| Basic Information | |
|---|---|
| Family ID | F082454 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSSSDGIGQLRSIEQQFDRESASVADLRALEDIRNRYLSRKSGLLTTQLQNL |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.61 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.81 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.73 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.442 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (8.850 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.973 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.25% β-sheet: 0.00% Coil/Unstructured: 43.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.73 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| e.79.1.1: CRISPR associated protein Cas1-like | d3goda_ | 3god | 0.877 |
| a.238.1.1: BAR domain | d1urua_ | 1uru | 0.8508 |
| a.25.1.4: YciF-like | d2gyqa1 | 2gyq | 0.8501 |
| a.78.1.1: GntR ligand-binding domain-like | d1hw1a2 | 1hw1 | 0.83984 |
| c.37.1.19: Tandem AAA-ATPase domain | d1z5za1 | 1z5z | 0.82567 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00453 | Ribosomal_L20 | 75.22 |
| PF05198 | IF3_N | 10.62 |
| PF01632 | Ribosomal_L35p | 7.96 |
| PF00707 | IF3_C | 2.65 |
| PF13191 | AAA_16 | 0.88 |
| PF07355 | GRDB | 0.88 |
| PF02912 | Phe_tRNA-synt_N | 0.88 |
| PF00587 | tRNA-synt_2b | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0292 | Ribosomal protein L20 | Translation, ribosomal structure and biogenesis [J] | 75.22 |
| COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 13.27 |
| COG0291 | Ribosomal protein L35 | Translation, ribosomal structure and biogenesis [J] | 7.96 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.44 % |
| Unclassified | root | N/A | 49.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004631|Ga0058899_12054485 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300004643|Ga0062591_100980265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 802 | Open in IMG/M |
| 3300005183|Ga0068993_10240544 | Not Available | 640 | Open in IMG/M |
| 3300005328|Ga0070676_11043611 | Not Available | 615 | Open in IMG/M |
| 3300005332|Ga0066388_100866456 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300005333|Ga0070677_10898610 | Not Available | 512 | Open in IMG/M |
| 3300005456|Ga0070678_102011651 | Not Available | 547 | Open in IMG/M |
| 3300005552|Ga0066701_10877870 | Not Available | 532 | Open in IMG/M |
| 3300005554|Ga0066661_10935736 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005574|Ga0066694_10530183 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005598|Ga0066706_10046449 | All Organisms → cellular organisms → Bacteria | 2906 | Open in IMG/M |
| 3300005598|Ga0066706_11264837 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005615|Ga0070702_100132954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
