| Basic Information | |
|---|---|
| Family ID | F082431 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAMFTEKGNGGPESEAGLSIIGTGMRVVGDITADGVVKIE |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.46 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 89.38 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.009 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.363 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.327 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01551 | Peptidase_M23 | 86.73 |
| PF13614 | AAA_31 | 5.31 |
| PF01656 | CbiA | 1.77 |
| PF08535 | KorB | 1.77 |
| PF02195 | ParBc | 1.77 |
| PF13932 | GIDA_C | 0.88 |
| PF00266 | Aminotran_5 | 0.88 |
| PF04519 | Bactofilin | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1475 | Chromosome segregation protein Spo0J, contains ParB-like nuclease domain | Cell cycle control, cell division, chromosome partitioning [D] | 1.77 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002886|JGI25612J43240_1049930 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300002907|JGI25613J43889_10026581 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300004153|Ga0063455_100298930 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300004778|Ga0062383_10470695 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005166|Ga0066674_10307704 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005167|Ga0066672_10626684 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005206|Ga0068995_10006407 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300005334|Ga0068869_100054214 | All Organisms → cellular organisms → Bacteria | 2918 | Open in IMG/M |
| 3300005406|Ga0070703_10314731 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005447|Ga0066689_10015542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3600 | Open in IMG/M |
| 3300005468|Ga0070707_100326425 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300005553|Ga0066695_10111238 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300005556|Ga0066707_10511779 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005556|Ga0066707_10516257 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005557|Ga0066704_10655359 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005558|Ga0066698_10460633 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 866 | Open in IMG/M |
| 3300005566|Ga0066693_10287919 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005886|Ga0075286_1008635 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300006034|Ga0066656_10149638 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300006046|Ga0066652_101363197 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300006796|Ga0066665_10941903 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_69_8 | 666 | Open in IMG/M |
| 3300006797|Ga0066659_10065143 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300006846|Ga0075430_100354045 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300006854|Ga0075425_100369831 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300007258|Ga0099793_10024624 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300007258|Ga0099793_10180909 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300007265|Ga0099794_10313671 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300009038|Ga0099829_10071462 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300009088|Ga0099830_10457889 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1037 | Open in IMG/M |
