone Soil | MSAPVKIPMPLRVPEIAPSLGRVLVPRRLEEPWVPLDDIREELAT |
Ga0137364_102090111 | 3300012198 | Vadose Zone Soil | MRAMKLLMPLRVPELAPSLGRIIVPRRLLDPWVPLEDIREELAT |
Ga0137364_107136482 | 3300012198 | Vadose Zone Soil | MKLLMPLRVPELAPSLGRIIVPRRLLDPWVPLDDIREEL |
Ga0137364_110188601 | 3300012198 | Vadose Zone Soil | MKLLMPLRVPELAPSLGRIIVPRRLFDPWVPLDDIREEL |
Ga0137365_110730711 | 3300012201 | Vadose Zone Soil | MTAPLKILMPLRVPELAPSLGRLLVPRRLAEPWVPIDD |
Ga0137365_113232321 | 3300012201 | Vadose Zone Soil | VSTVKIPMPLRVPELAPSLGRVVVPRRVAEPWVPIDDIREALATRVL |
Ga0137363_102460791 | 3300012202 | Vadose Zone Soil | MMPLRVPELAPSLGRIIVPRRLLDPWVPLDDIREELATRVVEL |
Ga0137363_103753771 | 3300012202 | Vadose Zone Soil | MSAPVKIPMPLRVPEIAPSLGRVLVPRRLEEPWVPLDDIREELATR |
Ga0137399_110650372 | 3300012203 | Vadose Zone Soil | MSAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVP |
Ga0137380_102575413 | 3300012206 | Vadose Zone Soil | MTAPLKILMPLRVPELAPSLGRLLVPRRLAEPWVPIDDVREELATRVI |
Ga0137376_110354751 | 3300012208 | Vadose Zone Soil | VSAPLKLLMPLRVPELAPSLGRVIVPRRRAAPWVQ |
Ga0137379_111733951 | 3300012209 | Vadose Zone Soil | VSTVKIPMPLRVPELAPSLGRVVVPRRVAEPWVPIDDIRE |
Ga0137447_10748881 | 3300012226 | Soil | MNIPMPLRVPELAPSLGRVVVARRREPPWVPLDDIREELA |
Ga0137370_109336582 | 3300012285 | Vadose Zone Soil | MKLLMPLRVPELAPSLGRIIVPRRLLDPWVPLADIREELAT |
Ga0137386_100896014 | 3300012351 | Vadose Zone Soil | MSAPLKIPMPLRVPDLAPSLGRLLVPRRLEPPWVPLDDVREELVTRVLE |
Ga0137369_106088883 | 3300012355 | Vadose Zone Soil | MNIPMPLRVPELAPSLGRVVVERRREEPWVPLDDIREELA |
Ga0137375_102628201 | 3300012360 | Vadose Zone Soil | MSAPLKILMPLRVPELAPSLGRLLVPRRLEPPWVPLDD |
Ga0134044_12057833 | 3300012395 | Grasslands Soil | MSASVKIPMPLRVPELAPSLGQVLVPRRLEEPWVPLD |
Ga0137373_100926371 | 3300012532 | Vadose Zone Soil | MKAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREQLAT |
Ga0137398_107733362 | 3300012683 | Vadose Zone Soil | MSASVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREEL |
Ga0137396_100673821 | 3300012918 | Vadose Zone Soil | MKLLMPLRVPELAPSLGRIIVPRRLLDPWVPVDDIREELATRVLE |
Ga0137419_101181211 | 3300012925 | Vadose Zone Soil | MSTPVKIPMPLRVPEIAPSLGRVLVPRRLEEPWVPLDDIREEL |
Ga0137404_113479652 | 3300012929 | Vadose Zone Soil | MSAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREEL |
Ga0137407_105492431 | 3300012930 | Vadose Zone Soil | MNPPHKLLMPLRVPELAPSLGRIIVPRRLLDPWVPLDDIREEL |
Ga0134077_102425451 | 3300012972 | Grasslands Soil | MSTPVKIPMPLRVPELAPSLGRVLVPRRLEDPWVPLDDIREELATRVME |
Ga0134077_102836021 | 3300012972 | Grasslands Soil | MKLLMPLRVPELAPSLGRIIVPRRLFDPWVPVDDIREEL |
Ga0134087_101254653 | 3300012977 | Grasslands Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDL |
Ga0134087_105237572 | 3300012977 | Grasslands Soil | VKAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIR |
Ga0134081_100436053 | 3300014150 | Grasslands Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDLREELATRV |
Ga0134081_102300742 | 3300014150 | Grasslands Soil | MTAPLKILMPLRVPELAPSLGRLLVPRRLAEPWVPIDDVREELATRV |
Ga0180087_10200243 | 3300014872 | Soil | MKLLMPLRVPELAPSLGRIIVPRRQQAPWVPLDDIRE |
Ga0137405_13857751 | 3300015053 | Vadose Zone Soil | MSAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVGSARRHPRG |
Ga0137403_100452411 | 3300015264 | Vadose Zone Soil | MSAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREELATRVM |
Ga0137403_102074851 | 3300015264 | Vadose Zone Soil | MSASVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREELATRVM |
Ga0132258_119074413 | 3300015371 | Arabidopsis Rhizosphere | MSPQVKIPMPLRVPELAPSLGRVLVPRRLTEPWVPLDDIPKSSRRA* |
Ga0134069_11622381 | 3300017654 | Grasslands Soil | MKLLMPLRVPELAPSLGRIIVPRRQQPPWVPLDDIREELAT |