| 3300005713|Ga0066905_102301819 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005836|Ga0074470_10514877 | All Organisms → cellular organisms → Bacteria | 2348 | Open in IMG/M |
| 3300005841|Ga0068863_100529411 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300005843|Ga0068860_101327854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 740 | Open in IMG/M |
| 3300005843|Ga0068860_102282189 | Not Available | 562 | Open in IMG/M |
| 3300006794|Ga0066658_10570227 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300006800|Ga0066660_10871569 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300006844|Ga0075428_101669763 | Not Available | 665 | Open in IMG/M |
| 3300006844|Ga0075428_102221723 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006852|Ga0075433_10131670 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300006876|Ga0079217_10271982 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300006954|Ga0079219_10920989 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300009094|Ga0111539_11293203 | Not Available | 846 | Open in IMG/M |
| 3300009148|Ga0105243_11265750 | Not Available | 753 | Open in IMG/M |
| 3300009148|Ga0105243_11527265 | Not Available | 692 | Open in IMG/M |
| 3300009162|Ga0075423_11530566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300009174|Ga0105241_12453060 | Not Available | 521 | Open in IMG/M |
| 3300009243|Ga0103860_10142816 | Not Available | 542 | Open in IMG/M |
| 3300009551|Ga0105238_10533042 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300010046|Ga0126384_11537698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 625 | Open in IMG/M |
| 3300010046|Ga0126384_11852417 | Not Available | 574 | Open in IMG/M |
| 3300010047|Ga0126382_11609674 | Not Available | 602 | Open in IMG/M |
| 3300010087|Ga0127492_1032808 | Not Available | 716 | Open in IMG/M |
| 3300010115|Ga0127495_1016931 | Not Available | 578 | Open in IMG/M |
| 3300010142|Ga0127483_1225563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300010304|Ga0134088_10658942 | Not Available | 523 | Open in IMG/M |
| 3300010321|Ga0134067_10343061 | Not Available | 586 | Open in IMG/M |
| 3300010366|Ga0126379_13678178 | Not Available | 514 | Open in IMG/M |
| 3300010397|Ga0134124_10862263 | Not Available | 909 | Open in IMG/M |
| 3300010397|Ga0134124_11426057 | Not Available | 719 | Open in IMG/M |
| 3300010401|Ga0134121_10353501 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300011120|Ga0150983_12349056 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300011443|Ga0137457_1198519 | Not Available | 681 | Open in IMG/M |
| 3300012212|Ga0150985_100278361 | Not Available | 769 | Open in IMG/M |
| 3300012212|Ga0150985_110877313 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300012212|Ga0150985_113203611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1294 | Open in IMG/M |
| 3300012285|Ga0137370_10445101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 788 | Open in IMG/M |