| 3300009089|Ga0099828_10314851 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300009089|Ga0099828_10542981 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300009137|Ga0066709_101142839 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300009147|Ga0114129_10773944 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300009147|Ga0114129_11828419 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300010301|Ga0134070_10432809 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010321|Ga0134067_10028877 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300010321|Ga0134067_10301581 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010321|Ga0134067_10448574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 526 | Open in IMG/M |
| 3300010323|Ga0134086_10056096 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300010323|Ga0134086_10081680 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300010323|Ga0134086_10121658 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300010333|Ga0134080_10127531 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300010335|Ga0134063_10202692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 934 | Open in IMG/M |
| 3300010337|Ga0134062_10000512 | All Organisms → cellular organisms → Bacteria | 12255 | Open in IMG/M |
| 3300010362|Ga0126377_10298930 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300011269|Ga0137392_10233559 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300011421|Ga0137462_1083113 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012096|Ga0137389_10742559 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012189|Ga0137388_11015554 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300012198|Ga0137364_10803000 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012199|Ga0137383_10838253 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012203|Ga0137399_11593255 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012204|Ga0137374_11156373 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012207|Ga0137381_10313608 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012207|Ga0137381_10994911 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012208|Ga0137376_10264601 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300012211|Ga0137377_11445314 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012357|Ga0137384_11291733 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 576 | Open in IMG/M |
| 3300012363|Ga0137390_11338789 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012398|Ga0134051_1032407 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012409|Ga0134045_1402120 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012917|Ga0137395_10483147 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300012924|Ga0137413_11229002 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012927|Ga0137416_11109519 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300014157|Ga0134078_10133908 | Not Available | 961 | Open in IMG/M |
| 3300014157|Ga0134078_10144430 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300014872|Ga0180087_1021893 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300015242|Ga0137412_11086543 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300015359|Ga0134085_10233432 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300015374|Ga0132255_100354854 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300017654|Ga0134069_1044491 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300017656|Ga0134112_10344299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 607 | Open in IMG/M |
| 3300017659|Ga0134083_10087947 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300017659|Ga0134083_10342388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 642 | Open in IMG/M |