Ga0134074_14026201 | 3300017657 | Grasslands Soil | MKLLMPLRVPELAPSLGRIIVPRRQQPPWVPLDDI |
Ga0187765_108639381 | 3300018060 | Tropical Peatland | MGAPIKIPMPLRVPELGSALGRLIVPRRLEPLWIP |
Ga0184618_100138885 | 3300018071 | Groundwater Sediment | MNPPLKLLMPLRVPELAPSLGRIIVPRRLLDPWVPLDDIREELA |
Ga0184639_100108981 | 3300018082 | Groundwater Sediment | VKLHVPELAPALGRLIVPRRLVEPWVPLDDLREAL |
Ga0066667_102705441 | 3300018433 | Grasslands Soil | MPLRVPELAPSLGRVLVPRRLADPRVPLDDIREELAT |
Ga0137408_11938231 | 3300019789 | Vadose Zone Soil | MSAPVKIPMPLRVPEIAPSLGRVLVPRRLEEPWVCPAAWRS |
Ga0193713_10455211 | 3300019882 | Soil | MSPGMKLLMPLRVPELAPSLGRIIVPRRLLDPWVPVDDIRE |
Ga0179592_103841281 | 3300020199 | Vadose Zone Soil | MSAPVKIPMPLRVPEIAPSLGRVLVPRRLEEPWVPLDDIREEL |
Ga0179596_100115821 | 3300021086 | Vadose Zone Soil | MSASVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDD |
Ga0179596_103401382 | 3300021086 | Vadose Zone Soil | MSAPVKIPMPLRVPEIAPSLGRVLVPRRLEEPWVPLDDIRE |
Ga0137417_10944412 | 3300024330 | Vadose Zone Soil | MSAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIR |
Ga0207684_100411436 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAPVKIPMPLRVPEIAPSLGQVLVPRRLEEPWVPLDDI |
Ga0207646_110261681 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAPLRIPMPLRVPELSSPLGRLIVPRRLAEPWIQIDDEREALATRIIELA |
Ga0207700_101316674 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPQVKIPMPLRVPELAPSLGRVLVPRRLTEPWVPLDDIREEL |
Ga0208776_10211181 | 3300026014 | Rice Paddy Soil | MSAPLKIPMPLRVPELAPSLGRVLVPRRLVEPWVPLDDIRE |
Ga0209237_12266981 | 3300026297 | Grasslands Soil | VSAAVQIPMPLRVPELAPSLGRVLVPRRVAEPWVPLDDIREALATRA |
Ga0209236_12393832 | 3300026298 | Grasslands Soil | MPLRVPELAPSLGRVLVPRRLADPWVPLDDIREELATR |
Ga0209238_10761473 | 3300026301 | Grasslands Soil | VSTVKIPMPLRVPELAPSLGRVVVPRRVAEPWVPIDDIREA |
Ga0209468_10273254 | 3300026306 | Soil | MSAPVKIPMPLRVPELAPSLGRLLVPRRLEEPWVPLD |
Ga0209761_10491321 | 3300026313 | Grasslands Soil | VSAAVQIPMPLRVPELAPSLGRVLVPRRVAEPWVPLDDI |
Ga0209268_10271901 | 3300026314 | Soil | MSAQVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREELATR |
Ga0209686_11423141 | 3300026315 | Soil | VNAPLKLLMPLRVPELAPSLGRIIVPRRLLPPWLPLDDIREEL |
Ga0209687_11154863 | 3300026322 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDLREELAT |
Ga0209470_10556761 | 3300026324 | Soil | VSTVKIPMPLRVPELAPSLGRLVVPRRVAEPWVPIDDIREALA |
Ga0209375_10143938 | 3300026329 | Soil | MSPQVKIPMPLRVPELAPSLGRVLVPRRLEEPWVPLDDIREELATRVM |
Ga0209377_11972002 | 3300026334 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDLREDLATRVM |
Ga0209808_11041631 | 3300026523 | Soil | VNAPLKLLMPLRVPELAPSLGRIIVPRRLLPPWVPLDDIREEL |
Ga0209378_12473922 | 3300026528 | Soil | MSASPPPLKIPMPLRVPELAPSLGRLLVPRRLEPPWVP |
Ga0209058_11871261 | 3300026536 | Soil | VKAPVKIPMPLRVPELAPSLGRVLVPRRLEEPWVP |
Ga0209376_13044122 | 3300026540 | Soil | MTAPLKILMPLRVPELAPSLGRLLVPRRLAEPWVPIDDVREELATRDE |
Ga0209577_101747214 | 3300026552 | Soil | MSPGVKIPMPLRVPELASSLGRLLVPRRLEEPWVPLDDV |
Ga0209689_13419261 | 3300027748 | Soil | MPLRVPELAPSLGRVLVPRRLADPWVPLDDIREELATRVIELG |
Ga0307282_106186781 | 3300028784 | Soil | MSPGMKLLMPLRVPELAPSLGRIIVPRRLLDPWVPVDDIREE |
Ga0307497_105916162 | 3300031226 | Soil | VNAPLKIPMPLRVPELAPSLGRLLVPRRLAQPWVPVDDIREELATRV |
Ga0335077_100794716 | 3300033158 | Soil | MGAPVKIPMPLRIPELGSALGRLIVPRRLEPLWIPLDDIREELATRIMEQ |
Ga0326723_0011158_1_114 | 3300034090 | Peat Soil | VKLAVPELGPALGQLIVPHRLSDPWVPLDDVRETLATR |
Ga0364931_0017251_1870_1995 | 3300034176 | Sediment | MNIPMPLRVPELAPSLGRVVVARRREAPWVPLDDIREELATA |
Ga0364931_0271682_1_111 | 3300034176 | Sediment | MKLHVPELAPALGRLIVPRRLVEPWVPLDDLREALAT |
Ga0364936_007980_1531_1641 | 3300034773 | Sediment | MKLNVPELAPALGRLIVPRRLVEPWVPLDDLREALAT |
⦗Top⦘ |