| 3300012398|Ga0134051_1237294 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300012410|Ga0134060_1172311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 746 | Open in IMG/M |
| 3300012410|Ga0134060_1438543 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300012469|Ga0150984_100860893 | Not Available | 512 | Open in IMG/M |
| 3300012469|Ga0150984_113122898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1334 | Open in IMG/M |
| 3300012469|Ga0150984_114411292 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012469|Ga0150984_114738506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1937 | Open in IMG/M |
| 3300012469|Ga0150984_122984679 | Not Available | 647 | Open in IMG/M |
| 3300012683|Ga0137398_10191134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1346 | Open in IMG/M |
| 3300012891|Ga0157305_10136084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 647 | Open in IMG/M |
| 3300012917|Ga0137395_11288924 | Not Available | 505 | Open in IMG/M |
| 3300012918|Ga0137396_10522846 | Not Available | 879 | Open in IMG/M |
| 3300012922|Ga0137394_11081168 | Not Available | 665 | Open in IMG/M |
| 3300012948|Ga0126375_11948455 | Not Available | 517 | Open in IMG/M |
| 3300012972|Ga0134077_10452495 | Not Available | 562 | Open in IMG/M |
| 3300014325|Ga0163163_12016325 | Not Available | 637 | Open in IMG/M |
| 3300014879|Ga0180062_1163624 | Not Available | 511 | Open in IMG/M |
| 3300014969|Ga0157376_12720849 | Not Available | 535 | Open in IMG/M |
| 3300015053|Ga0137405_1115114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2075 | Open in IMG/M |
| 3300015371|Ga0132258_11411967 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300015371|Ga0132258_12699566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300016294|Ga0182041_12319380 | Not Available | 502 | Open in IMG/M |
| 3300016371|Ga0182034_10994299 | Not Available | 724 | Open in IMG/M |
| 3300018062|Ga0187784_10880426 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300018063|Ga0184637_10257969 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300018429|Ga0190272_13336934 | Not Available | 501 | Open in IMG/M |
| 3300018433|Ga0066667_10097419 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300019880|Ga0193712_1005752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2514 | Open in IMG/M |
| 3300020064|Ga0180107_1161413 | Not Available | 703 | Open in IMG/M |
| 3300020170|Ga0179594_10044945 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300023270|Ga0247784_1073647 | Not Available | 852 | Open in IMG/M |
| 3300025926|Ga0207659_11416391 | Not Available | 596 | Open in IMG/M |
| 3300025933|Ga0207706_10123598 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300025934|Ga0207686_10236282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1328 | Open in IMG/M |
| 3300025938|Ga0207704_10413576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300025942|Ga0207689_11185707 | Not Available | 643 | Open in IMG/M |