| 3300017939|Ga0187775_10528628 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018058|Ga0187766_11432618 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018059|Ga0184615_10434588 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300018077|Ga0184633_10285761 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300018431|Ga0066655_10574877 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300019360|Ga0187894_10019639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4846 | Open in IMG/M |
| 3300020004|Ga0193755_1113945 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300021073|Ga0210378_10003968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7049 | Open in IMG/M |
| 3300021972|Ga0193737_1055322 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021972|Ga0193737_1067174 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300022717|Ga0242661_1139802 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300022756|Ga0222622_10917442 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300024246|Ga0247680_1011582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae | 1292 | Open in IMG/M |
| 3300024325|Ga0247678_1082353 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025955|Ga0210071_1034769 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300026298|Ga0209236_1044281 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
| 3300026307|Ga0209469_1095662 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 839 | Open in IMG/M |
| 3300026310|Ga0209239_1184515 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300026326|Ga0209801_1313761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 555 | Open in IMG/M |
| 3300026327|Ga0209266_1039144 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
| 3300026335|Ga0209804_1035321 | All Organisms → cellular organisms → Bacteria | 2512 | Open in IMG/M |
| 3300026523|Ga0209808_1133296 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300026537|Ga0209157_1126024 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300026537|Ga0209157_1127220 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300026540|Ga0209376_1284106 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300026540|Ga0209376_1353188 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300026542|Ga0209805_1162268 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300026557|Ga0179587_10649570 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300027490|Ga0209899_1109324 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300027765|Ga0209073_10206939 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300027882|Ga0209590_10931520 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
| 3300027886|Ga0209486_11080581 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027949|Ga0209860_1052913 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300027950|Ga0209885_1009939 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300028885|Ga0307304_10621279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 501 | Open in IMG/M |
| 3300031965|Ga0326597_11236799 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300032180|Ga0307471_103995477 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300032954|Ga0335083_10435375 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300033811|Ga0364924_128160 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 16.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.65% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.77% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25612J43240_10499301 | 3300002886 | Grasslands Soil | MALFTEKGGTGGDGVTGLSIIGTGMRVVGDISADGVVKIE |
| JGI25613J43889_100265813 | 3300002907 | Grasslands Soil | MAVFSDKGAGTTAPGRXGVPGXSIIGAGMRVIGDISADGVVKIEGSVNGTVRAAK |
| Ga0063455_1002989301 | 3300004153 | Soil | MAVFNEKGTNPGEKGVPGLSIIGAGMRVVGDISADGVVKIEGA |
| Ga0062383_104706951 | 3300004778 | Wetland Sediment | MAVFSDKNASGPGREAVPGLSIIGAGMRVVGDISADGVVKIE |
| Ga0066674_103077041 | 3300005166 | Soil | MAIFTEKGQGAPESETGLSIIGAGMRVVGDITAEGVVKIEGT |
| Ga0066672_106266842 | 3300005167 | Soil | MAVFSEKGASGNTGSREGVPGLSIIGAGMRVVGDISADGVVK |
| Ga0068995_100064071 | 3300005206 | Natural And Restored Wetlands | MAVFNDKVNGEKGVPGLSIIGAGMRVVGDISADGVVKIEGAVNGTV |
| Ga0068869_1000542141 | 3300005334 | Miscanthus Rhizosphere | MAVFNEKVAGEKGVPGLSIIGAGMRVVGDISADGVVKIEGAVNGTV |
| Ga0070703_103147311 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVFSEKSTTPGGVPGLSIIGAGMRVIGDISADGVVKIEGSVNGT |
| Ga0066689_100155421 | 3300005447 | Soil | MAIFTEKGQGVPETEAGLSIIGTGMRVVGDITAEGVVKIEGAV |
| Ga0070707_1003264253 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMFTEKGGAGGDGVTGLSIIGAGMRVVGDISAEGVVKIEGTVV |
| Ga0066695_101112381 | 3300005553 | Soil | MAVFSEKTPTSAGGREAVPGLSIIGAGMRVIGDISADGVVKI |
| Ga0066707_105117791 | 3300005556 | Soil | MAVFSEKGAGSGPVRDGVPGLSIIGAGMRVVGDISADGVVKIEGSVN |
| Ga0066707_105162571 | 3300005556 | Soil | MAIFTEKGQGVPETEAGLSIIGTGMRVVGDITAEGVVKIEGAVVG |
| Ga0066704_106553592 | 3300005557 | Soil | MAVFSEKNPTPGGGREGVPGLSIIGAGMRVVGDISA |
| Ga0066698_104606331 | 3300005558 | Soil | MAMFTEKGQGALESEAGLSIIGTGMRVVGDISADG |
| Ga0066693_102879191 | 3300005566 | Soil | MAVFSEKTPGPANTREGVPGLSIIGAGMRVVGDISADGVVKI |
| Ga0075286_10086353 | 3300005886 | Rice Paddy Soil | MAMFTEKGQGGLESEAGLSIIGTGMRVVGDITADGVVKI |
| Ga0066656_101496381 | 3300006034 | Soil | MAVFSEKTPTSAGGREAVPGLSIIGAGMRVIGDISADGV |
| Ga0066652_1013631971 | 3300006046 | Soil | MAMFTEKGQGAPEAEAGLSIIGTGMRVVGDITADGVVKIEGTVV |
| Ga0066665_109419031 | 3300006796 | Soil | MAIFTEKQHAGPESEAGLSIIGTGMRVEGDVSADGVVK |
| Ga0066659_100651431 | 3300006797 | Soil | MAIFTEKGHGAPESEAGLSIIGAGMRVEGDIVPEGV |
| Ga0075430_1003540451 | 3300006846 | Populus Rhizosphere | MAVFSEKTVASGGREGVPGLSIIGAGMRVVGDISADGV |
| Ga0075425_1003698313 | 3300006854 | Populus Rhizosphere | MAVFSEKGTGPGSGREGVPGLSIIGAGMRVVGDISADGVVKI |
| Ga0099793_100246244 | 3300007258 | Vadose Zone Soil | MAVFSEKNATPGGGREGVPGLSIIGAVMRVVGDISADGVGKSE* |
| Ga0099793_101809092 | 3300007258 | Vadose Zone Soil | MAVFSEKSASPAGGRDGVPGLSIIGAGMRVVGDISADGVVKIEGSVSGT |
| Ga0099794_103136712 | 3300007265 | Vadose Zone Soil | MAIFTEKGHGAPESEAGLSIIGAGMRVEGDIVAEAS* |
| Ga0099829_100714621 | 3300009038 | Vadose Zone Soil | MAVFTEKGQGPLDSEAGLSIIGTGMRVVGDITADGV |
| Ga0099830_104578893 | 3300009088 | Vadose Zone Soil | MAMFTEKGQGASDGEAGLSIIGTGMRVVGDITADGVVKIEG |
| Ga0099828_103148513 | 3300009089 | Vadose Zone Soil | MAMFTEKGQGASDGEAGLSIIGTGMRVVGDITADGVV |
| Ga0099828_105429813 | 3300009089 | Vadose Zone Soil | VATFTEKGQGPLDSEAGLSIIGTGMRVVGDITADGVVKIEGTV |
| Ga0066709_1011428393 | 3300009137 | Grasslands Soil | MAIFTEKGQGAPESETGLSIIGAGMRVVGDITAEG |
| Ga0114129_107739443 | 3300009147 | Populus Rhizosphere | MAMFTEKGGAGGDGVTGLSIIGAGMRVVGDISAEG |
| Ga0114129_118284191 | 3300009147 | Populus Rhizosphere | MALFTEKGGPGGDGVTGLSIIGTGMRVVGDISADGVVK |
| Ga0134070_104328092 | 3300010301 | Grasslands Soil | MAVFSEKTPTSAGGREAVPGLSIIGAGMRVIGDISADGVVKIEGSVN |
| Ga0134067_100288771 | 3300010321 | Grasslands Soil | MAMFTEKGQGGLESESGLSIIGKGMRVVGDITADGVVKIEGTV |
| Ga0134067_103015811 | 3300010321 | Grasslands Soil | MALFTEKSHGQGDAEAGLSIIGTGMRVVGDITAEGVVKVE |
| Ga0134067_104485741 | 3300010321 | Grasslands Soil | MAIFTEKGQGAPESETGLSIIGAGMRVVGDITAEGV |
| Ga0134086_100560961 | 3300010323 | Grasslands Soil | MFTEKGQGAPESESGLSIIGTGMRVVGDISAEGVVKIEGT |