| 3300026088|Ga0207641_10325298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1459 | Open in IMG/M |
| 3300026088|Ga0207641_11377255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 706 | Open in IMG/M |
| 3300026089|Ga0207648_10313699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1408 | Open in IMG/M |
| 3300026538|Ga0209056_10695553 | Not Available | 514 | Open in IMG/M |
| 3300026540|Ga0209376_1107474 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300027909|Ga0209382_10447959 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300028379|Ga0268266_11998913 | Not Available | 553 | Open in IMG/M |
| 3300028381|Ga0268264_11633934 | Not Available | 655 | Open in IMG/M |
| 3300028536|Ga0137415_10003408 | All Organisms → cellular organisms → Bacteria | 15820 | Open in IMG/M |
| 3300031099|Ga0308181_1072269 | Not Available | 699 | Open in IMG/M |
| 3300031099|Ga0308181_1188457 | Not Available | 501 | Open in IMG/M |
| 3300031170|Ga0307498_10171222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 737 | Open in IMG/M |
| 3300031562|Ga0310886_10089483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1507 | Open in IMG/M |
| 3300031740|Ga0307468_100917856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 761 | Open in IMG/M |
| 3300031890|Ga0306925_11296546 | Not Available | 724 | Open in IMG/M |
| 3300031941|Ga0310912_11067882 | Not Available | 618 | Open in IMG/M |
| 3300032000|Ga0310903_10544079 | Not Available | 612 | Open in IMG/M |
| 3300032075|Ga0310890_11560368 | Not Available | 545 | Open in IMG/M |
| 3300032157|Ga0315912_11138120 | Not Available | 619 | Open in IMG/M |
| 3300032180|Ga0307471_100596988 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300034661|Ga0314782_165716 | Not Available | 552 | Open in IMG/M |
| 3300034662|Ga0314783_066930 | Not Available | 709 | Open in IMG/M |
| 3300034664|Ga0314786_010236 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300034665|Ga0314787_049933 | Not Available | 686 | Open in IMG/M |
| 3300034667|Ga0314792_201601 | Not Available | 559 | Open in IMG/M |
| 3300034667|Ga0314792_203317 | Not Available | 558 | Open in IMG/M |
| 3300034669|Ga0314794_141624 | Not Available | 550 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 4.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058899_120544851 | 3300004631 | Forest Soil | MSSKTGIDQLHGLQQQFDSELASVVDHRSLEDVRARYLSRKSGLLTLQ |
| Ga0062591_1009802653 | 3300004643 | Soil | MSSEWIGQLRSIEQQFDRERESVADLRSFEELKNRYLSRKSGLLTLQLQNVRNVPSTERA |
| Ga0068993_102405442 | 3300005183 | Natural And Restored Wetlands | MSSNDGIGRLHAIQRQFDSETVSIVDRKSLEDARARYLSRKSGLLTLELQN |
| Ga0070676_110436112 | 3300005328 | Miscanthus Rhizosphere | MSSSDGIGNLRSIEHQFDRECVSVADIRALEDIRNRYLSRKSGLLTTQLQNLRNIPSS |
| Ga0066388_1008664565 | 3300005332 | Tropical Forest Soil | MSSNDGVGRLRAIEQQFDADRARVADRKSLEDIRNRYLSRKSGLLTLELQ |