| Ga0134086_100816803 | 3300010323 | Grasslands Soil | MAVFSEKGASGNTGGTREGVPGLSIIGAGMRVVGDIS |
| Ga0134086_101216581 | 3300010323 | Grasslands Soil | MAMFTEKGQGPLDSEAGLSIIGTGMRVVGDITADGVVKIEG |
| Ga0134080_101275311 | 3300010333 | Grasslands Soil | MAVFSDKSPGSSGGGTREGVPGLSIIGAGMRVVGDISADGVVKIEGSVN |
| Ga0134063_102026921 | 3300010335 | Grasslands Soil | MAMFTEKGQGGLESESGLSIIGTGMRVVGDITADGV |
| Ga0134062_100005121 | 3300010337 | Grasslands Soil | MAMFTEKGQGAPESESGLSIIGTGMRVVGDISAEG |
| Ga0126377_102989301 | 3300010362 | Tropical Forest Soil | MAMFTEKSGLSAAEAGLSIIGSGMRVVGDISAEGVVKIEGTV |
| Ga0137392_102335591 | 3300011269 | Vadose Zone Soil | MAMFTEKGQGPLDSEAGLSIIGTGMRVVGDITADG |
| Ga0137462_10831131 | 3300011421 | Soil | MAVFNDKGTTPREGAPGLSIIGAGMRVVGDISADGV |
| Ga0137389_107425592 | 3300012096 | Vadose Zone Soil | MAMFTEKGQGPLDSEAGLSIIGTGMRVVGDITADGVVKIEGTVVGT |
| Ga0137388_110155541 | 3300012189 | Vadose Zone Soil | MAIFTEKGHGAPESEAGLSIIGAGMRVEGDIVAEGVVKIEGT |
| Ga0137364_108030002 | 3300012198 | Vadose Zone Soil | MAVFSEKSATGGREGVQGLSIIGAGMRVVGDISADGVVKIEG |
| Ga0137383_108382532 | 3300012199 | Vadose Zone Soil | MAVFSEKNPTPGGGREGVPGLSIIGAGMRVVGDISADGVVKIEGSVNGTV |
| Ga0137399_115932551 | 3300012203 | Vadose Zone Soil | MAIFTERQRGGPESDAGLSIIGTGMRVEGDVSADGVVKVEGSI |
| Ga0137374_111563732 | 3300012204 | Vadose Zone Soil | MAMFTEKGGAGGDVVTGLSIIGAGMRVVGDISAEGVVKIEGTVVGTVQ |
| Ga0137381_103136081 | 3300012207 | Vadose Zone Soil | MAIFTEKGHGAPEGESGLSIIGTGMRVVGDITADGVVKIEG |
| Ga0137381_109949111 | 3300012207 | Vadose Zone Soil | MALFTEKSHGQGDAEAGLSIIGTGMRVVGDITAEGVVKVEGTVVGT |
| Ga0137376_102646013 | 3300012208 | Vadose Zone Soil | MAVFSEKSATPAGGRDGVPGLSIIGAGMRVVGDISA |
| Ga0137377_114453141 | 3300012211 | Vadose Zone Soil | MAVFSEKGASGNTGSTREGVPGLSIIGAGMRVVGDISADGVV |
| Ga0137384_112917331 | 3300012357 | Vadose Zone Soil | MAMFTEKGQGPLDSEAGLSIIGTGMRVVGDITADGVVKIEGT |
| Ga0137390_113387892 | 3300012363 | Vadose Zone Soil | MAMFTEKSGLSATEAGLSIIGSGMRVVGDISAEGVVKIE |
| Ga0134051_10324072 | 3300012398 | Grasslands Soil | MAVFSEKGATPAAGRDGVPGLSIIGAGMRVVGDISADGVVKIEGSVSGTV |
| Ga0134045_14021202 | 3300012409 | Grasslands Soil | MSVFSEKTPGSGGAREGVPGLSIIGAGMRVVGDISADGVVKIEGSVNG |
| Ga0137395_104831471 | 3300012917 | Vadose Zone Soil | MAVFSEKATGSGVGREGVPGLSIIGAGMHVVGDIS |
| Ga0137413_112290022 | 3300012924 | Vadose Zone Soil | MAVFSEKNPTPGSGRDGVPGLSIIGAGMRVVGDISADGVVKIEGSVNG |
| Ga0137416_111095191 | 3300012927 | Vadose Zone Soil | MAMFTEKGQSPLDSEAGLSIIGTGMRVVGDITADGVVKIEGT |
| Ga0134078_101339081 | 3300014157 | Grasslands Soil | MAIFTEKGQGAPESETGLSIIGVGMRVVGDITAEG |
| Ga0134078_101444302 | 3300014157 | Grasslands Soil | MAVFSEKGAAPGPVREGVPGLSIIGAGMHVVGDISADGVVKI |
| Ga0180087_10218933 | 3300014872 | Soil | MAVFNDKGTTPREGAPGLSIIGAGMRVVGDISADG |
| Ga0137412_110865432 | 3300015242 | Vadose Zone Soil | MALFTEKGGAGGDGVTGLSIIGAGMRVVGDISADGVVKIEGT |
| Ga0134085_102334321 | 3300015359 | Grasslands Soil | MAIFTEKGHGAPETETGLSIIGTGMRVVGDITAEGVVK |
| Ga0132255_1003548541 | 3300015374 | Arabidopsis Rhizosphere | MAVFSDKTPSSGGSAREGVPGLSIIGAGMRVIGDIS |
| Ga0134069_10444913 | 3300017654 | Grasslands Soil | MAVFSEKGASGNTGGTREGVPGLSIIGAGMRVVGDISADGVVKIEG |
| Ga0134112_103442991 | 3300017656 | Grasslands Soil | MAMFTEKGQGAPESETGLSIIGAGMRVVGDITAEGVVKIEGT |
| Ga0134083_100879471 | 3300017659 | Grasslands Soil | MAVFSEKGASGNTGGTREGVPGQSIIGAGMRVVGD |
| Ga0134083_103423881 | 3300017659 | Grasslands Soil | MAIFTEKGQGAPESETGLSIIGVGMRVVGDITAEGVVKIEGTV |
| Ga0187775_105286281 | 3300017939 | Tropical Peatland | MAIFTEKGATAGGSDATLSIIGTGMRVVGDITAEGVVKVEGTVQGTVQ |