| Ga0070677_108986101 | 3300005333 | Miscanthus Rhizosphere | MSSEWIGQLRSIAQQFDRDRESVADLRSLEDIRNRYLSRKSGLLTLQLQNVRNVPPAE |
| Ga0070678_1020116511 | 3300005456 | Miscanthus Rhizosphere | MSSSDGIGNLRSLRSIEEQFDRECASIADVRALEDIRNRYLSRKSGLL |
| Ga0066701_108778702 | 3300005552 | Soil | MSSNDGIARLRTIKQQFDAECVSVVDHKSLEDFRNRYLSRK |
| Ga0066661_109357362 | 3300005554 | Soil | MSSNDGIGRLRAIERQFDEDRVSVADLKAVEDIRTRYLSRKAGLLTLE |
| Ga0066694_105301831 | 3300005574 | Soil | MSSNDGIGRLRAIERQFDEDRVSVADLKAVEDIRTRYLSRKAGLLTLELQNLG |
| Ga0066706_100464491 | 3300005598 | Soil | MSSNDGIGRLRAIEQKFNSELASVHDARSLEDIRTRYLSRKSGLL |
| Ga0066706_112648372 | 3300005598 | Soil | VSSNDGIGKLRAIEEQFEQDRASAVDLKSLEDLRTRYLSRKSGILTLELQNLGK |
| Ga0070702_1001329541 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEDFRNRYLARKSGLLTT |
| Ga0066905_1023018191 | 3300005713 | Tropical Forest Soil | MSSKTGIEQLRAIEEQFDRESGAVSDPRSLEEIRNRYLSRKSGILTTQLQNLKDLP |
| Ga0074470_105148776 | 3300005836 | Sediment (Intertidal) | MSSSDGIGSLRSIEDQFDRECAAVSDLRSLEDIRNRYLSRKSGLLTTQL |
| Ga0068863_1005294111 | 3300005841 | Switchgrass Rhizosphere | MSSSDGIGQLHSIEDQFVRECASVSDLRSLEHIRNRYLSRKSGLL |
| Ga0068860_1013278543 | 3300005843 | Switchgrass Rhizosphere | MSSSDGIGNLRSIEHQFDRECVSVADIRALEDIRNRYLSRKSGLLTTQLQNLRNIP |
| Ga0068860_1022821891 | 3300005843 | Switchgrass Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNRYLSRKSGLLTLQLQ |
| Ga0066658_105702271 | 3300006794 | Soil | MSSNDGIGRLRAIERQFDEDRVSVADLKAVEDIRTRYLSRKAGLLTLELQNLGKLPK |
| Ga0066660_108715693 | 3300006800 | Soil | VSSNDGIGRLRAIEGQFDRERASVLDLKSLEDVRARYLSRKSGFLTLELQN |
| Ga0075428_1016697631 | 3300006844 | Populus Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNRFLSRKSGLLTLQLQNVRSVPAT |
| Ga0075428_1022217231 | 3300006844 | Populus Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEEFRNRFLSRKSGLLTIQLQNVRNVPPVE |
| Ga0075433_101316701 | 3300006852 | Populus Rhizosphere | MSSKTGIEQLRAIEEQFDRECGAVSDPRSLEEIRNRYLSRKSGILTTQLQNLKD |
| Ga0079217_102719824 | 3300006876 | Agricultural Soil | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNRYLSRKSGLLTLQL |
| Ga0079219_109209891 | 3300006954 | Agricultural Soil | MSSNSGIEQLRAVEQQFEAERASVVDSRSLEDIRARFLSRKSGLLTLQLQLLSKLP |
| Ga0111539_112932032 | 3300009094 | Populus Rhizosphere | MSSNDGIGRLRAIEQQFDTERASVVDRKALEGTRARYLSRKSGLLTLE |
| Ga0105243_112657503 | 3300009148 | Miscanthus Rhizosphere | MSSEWIGQLRSIEQQFDRDRESVADLRSLEELKNRFLSRKSGLLTLQLQNVRNV |
| Ga0105243_115272653 | 3300009148 | Miscanthus Rhizosphere | MSSSDGIGQLRSIEDQFDRECAAVADLRSLEDIRNRYLSRKSGLLTTQLQNLRN |
| Ga0075423_115305663 | 3300009162 | Populus Rhizosphere | MSSNDGIGRLRAIEQQFDTESVSVVDHKSLEDTRARYLSRKS |
| Ga0105241_124530601 | 3300009174 | Corn Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNKYLSRKS |
| Ga0103860_101428161 | 3300009243 | River Water | MSSGIEFDQLHAIEQQFDKDAACVSSLRSLEDIRTLYLSRKSGLLTAQLQNLRQ |
| Ga0105238_105330423 | 3300009551 | Corn Rhizosphere | MSSNDAIDTLRSIHDQFDRECSAVADLRALEDIRNRYLSRKSGLLTLQL |
| Ga0126384_115376982 | 3300010046 | Tropical Forest Soil | VSSKDGIDRLKAIEQQFDTERVSVADRKSLEDARTRYLSR |
| Ga0126384_118524172 | 3300010046 | Tropical Forest Soil | MSSNDGVGRLRAIEQQFDADRVRVADRKALEDIRNRYLSRKSG |
| Ga0126382_116096742 | 3300010047 | Tropical Forest Soil | MSSEWIGQLRSIEQQFDHDRESVPDLRSLEDFKNRYLAR |
| Ga0127492_10328083 | 3300010087 | Grasslands Soil | VSSSDGIGRLRAIERQFDRDRISVADLKSLEDIRTRYLSRKAGLLTLELQNLGK |
| Ga0127495_10169311 | 3300010115 | Grasslands Soil | VSSSDGIGRLRAIERQFDRDRISVADLKSLEDIRTRYLSRKAGLLTLELQNLGKL |
| Ga0127483_12255631 | 3300010142 | Grasslands Soil | VSSSDGIGRLRAIERQFDRDRIAVADLKSLEDIRTRYLSRKAGLL |
| Ga0134088_106589422 | 3300010304 | Grasslands Soil | VSSNDGIGKLRAIEEQFEQDRASAVDLKSLEDLRARYLSRKSGILTLELQN |
| Ga0134067_103430611 | 3300010321 | Grasslands Soil | VSSSDGIGRLRAIERQFDRDRISVADLKSLEDIRTRYLSRKAGLLT |
| Ga0126379_136781781 | 3300010366 | Tropical Forest Soil | MSSNDGIGRLRAIEQQFDTESVSVVDHRSLEDTRA |
| Ga0134124_108622631 | 3300010397 | Terrestrial Soil | MSSNDGIGRLRTIEQQFDGERMSVVDRKSLEDTRARYLSR |
| Ga0134124_114260573 | 3300010397 | Terrestrial Soil | MSTTGIGQLRSIEQQFERDCASVADLRGLEDLRNRYLSRKS |
| Ga0134121_103535014 | 3300010401 | Terrestrial Soil | MSSSDGIGNLRSIEQQFDRESASIADLRALDDIRNKYLSRKSGLLTTELQ |
| Ga0150983_123490563 | 3300011120 | Forest Soil | VSSNDGIGRLRAIEGQFDRERASVLDLKSLEDIRTRYLSRKSGLLTLELQNLGKLPK |
| Ga0137457_11985192 | 3300011443 | Soil | MSSNDGIGRLRAIEQQFDAERVSVVDQRSLEDTRTRYLSR |
| Ga0150985_1002783613 | 3300012212 | Avena Fatua Rhizosphere | MSSSDGIGNLRAIEQQFDRECASIADLRELEAIRNRYLSRKSGLV |
| Ga0150985_1108773131 | 3300012212 | Avena Fatua Rhizosphere | MSSSTGIDHLLSIEQQFDRERESAVDLRALDDIRNRYLSRKSGLLTLQLQNLKS |
| Ga0150985_1132036111 | 3300012212 | Avena Fatua Rhizosphere | MSSNDGIGRLRGIEEQFDTESSSVVDRKSLEDARTRYVSRKSGLL |
| Ga0137370_104451013 | 3300012285 | Vadose Zone Soil | MSSNDGIARLRTIKQQFDAECVSVVDHKSLEDFRNRYLSRKAGVLTLELQSLGKL |
| Ga0134051_12372944 | 3300012398 | Grasslands Soil | VSSSDGIGKLRAIERQFDRDRISVADLKSLEDIRTRYLSRKAGLL |
| Ga0134060_11723111 | 3300012410 | Grasslands Soil | MSSNEGIDKLRAIEQQFDRERASVVDRKSLEDIRSR |
| Ga0134060_14385434 | 3300012410 | Grasslands Soil | MSSHDGIGRLRAIELQFDADRVSVADLKAVEDIRTRYLSRKAGLLTLELQNL |
| Ga0150984_1008608932 | 3300012469 | Avena Fatua Rhizosphere | MSSKSGIEQLRAVEQQFDAERASVVDSRSLEDIRSRFLSRKSGLL |
| Ga0150984_1131228984 | 3300012469 | Avena Fatua Rhizosphere | MSSNDGIGRLRGIEEQFDTESSSVVDRKSLEDARTRYLSRKSGLLTLELQNLGKLPK |
| Ga0150984_1144112923 | 3300012469 | Avena Fatua Rhizosphere | MSSNGGIDSLRVLEQQFDKELAAVVDHRSLEDIRTRYLSRKSGLLTLQLQSLGKLP |
| Ga0150984_1147385061 | 3300012469 | Avena Fatua Rhizosphere | VSSTDGIGRLRAIEAQFKEECASVGDLKSLEEVRTRYVSRKS |
| Ga0150984_1229846791 | 3300012469 | Avena Fatua Rhizosphere | VSSNDGIGRLKAIEQQFETERVSVADRKSLEDARTRYLSRKSGLLTLELQNL |