| Ga0187766_114326181 | 3300018058 | Tropical Peatland | MAIFTEKGANPGGSDATLSIIGAGMRVVGDITAEGVVKVEG |
| Ga0184615_104345881 | 3300018059 | Groundwater Sediment | MAMFTEKGPGGGAESGTGLSIIGAGMKVVGDLTAEGVVKIEGT |
| Ga0184633_102857611 | 3300018077 | Groundwater Sediment | MAVFTEKSPAGGREAVPGLSIIGAGMRVVGDISADGVVKIE |
| Ga0066655_105748771 | 3300018431 | Grasslands Soil | MAMFTEKGQGPLDSEAGLSIIGTGMRVVGDITADGVVKIEGTVVG |
| Ga0187894_100196391 | 3300019360 | Microbial Mat On Rocks | MAIFTEKSGAPAGEAGLSIIGSGMRVVGDISAEGVVKIEGT |
| Ga0193755_11139451 | 3300020004 | Soil | MAIFTEKGHGAPESPGALSIIGPGMRVVGDITADGVVK |
| Ga0210378_100039681 | 3300021073 | Groundwater Sediment | MAMFTEKGPGGGAESGTGLSIIGAGMKVVGDLTAEGVVKIEG |
| Ga0193737_10553222 | 3300021972 | Soil | MAMFTEKGGAAGDGISGLSIIGTGMRVVGDISADGVVKIE |
| Ga0193737_10671742 | 3300021972 | Soil | MAMFTEKGPGGGAESGTGLSIIGAGMKVVGDLTAEGVVKIEGTVVGTV |
| Ga0242661_11398021 | 3300022717 | Soil | MAVFTEKTRGGNEGDAALSIIGSGMRVVGDITADGVVKVEGTIV |
| Ga0222622_109174421 | 3300022756 | Groundwater Sediment | MALFTEKGGSGGDVVTGLSIIGAGMRVVGDISAEGVVKIEGTVVGTVQAA |
| Ga0247680_10115821 | 3300024246 | Soil | MAMFTEKGNGGPESEAGLSIIGTGMRVVGDITADGVVKIE |
| Ga0247678_10823532 | 3300024325 | Soil | MAMFTEKSGLSAAEAGLSIIGSGMRVVGDISAEGVVKIEGTVV |
| Ga0210071_10347692 | 3300025955 | Natural And Restored Wetlands | MAIFADKGSGGGDAEAGLSIIAAGMEVVGDIVAEGIVKVEGAVRGNI |
| Ga0209236_10442811 | 3300026298 | Grasslands Soil | MAIFTEKGHGAPESEAGLSIIGAGMRVEGDIVAEGVVKI |
| Ga0209469_10956622 | 3300026307 | Soil | MAIFTEKGHGVPETDTGLSIIGTGMRVVGDITAEGVVKI |
| Ga0209239_11845151 | 3300026310 | Grasslands Soil | MAVFTEKSGSGNREAVPGLSIIGAGMRVVGDISADGVVKIEGS |
| Ga0209801_13137611 | 3300026326 | Soil | MAIFTEKGQGVPETEAGLSIIGTGMRVVGDITAEG |
| Ga0209266_10391444 | 3300026327 | Soil | MAVFSEKTPTSAGGREAVPGLSIIGAGMRVIGDISADGVVKIEGSV |
| Ga0209804_10353211 | 3300026335 | Soil | MAVFSEKNATPGGGREGVPGLSIIGAGMRVVGDISADGVVKIEGSV |
| Ga0209808_11332961 | 3300026523 | Soil | MAVFSEKGASGNTGTSREGVPGLSIIGAGMRVVGDISADGVVKIE |
| Ga0209157_11260243 | 3300026537 | Soil | MAMFTEKGQGGLESESGLSIIGTGMRVVGDISADGVVKIEGTV |
| Ga0209157_11272203 | 3300026537 | Soil | MAVFSEKNPAPGGGREGVPGLSIIGAGMRVVGDISADGS |
| Ga0209376_12841061 | 3300026540 | Soil | MAMFTEKGQGALESESGLSIIGTGMRVVGDISADGVVKIEG |
| Ga0209376_13531882 | 3300026540 | Soil | MAVFSEKGAGSGPVRDGVPGLSIIGAGMRVVGDISADG |
| Ga0209805_11622681 | 3300026542 | Soil | MAVFSEKGASGNTGTSREGVPGLSIIGAGMRVVGDISADGVVKIEGSVSGT |
| Ga0179587_106495701 | 3300026557 | Vadose Zone Soil | MAVFSEKGATPAGGRDGVPGLSIIGAGMRVVGDISADGVVKIEGSVS |
| Ga0209899_11093242 | 3300027490 | Groundwater Sand | MAFLTEKGRGALEPDVGLSIIGTGMRVVGDIMAEGVVKVEGVV |
| Ga0209073_102069391 | 3300027765 | Agricultural Soil | MAVFTEKTRGGSEGDAALSIIGTGMRVVGDITADGVVK |
| Ga0209590_109315201 | 3300027882 | Vadose Zone Soil | MAIFTEKGHGAAADTETGLSIIGTGMRVVGDITAEG |
| Ga0209486_110805812 | 3300027886 | Agricultural Soil | MAVFSEKSPSGGGREAVPGLSIIGAGMRVVGDISADGVVKIE |
| Ga0209860_10529131 | 3300027949 | Groundwater Sand | MAVFTEKGAGGGREGVPGLSIIGAGMRVVGDIAADGVVK |
| Ga0209885_10099393 | 3300027950 | Groundwater Sand | MAVFSDKGASGGGREGVPGLSIIGAGMRVVGDISADGVVKIEGSV |
| Ga0307304_106212792 | 3300028885 | Soil | MAIFTEKGRGTPESQGALSIIGPGMRVVGDITADGVVKIEGTVV |
| Ga0326597_112367991 | 3300031965 | Soil | MAVFNEKATSGGGRDGVPGLSIIGAGMRVVGDIAADGVVKIEGS |
| Ga0307471_1039954771 | 3300032180 | Hardwood Forest Soil | MAVFSEKSATGGREGVPGLSIIGAGMRVVGDISADGVVKIEGSVSGTV |
| Ga0335083_104353751 | 3300032954 | Soil | MAVFTEKSRGAGEGDAALSIIGTGMRVVGDITAEGV |
| Ga0364924_128160_1_132 | 3300033811 | Sediment | MAMFTEKVPGGAESGTGLSIIGAGMKVVGDLTAEGVVKIEGTVV |
| ⦗Top⦘ |