| Ga0137398_101911341 | 3300012683 | Vadose Zone Soil | MSSSDGIGQLRSIEQQFDRESASVADLRALEDIRNRYLSRKSGLLTTQLQNL |
| Ga0157305_101360841 | 3300012891 | Soil | MSSEWIGQLRSIAQQFDRDRESVADLRSLEDIRNRYLSRKSG |
| Ga0137395_112889242 | 3300012917 | Vadose Zone Soil | VSSNDGIGRLRAIEGQFDQERASVADLKSLEDIRTRYLSRKSGLLTLELQNLG |
| Ga0137396_105228464 | 3300012918 | Vadose Zone Soil | MSSNEGIDKLRAMEQQFDRERASVVDRKSLEDIRTRYLSRKSGLL |
| Ga0137394_110811681 | 3300012922 | Vadose Zone Soil | MSSNDGIEKLRAIEQQFDRERASVVDGKSLEDIRTRYLSRKS |
| Ga0126375_119484552 | 3300012948 | Tropical Forest Soil | MSSNDGVGRLRAIEQQFDVDRVRIADRKSLEDIRN |
| Ga0134077_104524951 | 3300012972 | Grasslands Soil | MSSNDGIDKLRAIEQQFDRERASVVDRKSLEDIRTRYLSRKSGLLTLQLQNLGQL |
| Ga0163163_120163251 | 3300014325 | Switchgrass Rhizosphere | MSSNDGIGRLRAIEQQFDTERASVVDRKSLEEARGRYVSRKSGLLTL |
| Ga0180062_11636242 | 3300014879 | Soil | MSSSTGIDQLRSIEQQFDRERESVADLRSLEELRNCYLSRKSGLLTVQLQ |
| Ga0157376_127208492 | 3300014969 | Miscanthus Rhizosphere | MSSDGIGQLRSIEDQFVRECAAVSDLRALEEIRNRYLSRKSGLLTT |
| Ga0137405_11151141 | 3300015053 | Vadose Zone Soil | MSSNEGIDKLRAIEQQFDRERASVVDRKSLEKTSG |
| Ga0132258_114119675 | 3300015371 | Arabidopsis Rhizosphere | MSTTGIGQLRSIEQQFERDCASVADLRGLEDLRNRYVG |
| Ga0132258_126995664 | 3300015371 | Arabidopsis Rhizosphere | MSSNTGIDHLRSIEQQFDRERESVADLRALDDIRNRYLSRKSGLLTLQLQNLKNLP |
| Ga0182041_123193801 | 3300016294 | Soil | VSSNDGIGRLRAIEQQFDAERASVVDRKSLEDARTRYLSRKNGLLTVELQNLGKL |
| Ga0182034_109942991 | 3300016371 | Soil | MSSNGIGRLRAIEQQFDTESVSVVDRKSLEDTRTRYLSRKSGLLTLELQSLGKLPK |
| Ga0187784_108804263 | 3300018062 | Tropical Peatland | MPPKTGIEQLRAIEQQFDSDQASIADLRSLEDVRARYLSRKSGLLTQQLQS |
| Ga0184637_102579691 | 3300018063 | Groundwater Sediment | MSSKTGVEQLRAIEEQFDRECRAVSDSRALEDIRNRYLSRKSGILTA |
| Ga0190272_133369342 | 3300018429 | Soil | MPSKTGIDQLLALEQQFDSELAAVVDRRSLEDIRARFLSRKSGLLTLQLQNLGK |
| Ga0066667_100974191 | 3300018433 | Grasslands Soil | MSSNDGIGRLRAIERQFDEDRVSVADLKAVEDIRTRYL |
| Ga0193712_10057526 | 3300019880 | Soil | MSSSAGIGQLRSIEQQFDRECASVADLRALEDIRN |
| Ga0180107_11614133 | 3300020064 | Groundwater Sediment | MSSKIGIDQLCALEQQFDSERATVVDRRSLEDIRARYLSRKSGLLTHQLQGLKELPA |
| Ga0179594_100449454 | 3300020170 | Vadose Zone Soil | MSSNEGIDKLRAIEQQFDRERASVVDRKSLEDIRTRYLSRKSGLLTLQLQNLGQLP |
| Ga0247784_10736471 | 3300023270 | Plant Litter | MSSSDGIGSLHSIEEQFDRECAAVSDLRSLDDVRNRYLSRKSGLLTTQLQNL |
| Ga0207659_114163912 | 3300025926 | Miscanthus Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNRYLS |
| Ga0207706_101235981 | 3300025933 | Corn Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSFEELKNRYLSRKSGLLTLQLQNVRNVP |
| Ga0207686_102362824 | 3300025934 | Miscanthus Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNRFLSRKSGLLTLQLQNVRN |
| Ga0207704_104135761 | 3300025938 | Miscanthus Rhizosphere | MSSSDGIGNLRSLRSIEEQFDRDCASIADVRALEDIRNRYLSRKSG |
| Ga0207689_111857073 | 3300025942 | Miscanthus Rhizosphere | MSSSDGIGNLRSIEHQFDRECVSVADIRALEDIRNRYLSRKSGLL |
| Ga0207641_103252981 | 3300026088 | Switchgrass Rhizosphere | MSSSDGIGNLRSLRSIEEQFDRECASIADVRALEDIRNRYLSRKSGLLTTQL |
| Ga0207641_113772551 | 3300026088 | Switchgrass Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNRY |
| Ga0207648_103136994 | 3300026089 | Miscanthus Rhizosphere | MSSSDGIGNLRSLRSIEEQFDRECASIADVRALEDIRNRYLSRKSG |
| Ga0209056_106955531 | 3300026538 | Soil | VSSNDGIGRLRAIEGQFDRERASVLDLKSLEDIRARYLSRKSG |
| Ga0209376_11074744 | 3300026540 | Soil | MSSNDGIGRLRAIERQFDEDRVSVADLKAVEDIRTRY |
| Ga0209382_104479591 | 3300027909 | Populus Rhizosphere | MSSDGIDQLRVLEQQFARELPSVVDQRSLEDIRSRYLSRKSGLLSIQLQSLRSLPASER |
| Ga0268266_119989131 | 3300028379 | Switchgrass Rhizosphere | MSSEWIGQLRSIEQQFDRDRESVADLRSLEELKNRFLSRKSG |
| Ga0268264_116339342 | 3300028381 | Switchgrass Rhizosphere | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNRYLSRKSGLLTLQLQNVRNVP |
| Ga0137415_1000340822 | 3300028536 | Vadose Zone Soil | MSSNEGIDKLRAIEQQFDRERASVVDRKSLEDIRT |
| Ga0308181_10722691 | 3300031099 | Soil | MTSKAGIEQLRAIEEQFDRECEAVSDPRSLEEVRNRYLSRKSGILTTQLQNLKDL |
| Ga0308181_11884572 | 3300031099 | Soil | MSSDGIGQLRSIEGQFDRECAAVSDLRSLEDIRNRYLSRKSGLLTTQLQN |
| Ga0307498_101712223 | 3300031170 | Soil | MSSNDGIGQLRSIEDQFDRECAGVADLRSLEDIRNRYLSRKSGLLT |
| Ga0310886_100894831 | 3300031562 | Soil | MSSEWIGQLRSIAQQFDRDRESVADLRSLEDIRNRYLSRKSGLLTLQLQNVRNVP |
| Ga0307468_1009178563 | 3300031740 | Hardwood Forest Soil | MSSNDGIGRLRAIEQQFDTDCVSVVDHKSLEDTRGRY |
| Ga0306925_112965461 | 3300031890 | Soil | VSSNDGIGRLRAIEQQFDAERVSVADRKSLADALTRYLSRKSGLLTLELQNLGKL |
| Ga0310912_110678822 | 3300031941 | Soil | VSSNDGIGRLRAIEQQFDGERTSVVDRKSLEDARTRYLSRKSGLL |
| Ga0310903_105440792 | 3300032000 | Soil | MSSEWIGQLRSIEQQFDRDRESVADLRSLEELKNRFLSRKSGLLTLQLQSVRNVPSAE |
| Ga0310890_115603681 | 3300032075 | Soil | MSSEWIGQLRSIEQQFDRERESVADLRSLEELKNRFLSRKSGLLTLQLQ |
| Ga0315912_111381201 | 3300032157 | Soil | MSSEWIGQLRSIEQQFDLDRESVADLRSLEDLRNRYLARKSGLLTNQLQNVRSIP |
| Ga0307471_1005969881 | 3300032180 | Hardwood Forest Soil | MSSSDGIGRLRAIERQFDRDRISVADLKSLEDIRTRYLSRKAGLLTL |
| Ga0314782_165716_389_550 | 3300034661 | Soil | MSSEWIGQLRSIAQQFDRDRESVADLRSLEDIRNRYLSRKSGLLTLQLQNVRNV |
| Ga0314783_066930_556_708 | 3300034662 | Soil | MSSEWIGQLRSIEQQFDRDRESVADLRSLEELKNRFLSRKSGLLTLQLQSV |
| Ga0314786_010236_3_125 | 3300034664 | Soil | MSSEWIGQLRSIAQQFDRDRESVADLRSLEDIRNRYLSRKS |
| Ga0314787_049933_1_129 | 3300034665 | Soil | MSSNDGIGRLRAIEQQFDADRVSVVDHKSLEDTRTRYLSRKSG |
| Ga0314792_201601_434_559 | 3300034667 | Soil | MSSEWIGQLRSIEQQFDRERESVADLRSLEDIRNRYLSRKSG |
| Ga0314792_203317_2_172 | 3300034667 | Soil | MSSEWIGQLRSIEQQFDRDRGAVADLRSLEDIRNRYLARKSGLLTSQLQNIRNRYLA |
| Ga0314794_141624_381_548 | 3300034669 | Soil | MSSEWIGQLRSIAQQFDRDRESVADLRSLEDIRNRYLSRKSGLLTLQLQNVRNVPT |
| ⦗Top⦘ |